Estatísticas da Wikipédia inglês

Zoom           
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Articles per size range / Records per namespace / Most edited articles / Zeitgeist

Note: for the English Wikipedia data for months after Sep 2006 are based on a partial database dump (only event meta data, no article contents).
Therefore some information for those months can not yet be shown.

 
Monthly counts & Quarterly rankings
 
DataWikipedistasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
set 2009+1% -3%-3%+1% -26%    +2%      +1%
ago 2009+2% -1%+2%+2% -1%    +2%      +2%
jul 2009+2% -1%-1%+2% +26%    -3%      +2%
jun 2009+2% -3%-4%+1% -4%    -8%      +3%
mai 2009+2% +2%+3%+1% -17%    +6%      +2%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P____Q____R____S__
set 200953090077933921139993,1 M 112967,3   4,0 M      3,8 M
ago 200952310786504048841043,0 M 152666,8   3,9 M      3,8 M
jul 200951445791974083940053,0 M 153666,5   3,8 M      3,7 M
jun 200950526089574114840462,9 M 121666,3   4,0 M      3,7 M
mai 200949630394464220942332,9 M 126865,7   4,3 M      3,6 M
abr 200948685792454136841212,9 M 152265,1   4,1 M      3,5 M
mar 2009477612100394387143082,8 M 174964,7   4,4 M      3,4 M
fev 200946757394954142640082,8 M 154464,4   4,2 M      3,4 M
jan 200945807896974312843702,7 M 146763,9   4,4 M      3,3 M
dez 200844838190204040539982,7 M 129363,3   4,1 M      3,3 M
nov 200843936190984082740152,6 M 120162,7   4,1 M      3,2 M
out 200843026397794237942642,6 M 142862,0   4,6 M      3,2 M
set 200953090077933921139993,1 M 112967,3   4,0 M      3,8 M
ago 200952310786504048841043,0 M 152666,8   3,9 M      3,8 M
jul 200951445791974083940053,0 M 153666,5   3,8 M      3,7 M
jun 200950526089574114840462,9 M 121666,3   4,0 M      3,7 M
mai 200949630394464220942332,9 M 126865,7   4,3 M      3,6 M
abr 200948685792454136841212,9 M 152265,1   4,1 M      3,5 M
mar 2009477612100394387143082,8 M 174964,7   4,4 M      3,4 M
fev 200946757394954142640082,8 M 154464,4   4,2 M      3,4 M
jan 200945807896974312843702,7 M 146763,9   4,4 M      3,3 M
dez 200844838190204040539982,7 M 129363,3   4,1 M      3,3 M
nov 200843936190984082740152,6 M 120162,7   4,1 M      3,2 M
out 200843026397794237942642,6 M 142862,0   4,6 M      3,2 M
set 200842048489944079340852,6 M 119161,3   4,4 M      3,1 M
ago 200841149096054212443472,5 M 187460,4   4,2 M      3,0 M
jul 2008401885100354292343652,5 M 170660,1   4,1 M      3,0 M
jun 200839185099524225742352,4 M 141259,7   4,1 M      2,9 M
mai 2008381898107774540344142,4 M 142659,0   4,4 M      2,8 M
abr 2008371121111564634944912,3 M 148758,3   4,4 M      2,8 M
mar 2008359965114304743347392,3 M 186757,5   4,8 M      2,7 M
fev 2008348535108984504243712,2 M 203856,8   4,3 M      2,5 M
jan 2008337637106884525745692,2 M 174656,4   4,3 M      2,5 M
dez 200732694995714183641932,1 M 158755,8   4,1 M      2,4 M
nov 2007317378104804444243352,1 M 145155,1   4,2 M      2,3 M
out 2007306898113984706045312,0 M 146954,2   4,5 M      2,2 M
set 2007295500107214503244582,0 M 164553,2   4,2 M      2,2 M
ago 2007284779111494614346661,9 M 203352,4   4,1 M      2,1 M
jul 2007273630118744780047861,9 M 221651,9   4,2 M      2,0 M
jun 2007261756113934675347351,8 M 169151,5   4,2 M      1,9 M
mai 2007250363134345235150991,7 M 163950,6   4,7 M      1,9 M
abr 2007236929140595349851701,7 M 165949,3   4,8 M      1,8 M
mar 2007222870148045451052211,6 M 168447,9   4,9 M      1,7 M
fev 2007208066139045132549541,6 M 178246,5   4,5 M      1,7 M
jan 2007194162140445156551261,5 M 168145,1   4,6 M      1,6 M
dez 2006180118125874731947191,5 M 161543,6   4,1 M      1,5 M
nov 2006167531125384655146041,4 M 169242,2   4,2 M      1,5 M
out 2006154993119154388244701,4 M 164340,8   4,0 M      1,4 M
set 2006143078112304173642921,3 M 176339,3   3,7 M      1,3 M
ago 2006131848125384299746631,3 M1,3 M207938,0327684%36%3,9 M4,2 Gb577 M30,6 M1,8 M826 k2,4 M1,3 M
jul 2006119310112803891644111,2 M1,2 M201936,9322983%36%3,5 M3,9 Gb539 M28,9 M1,7 M772 k2,2 M1,2 M
jun 2006108030103973656341941,2 M1,2 M179535,8318783%35%3,4 M3,7 Gb505 M27,2 M1,5 M721 k2,1 M1,2 M
mai 200697633100743512940181,1 M1,1 M167534,5314182%35%3,4 M3,4 Gb474 M25,7 M1,4 M675 k1,9 M1,1 M
abr 20068755990923189035971,0 M1,0 M164032,9309281%35%3,0 M3,2 Gb444 M24,2 M1,4 M629 k1,7 M1,0 M
mar 2006784678868307493594998 k990 k166831,5304281%35%3,1 M3,0 Gb416 M22,9 M1,3 M586 k1,6 M960 k
fev 2006695997712266883266947 k936 k162130,0299080%35%2,6 M2,8 Gb387 M21,6 M1,1 M531 k1,5 M901 k
jan 2006618877697254373359901 k887 k165628,6293980%34%2,8 M2,6 Gb362 M20,3 M1,1 M492 k1,3 M849 k
dez 2005541907264225772973850 k832 k148327,1289779%34%2,4 M2,4 Gb335 M19,0 M966 k451 k1,2 M789 k
nov 2005469263850151062085804 k782 k141125,6282978%33%1,9 M2,2 Gb310 M17,8 M895 k414 k1,1 M737 k
out 2005430763953148291981762 k740 k144824,5278878%33%1,7 M2,1 Gb289 M16,7 M835 k388 k996 k693 k
set 2005391233152128801763717 k696 k127023,6276077%33%1,4 M1,9 Gb269 M15,7 M768 k359 k910 k652 k
ago 2005359713827136871988679 k657 k144222,9273377%33%1,5 M1,8 Gb252 M14,7 M694 k331 k832 k614 k
jul 2005321443516125001824634 k612 k139722,1269377%33%1,4 M1,7 Gb232 M13,6 M632 k295 k748 k564 k
jun 2005286282817102011566591 k570 k114921,3266877%33%1,2 M1,5 Gb214 M12,6 M568 k261 k670 k520 k
mai 200525811257094071410556 k535 k101420,5263576%33%1,1 M1,4 Gb199 M11,7 M524 k236 k606 k474 k
abr 200523241240186461366525 k503 k102919,7260476%33%1,0 M1,3 Gb185 M10,9 M476 k214 k549 k441 k
mar 200520840201373881084494 k472 k85618,9256876%33%788 k1,2 Gb172 M10,2 M405 k193 k495 k406 k
fev 20051882714185917873467 k446 k72618,3253675%33%606 k1,1 Gb160 M9,5 M366 k178 k449 k379 k
jan 20051740914345925887447 k425 k72817,8250875%32%620 k1,1 Gb151 M9,0 M341 k164 k412 k361 k
dez 20041597515896004944424 k402 k86717,3247775%32%724 k1,0 Gb142 M8,5 M318 k151 k373 k341 k
nov 20041438615525510990398 k377 k87716,6245375%32%751 k963 Mb131 M7,9 M297 k139 k335 k307 k
out 20041283413784880795371 k351 k74415,8240374%28%584 k881 Mb121 M7,0 M266 k122 k300 k285 k
set 20041145611274302776348 k329 k69415,1236574%28%528 k814 Mb113 M6,5 M237 k110 k271 k265 k
ago 20041032910273863720327 k309 k66414,5233774%28%510 k756 Mb105 M6,1 M211 k97 k246 k246 k
jul 200493029993665642307 k289 k66213,8228774%27%490 k693 Mb97,6 M5,5 M194 k79 k224 k228 k
jun 200483038443100581286 k270 k60013,1226474%27%458 k638 Mb90,5 M5,1 M160 k71 k201 k182 k
mai 200474597962963540268 k253 k56312,2222674%27%335 k586 Mb83,9 M4,7 M147 k60 k180 k164 k
abr 200466637512740518251 k236 k60911,7221474%26%320 k543 Mb78,1 M4,3 M132 k52 k160 k147 k
mar 200459128692722530233 k220 k67211,3221075%26%347 k502 Mb72,5 M4,0 M117 k45 k140 k132 k
fev 200450436832072412212 k202 k53210,8221276%26%243 k458 Mb66,5 M3,6 M103 k38 k121 k110 k
jan 200443604001505299196 k188 k35910,4221676%27%176 k425 Mb62,1 M3,4 M91 k32 k107 k99 k
dez 200339603701332281185 k177 k35710,1219577%26%181 k398 Mb58,4 M3,1 M83 k29 k95 k91 k
nov 200335903661230269174 k167 k3049,7218777%26%162 k373 Mb55,0 M2,9 M64 k26 k85 k82 k
out 200332243281132205165 k158 k2329,2217377%26%124 k351 Mb52,0 M2,7 M56 k24 k76 k73 k
set 20032896267952211158 k151 k2858,8214977%26%115 k333 Mb49,4 M2,6 M51 k22 k69 k67 k
ago 200326293351007219149 k143 k2538,6213778%26%127 k313 Mb46,7 M2,4 M44 k20 k62 k61 k
jul 20032294256868167141 k135 k2678,1211377%26%109 k292 Mb43,8 M2,2 M38 k18 k54 k55 k
jun 20032038215752156133 k126 k2097,8208277%25%96 k270 Mb40,9 M2,0 M34 k13 k48 k49 k
mai 20031823202662154127 k120 k2157,5206077%23%92 k255 Mb38,8 M1,9 M30 k12 k43 k45 k
abr 20031621131509122120 k114 k1847,1202877%22%74 k238 Mb36,6 M1,7 M24 k9,7 k39 k40 k
mar 20031490122479107115 k109 k1736,8200477%22%72 k225 Mb34,8 M1,6 M21 k8,0 k35 k37 k
fev 20031368164550107109 k104 k1786,5197677%22%65 k212 Mb33,0 M1,5 M19 k6,5 k32 k33 k
jan 20031204160503117104 k100 k1956,2195577%21%75 k200 Mb31,3 M1,4 M16 k5,7 k29 k30 k
dez 200210441043519298 k94 k1435,8193677%21%87 k187 Mb29,4 M1,3 M15 k4,9 k25 k27 k
nov 2002940693238494 k90 k1785,1190577%14%52 k175 Mb27,9 M1,2 M13 k4,4 k22 k25 k
out 200287111232910188 k85 k12064,8188778%14%96 k164 Mb26,2 M1,1 M11 k3,9 k20 k23 k
set 20027591033129351 k48 k3106,5177267%20%72 k90 Mb13,3 M621 k8,2 k3,2 k17 k20 k
ago 2002656942497942 k40 k1516,2177366%20%51 k74 Mb10,9 M481 k4,6 k2,5 k15 k16 k
jul 2002562642095037 k35 k915,6179165%21%29 k67 Mb9,8 M411 k1,5 k1,2 k13 k12 k
jun 2002498391584434 k32 k935,3179966%21%25 k62 Mb9,2 M376 k87388412 k10 k
mai 2002459221302931 k29 k574,9174966%21%17 k56 Mb8,2 M329 k73079011 k8,5 k
abr 2002437261423130 k28 k624,6175266%21%16 k53 Mb7,8 M305 k64651410 k7,5 k
mar 2002411451704328 k26 k814,4176866%21%20 k51 Mb7,5 M280 k1163959,3 k6,5 k
fev 2002366511543525 k24 k3104,0173766%20%47 k45 Mb6,7 M248 k323098,1 k5,7 k
jan 2002315551582417 k16 k493,3190871%24%14 k37 Mb4,9 M185 k7286,7 k652
dez 2001260651642715 k14 k762,7188470%24%14 k34 Mb4,4 M167 k1 5,7 k564
nov 2001195311231613 k12 k952,1171167%21%8,2 k27 Mb3,4 M128 k1 4,0 k480
out 200116437109109,9 k9,2 k1121,9156865%19%6,2 k20 Mb2,4 M87 k1 2,7 k432
set 2001127359266,4 k5,8 k731,9159163%18%4,0 k14 Mb1,6 M54 k1 1,5 k359
ago 200192295824,2 k3,6 k422,0154260%17%2,3 k9,9 Mb1,0 M32 k1 836274
jul 2001631142 2,9 k2,4 k222,1132153%14%1,3 k6,8 Mb609 k20 k1 526209
jun 20015292312,3 k1,7 k122,2132149%13%7765,7 Mb462 k14 k1 395175
mai 20014382721,9 k1,3 k322,2113743%11%1,5 k4,9 Mb315 k10 k  318157
abr 2001357212917814162,8130558%15%7583,5 Mb214 k5,8 k  100119
mar 20012813241435554114,2117880%19%1,0 k2,5 Mb133 k4,0 k  76103
fev 200115814 8814039,21453100%34%5961,3 Mb43 k727  2933
jan 2001779 1115 19,41852100%45%213313 kb4,9 k21  7 
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
The following table ranks this project in relation to projects in other languages with 1000+ articles
set 200911111 11   1      269
ago 200911111 11   1      269
jul 200911111 11   1      269
jun 200911111 11   1      269
mai 200911111 11   1      269
abr 200911111 11   1      269
mar 200911111 11   1      269
fev 200911111 11   1      269
jan 200911111 12   1      269
dez 200811111 12   1      269
nov 200811111 12   1      269
out 200811111 12   1      269
set 200811111 12   1      269
ago 200811111 12   1      269
jul 200811111 12   1      269
jun 200811111 12   1      268
mai 200811111 12   1      268
abr 200811111 12   1      268
mar 200811111 12   1      266
fev 200811111 12   1      266
jan 200811111 12   1      265
dez 200711111 12   1      265
nov 200711111 12   1      265
out 200711111 22   1      264
set 200711111 12   1      262
ago 200711111 12   1      260
jul 200711111 11   1      260
jun 200711111 11   1      260
mai 200711111 11   1      260
abr 200711111 11   1      258
mar 200711111 11   1      258
fev 200711111 11   1      258
jan 200711111 11   1      257
dez 200611111 11   1      257
nov 200611111 11   1      256
out 200611111 11   1      255
set 200611111 11   1      252
ago 2006111111112351111111249
jul 2006111111112341111111245
jun 2006111111112341111111244
mai 2006111111112441111111241
abr 2006111111112441111111239
mar 2006111111112541111111236
fev 2006111111112531111111221
jan 2006111111212531111111221
dez 2005111111112431111111219
nov 2005111111113441111111219
out 2005111111112531111111218
set 2005111111313531111111210
ago 2005111111113431111111207
jul 2005111111113431111111207
jun 2005111111112331111111204
mai 2005111111112331111111200
abr 2005111111112511111111200
mar 2005111111111411111111199
fev 2005111111111411111111198
jan 2005111111111411111111197
dez 2004111111111411111111196
nov 2004111111111411111111195
out 2004111111121411111111195
set 2004111111121411111111191
ago 2004111111121411111111188
jul 2004111111121411111111160
jun 2004111111121311111111150
mai 2004111111121211111111147
abr 2004111111121211111111143
mar 2004121111121111111111138
fev 2004111111121111111211131
jan 2004111111121111111111128
dez 2003111111121121111111119
nov 2003112111121121111211107
out 2003111111121111111211102
set 200311211112111111121197
ago 200311111112111111121191
jul 200311111112111111121189
jun 200311211112111111111180
mai 200311311111111111111174
abr 200311311111111111111172
mar 200311311111111111111169
fev 200311511111111111111165
jan 200311611111111111111160
dez 200211511112111111111153
nov 200211611112112111111147
out 200211711112111111111143
set 200211511111111111111138
ago 200211611111111111111135
jul 200211511111111111111133
jun 200211511111111111111133
mai 200211611111111111111119
abr 200211711111111111111118
mar 200211611111111111111118
fev 200211611111111111111118
jan 200211611111111111111116
dez 200111811111111111111115
nov 200111711111111111111114
out 200111311111111111111112
set 200111911111111111111112
ago 200111611111111111111110
jul 20011152111111111111117
jun 20011151111111111111117
mai 20011151111111111111116
abr 20011141111111111111114
mar 20011111111111111111112
fev 20011111111111111111111
jan 20011111111111111111111
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
 WikipedistasArtigosBase de dadosLigações

Nota: os valores para os primeiros meses estão muito baixos. O histórico de revisões nem sempre era preservado nos primeiros tempos.

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

Wikipedistas (usuários registrados)
A = Wikipedistas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikipedistas que editaram pelo menos dez vezes desde que chegaram
C = Wikipedistas que contribuíram cinco vezes ou mais este mês
D = Wikipedistas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Artigos que contêm pelo menos uma ligação interna e 200 caracteres de texto legível, não contando códigos wiki e html,
      ligações ocultas, etc.; títulos também não contam (outras colunas são baseadas no método oficial de contagem)
G = Novos artigos por dia no mês passado
H = Número médio de revisões por artigo
I = Tamanho médio dos artigos em bytes
J = Porcentagem de artigos com pelo menos 0,5 kb de texto legível (veja F)
K = Porcentagem de artigos com pelo menos 2 kb de texto legível (veja F)

Base de dados
L = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
M = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
N = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
O = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
P = Total de ligações para outras wikipédias
Q = Total de imagens apresentadas
R = Total de ligações para outros sítios
S = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Namespaces: Articles = 0   Talk = 1,3,5,7,9,..   Other = 2,4,6,8,..

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 5  10  25  100  250  1000  2500  10000  25000  5  10  100  1000  10000  100000  5  10  25  100  250  1000  2500  10000  25000  100000  5  10  100  1000  10000  100000  5  10  25  100  250  1000  2500  10000  5  10  100  1000  10000  100000 
set 20093921122607112483999164525255521079984381011001063223606136750657101  665944244 1014163303319997334356 125117803271
ago 200940488237911185441041753271585211510787417 10234653137561380530608   595444264 10388650534411033321352 12411882306 
jul 200940839239761201240051727260513111911087386 10431659636891351522494   696345237 10259643133741048320293 12111478336 
jun 200941148239841201640461747255453 120113915210 106886738376314225414981  696540214 10302643834361026343293 13913190345 
mai 2009422092426812036423318542644642123117935610 10649676938101431566631611 716851285110467644534451049353221 13912692334 
abr 200941368239471189041211777275462 12812284489 10801683138301470590751111 645943236 10390644334101063339305 13112292344 
mar 200943871249841225143081887315482 12411897549 114047155402515636518817321706856334 10633668036191086356252 13312394425 
fev 200941426236351163740081714241422 1241199850911070567863831144258653162  706746213 1007662893351957313241 13612988395 
jan 200943128247551231843701887295534 1281251014911 1139571484140157067064142  636141236 10738681036011144363253 15313989345 
dez 200840405233091166039981733248464112311988439 1050765553778143753058174  625941204 10007631334121031310263 12611883244 
nov 20084082723119114394015170724945311251209542911047465723725139459371153  636044223 10034615633371036326295 13311977286 
out 200842379242951196942641848317646112112190451111125369373909153364689213  585543171 10399641834241088347221 11911182334 
set 20093921122607112483999164525255521079984381011001063223606136750657101  665944244 1014163303319997334356 125117803271
ago 200940488237911185441041753271585211510787417 10234653137561380530608   595444264 10388650534411033321352 12411882306 
jul 200940839239761201240051727260513111911087386 10431659636891351522494   696345237 10259643133741048320293 12111478336 
jun 200941148239841201640461747255453 120113915210 106886738376314225414981  696540214 10302643834361026343293 13913190345 
mai 2009422092426812036423318542644642123117935610 10649676938101431566631611 716851285110467644534451049353221 13912692334 
abr 200941368239471189041211777275462 12812284489 10801683138301470590751111 645943236 10390644334101063339305 13112292344 
mar 200943871249841225143081887315482 12411897549 114047155402515636518817321706856334 10633668036191086356252 13312394425 
fev 200941426236351163740081714241422 1241199850911070567863831144258653162  706746213 1007662893351957313241 13612988395 
jan 200943128247551231843701887295534 1281251014911 1139571484140157067064142  636141236 10738681036011144363253 15313989345 
dez 200840405233091166039981733248464112311988439 1050765553778143753058174  625941204 10007631334121031310263 12611883244 
nov 20084082723119114394015170724945311251209542911047465723725139459371153  636044223 10034615633371036326295 13311977286 
out 200842379242951196942641848317646112112190451111125369373909153364689213  585543171 10399641834241088347221 11911182334 
set 2008407932349511696408517742625441118115914310111224710640401552634792021 636243215 10249648734611065288272 12411269285 
ago 200842124248661256443471877282474 127122944111 1183274414206159959582124  666445204 10615680336711117343252 13111674314 
jul 200842923252071273043651908273481112812092468 1213376354348162165279101  706547254 10820689437781164366293 12111481295 
jun 200842257249121241042351806267332 122115954812 1181774444213159160883223  626144234 10935687637311130368284 12611780304 
mai 200845403260371285544141911277414 120118834612 1256278594515168867683192  757253325 11273695937061212374233 13112588365 
abr 200846349262461292444911955291441 10510171354 1287281224598179474592221  666240243 11450710638081237397276 11310779366 
mar 2008474332681013355473920603015011989472391511298782474662183476410017   605943236 11601721539021299405273 12311572334 
fev 200845042255001249143711890258432 1069973338 126957965437016626798520   605939224 11209700537651219372262 11310475267 
jan 20084525725840127304569202532441  1029979389 1288280614506174774680171  646243267 11656723438531257414356111310676255 
dez 200741836241391209341931769255311 10296764092119377382415915336025512   595741233 10516656636051116359264 11110068236 
nov 20074444225205125104335182325233  10095764010 12362777242881558573498   575640215 10744673335601101318192 1109675224 
out 20074706026719130954531193126732  10499783913 12902801643501581605609   656246285 11282700937271177360163 11110065214 
set 20074503225942129914458190623729  10092683171127727916439515465834710   646250235 11145684335911120340143 11010063164 
ago 20074614327141135094666193325127  969274406 1342382264511161264054121  636145263 11468717938381182374172 11410064233 
jul 200747800281381431047862021250341 939171296 139818641463316115896410   605436195 12019745739291214357222 1019360182 
jun 200746753272901368747351947223293 898672357 138898635471416776055912   595541205 11834741939261216343182 1029259173 
mai 200752351300601479650992169272371 928971367 149899267504818377066112   605643236 12645784241831273378143 10094632231
abr 20075349830610149725170214428232  888670327 155559520511818277066611   625740226 1277378834191124736810  9486651921
mar 20075451031086152135221220129531  868472359 156629589525719377548912   666549286 1306680534232123540719  938454183 
fev 200751325293721441949541990244251 717058297 146698931481417596246171  505032194 1220574493850116434214  716448225 
jan 20075156529795148575126211728027  746853257 150109255493617276686911   424025182 1253376304048121337221  676441152 
dez 20064731927837138894719195324625  757554317 14071864945661479536524   413928123 11929730038291087325192 665836111 
nov 20064655126964133854604189326027  686548248 13786825743801438511504   353322112 11470701535991095324152 615132111 
out 20064388225926130694470185924531  787659306 13353810042311388478529   363423143 109356690353299629819  655831114 
set 200641736247271266442921726231251 757463274 12960793441161282396383   40372283 1053564643364971265203 676335121 
ago 200642997260801362446631979243371 676656296 13908861045331446489355   353220123111529713537841102315304 625335131 
jul 20063891624037127334411178919225  525244234 12919801142161349449213   272313101 10586672235151062352155 4438278  
jun 20063656322635118884194176921527  565444244 12348774640481323452261   24211561 10249660034991049324172 43372211  
mai 200635129216681136240181699228271 494535206 11858736738691210413322   21201253 98786198330795727712  3026196  
abr 20063189019778103663597148016920  484534174 10549655433721087376212   2018841 8913552529118342447  33291881 
mar 20063074919052101403594148118724  403935193 10461650834401083389222   2015941 88755535288387726181 3127155  
fev 20062668816806900032661345163261 323227181 942359233089994320172   1110631 80265052271083622712  2926165  
jan 2006254371645389923359147120327  343229174 9094571130331001333182   9932  801251662835956299121 2826146  
dez 2005225771462778552973132019325  37353017  78294918258087129519    1093   67734321244080023612  2925163  
nov 20051510697725455208593412911  323025111 5463339318185761613    10531  4684296216105231527  2724135  
out 20051482997285407198189211514  232221121 53553335171652516141   651   45882881160654216471 2420145  
set 200512880848546801763758918  232321123 4740291314964461193    761   39772527138544912861 18161011 
ago 20051368791295290198888110314  22222110  5206329516775041494    33    4520280915335191577  191591  
jul 2005125008377483218248171119  19171413  4525288214914561274    31    4052258914274881499  1184   
jun 2005102016924401315667048711  1616109  372923931213339921    652   3354212511863831164  1297   
mai 200594076363366114106118312  1818149  342321541079291671    41    294618971059348905  131152  
abr 20058646589834741366596887  12111061 324119931046286663    4311  28431812959316934  642   
mar 20057388492428321084477709  7754  26241640848234622    431   23791541881277914  432   
fev 2005591740002325873365428  8732  2158133464516336     1     19511256706218622  22    
jan 2005592539952332887382427  8732  21681388691162321    21    19511271720211622  433   
dez 2004600441802476944416627  109732 23201431734192513    3211  20721339747237734  663   
nov 2004551038412278990428636  99772 21191313683193492    11    19381263702220662  6531  
out 2004488033872017795369568  87632 1785113157915837     2     15961039594203511  421   
set 2004430230351858776377526  88631 16581057548146401    111   1514100354418358   6311  
ago 2004386327111683720336656  88531 1428944512129271    22    1290857501159471  4311  
jul 2004366525731567642300539  66432 1317835450107192    322   1171748421124401  541   
jun 200431002239138958128664141133    1108692365841411         10716933851374431 111   
mai 2004296321161333540232285  3321  10426913769217           93360932796291  111   
abr 2004274019811243518237383  221   99362736810821           92860434510825         
mar 2004272219531222530254433  2211  959652358116371    111   888570316110342  211   
fev 200420721503918412173252  2221  7355032718125     11    63441223085211  11    
jan 200415051120722299134211  221   5563691934912           4753281704611         
dez 20031332992667281129225  2222  5383751915310     21    4673031633981  21    
nov 20031230926593269119242  221   4622981695013     1     3942541344281  1     
out 200311328264942058412   2211  410265150324     11    295194113222   11    
set 2003952704459211949         373251127265           29118394115         
ago 2003100775148021910413   22    407276152407           334201113162         
jul 2003868655413167769   11111 3582321203211     1111  25015776221         
jun 2003752561352156818   1111  310223122339           21213770182         
mai 200366251432515476141  11    27218596329           21914355154         
abr 2003509396268122638         24415987219           1721075051         
mar 20034793732551076261        22515990196           162945451         
fev 20035504142801076151        23015787227           166984841         
jan 20035033772471175181        221166862511           1611003641         
dez 2002351282198924051  11111 18013364184           14279285          
nov 200232322915884375         14310861133           112753821         
out 20023292581791014710211      166126701641          118723510          
set 2002312246176934594        14510760174           119673171         
ago 200224919814379437         1098453153           94552461         
jul 200220915310050262         74502882           5131162          
jun 20021581178844222         61442231           4124102          
mai 20021301006329101         43271211           341481          
abr 20021421217831111         64462041           4330143          
mar 2002170128874314          6946236            5929181          
fev 20021541217735161111      5733233111         60341811         
jan 200215811978246          6436203            49227           
dez 200116413081279          7149276            28164           
nov 20011238957164          512913             1372           
out 20011097843102          38206             1681           
set 20019258286           24104             731           
ago 20015843192           2263             2             
jul 200142259            841             32            
jun 2001231951           421             2             
mai 200127161022          11                            
abr 2001211472           31              1             
mar 20012418121           41              11            
fev 200114127            1               2             
jan 2001961                            11            

 

Distribuição de edições de artigos por wikipedistas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikipedistasEdições total
12641868100.0%126067980100.0%
3109159141.3%12357025698.0%
1053089920.1%12034572695.5%
322096607.9%11495162891.2%
100878663.3%10836207486.0%
316389411.5%9992820179.3%
1000172710.7%8789663969.7%
316267430.3%6941931755.1%
1000019130.1%4312035534.2%
316232890.0%1645630813.1%
100000240.0%37444513.0%
31622810.0%3334520.3%

 

50 wikipedistas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesPrimeira edição
ArtigosOutros
 posiçãoúltimos
30 dias
totaltotalúltimos
30 dias
datadias
atrás
agoraΔ
Rjwilmsi1 06543333452412799mar 04, 20051670
Rich_Farmbrough2 0475113161639207320859mai 02, 20041976
Bearcat3 0855426962247565990out 03, 20032188
Waacstats4 01627324077810518293ago 07, 20061149
Erik9bot5+1656762343831998523320fev 12, 2009229
Charles_Matthews7 0166816523227785885fev 25, 20022773
WhisperToMe8 02882160834218901181jul 10, 20032273
Alansohn9 03693152393794422642mai 23, 20051590
J.delanoy10 011951338091429762345out 01, 20061094
Woohookitty11 0986713038570370572dez 29, 20041735
Darius_Dhlomo12 01787119994611087nov 08, 20051421
Michael_Hardy13 0136111655317233273mar 23, 20022747
Everyking15 03381103941204116fev 13, 20042055
Hesperian16+1223410855921361738set 29, 20041826
Tassedethe17+56182108293143421458mai 13, 2008504
BrownHairedGirl18-2111510817150488391jan 08, 20061360
BD241219+13094107952825513281fev 20, 20051682
Arcadian20-286510705419018723set 13, 20041842
Hmains21 0138710602433869157dez 03, 20051396
Carlossuarez4622-31621057723818998set 21, 20032200
Dale_Arnett23 013981022929193378out 12, 20032179
Koavf24 036210030233484143mar 05, 20051669
Bobo19225 066199218890093ago 29, 20041857
CambridgeBayWeather26+218769642721768263jun 11, 20051571
Altenmann27-18139619232910176nov 13, 20032147
Ksnow28+1194995418371622nov 15, 20041779
NE229-23039538848878297jul 09, 20061178
Nyttend30 015479462327353618ago 10, 20061146
Badagnani31 0153930113872677jun 24, 20051558
Lugnuts32+121259276325527736abr 18, 20061260
Gaius_Cornelius33-144592615186231jun 10, 20051572
Dbachmann34+112918920040069560jul 21, 20041896
David_Gerard35-123886441244514jan 04, 20042095
Tabletop36+2319887555251759jan 22, 20051711
Neddyseagoon37-11987513155266fev 04, 20061333
Jaraalbe38+22926860609135247mai 08, 20051605
Epbr12339-26528589777079443ago 15, 20061141
Good_Olfactory40+5552285213562623713fev 16, 2008591
TMC198241-274483961515293ago 25, 20041861
Ahoerstemeier42-18982376206078jan 26, 20032438
Darwinek43-16828206322242154set 28, 20041827
Iridescent44-162581261474901403fev 15, 20061322
Olivier45-1518810925248124set 03, 20022583
Grutness46+29557851236919415out 13, 20041812
Discospinster47-1192780532799771jun 27, 20041920
SimonP48-1223777941959115dez 10, 20012850
Kwamikagami50+323827405818056605ago 12, 20041874
Colonies_Chris52+6225372636152925nov 13, 20051416
Docu53-228722941939952fev 25, 20022773
TenPoundHammer54+212497186140286552jun 23, 20061194

 

20 wikipedistas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesPrimeira ediçãoúltima edição
 posiçãototaldatadias
atrás
datadias
atrás
Dr._Blofeld6194943jun 14, 20061203ago 26, 200934
Lightmouse14111097mai 23, 2007860abr 11, 2009171
Can't_sleep,_clown_will_eat_me4976010nov 23, 20051406abr 01, 2008546
Gene_Nygaard5173432dez 06, 20041758jul 31, 200960
Stemonitis5771093dez 23, 20041741mar 19, 2009194
Pegship6962960jul 29, 20051523jun 29, 200992
Redirect_fixer7361187jul 23, 2008433out 25, 2008339
Bobblewik7659618mar 13, 20042026out 04, 20061091
UtherSRG8257327dez 04, 20032126ago 31, 200929
SPUI9553634out 06, 20041819fev 25, 2007947
El_C11548388ago 09, 20041877ago 03, 200957
Soxrock11748160fev 12, 20061325dez 04, 2007665
Gwernol12246707mai 13, 20051600jul 28, 2008428
Crystallina12346650set 12, 20051478out 05, 2008359
Ram-Man12546482set 08, 20022578jun 30, 200991
Sardanaphalus12845962set 11, 20051479dez 28, 2008275
Morwen13544920ago 01, 20032251jul 16, 2007806
Quadell15342112abr 05, 20042003ago 18, 200942
MisfitToys15441803mar 25, 20042014fev 19, 2009222
Khoikhoi17039611dez 09, 20051390mai 26, 2009126

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 65.668.299 edições foram feitas por usuários anônimos, de um total de 206.866.361 edições ( 31e %)
 


Artigos que contêm pelo menos uma ligação interna e .. caracteres de texto legível, não contando códigos wiki e html,
ligações ocultas, etc.; títulos também não contam  (excluindo páginas de redirecionamento)

DataArtigos
 < 32 ch< 64 ch< 128 ch< 256 ch< 512 ch< 1 k ch< 2 k ch< 4 k ch< 8 k ch< 16 k ch< 32 k ch< 64 k ch
out 30, 20060.0%0.0%1.4%7.7%20.5%41.1%65.1%83.8%93.4%97.7%99.3%99.7%
set 20060.0%0.0%1.5%8.0%21.0%41.7%65.6%84.3%93.8%98.0%99.6%100.0%
ago 20060.0%0.0%1.6%8.2%21.3%42.0%65.9%84.5%93.8%98.0%99.6%100.0%
jul 20060.0%0.0%1.7%8.3%21.6%42.4%66.4%84.6%93.8%97.9%99.4%99.8%
jun 20060.0%0.1%1.8%8.4%21.9%42.7%66.8%85.0%94.1%98.1%99.6%100.0%
mai 20060.0%0.1%1.8%8.5%22.3%43.1%67.1%85.2%94.2%98.1%99.6%100.0%

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.

See also Category Overview Complete (64 Mb!), Concise (4.5 Mb)
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110BmpBz2DiaDjvuDxbElFigGifGzJpeJpgMMidMidiMngMovNbOggOgvPdfPgnPngPovPsdSgfSvgTclTgzVimWavWrlXcfXlsXmlZip
set 20096,9 M853 k483 k888 k1,3 k241 k571514 k78 k      1913111332 k15655 k156011316,9 k222311178 k11215 k111163112811
ago 20096,8 M834 k475 k872 k1,3 k234 k559502 k77 k      1913111332 k15643 k156011316,7 k172171175 k11214 k111163112811
jul 20096,7 M816 k465 k859 k1,2 k228 k553491 k77 k      1913111331 k15633 k146311316,6 k162051173 k11214 k111163112811
jun 20096,6 M797 k455 k846 k1,2 k220 k542479 k76 k      1913111331 k15623 k135011316,5 k151871171 k11214 k111163112811
mai 20096,5 M779 k444 k832 k1,1 k215 k532470 k74 k      1913111330 k15612 k134011316,3 k131801169 k11213 k111163110811
abr 20096,4 M759 k436 k818 k1,1 k211 k522462 k73 k      1913111329 k15602 k133911316,2 k101631167 k11213 k111163110811
set 20096,9 M853 k483 k888 k1,3 k241 k571514 k78 k      1913111332 k15655 k156011316,9 k222311178 k11215 k111163112811
ago 20096,8 M834 k475 k872 k1,3 k234 k559502 k77 k      1913111332 k15643 k156011316,7 k172171175 k11214 k111163112811
jul 20096,7 M816 k465 k859 k1,2 k228 k553491 k77 k      1913111331 k15633 k146311316,6 k162051173 k11214 k111163112811
jun 20096,6 M797 k455 k846 k1,2 k220 k542479 k76 k      1913111331 k15623 k135011316,5 k151871171 k11214 k111163112811
mai 20096,5 M779 k444 k832 k1,1 k215 k532470 k74 k      1913111330 k15612 k134011316,3 k131801169 k11213 k111163110811
abr 20096,4 M759 k436 k818 k1,1 k211 k522462 k73 k      1913111329 k15602 k133911316,2 k101631167 k11213 k111163110811
mar 20096,3 M742 k427 k804 k1,0 k207 k515451 k72 k      1913111329 k15593 k133711316,1 k71491164 k11212 k111163110811
fev 20096,1 M721 k416 k789 k991202 k498440 k71 k      1913111328 k1 582 k133711316,0 k31351160 k11211 k111163110811
jan 20096,0 M704 k408 k777 k981197 k481430 k69 k      1913111328 k1 573 k133711315,9 k31231158 k11211 k11116319811
dez 20085,9 M685 k400 k763 k957192 k439418 k67 k      1913111328 k1 563 k133611315,7 k 1091155 k11211 k11116317811
nov 20085,8 M669 k393 k733 k948188 k437411 k65 k      1913111327 k1 554 k133311315,6 k 1001136 k11210 k11116317811
out 20085,8 M652 k386 k719 k937183 k434402 k64 k      1913111327 k1 543 k131511315,5 k 981133 k1129,8 k11116317811
set 20085,6 M634 k378 k698 k925178 k430393 k63 k      1913111327 k1 532 k131511315,4 k 931124 k1129,5 k11116317811
ago 20085,5 M617 k371 k685 k906174 k426383 k62 k      1913111326 k1 523 k130711315,3 k 851121 k1129,1 k11116317811
jul 20085,4 M599 k363 k670 k883167 k405370 k59 k      1913111326 k1 511 k121711315,2 k 851119 k1128,8 k11116317811
jun 20085,3 M582 k355 k654 k865152 k403358 k57 k      1913111325 k1 499 k112811315,1 k 851116 k1128,5 k11116317811
mai 20085,2 M564 k347 k639 k839147 k397344 k56 k      1913111325 k1 487 k112711315,0 k 801114 k1128,1 k11116317811
abr 20085,1 M546 k340 k622 k812141 k371332 k54 k      1913111324 k1 473 k112311314,8 k 771111 k1127,6 k11116316811
mar 20085,0 M528 k332 k603 k775136 k367320 k52 k      1913 11324 k1 460 k112011314,7 k 751107 k1127,1 k11116315811
fev 20084,7 M508 k322 k584 k753130 k360309 k50 k      1913 11323 k1 445 k112011314,5 k 701104 k1126,6 k11116314811
jan 20084,6 M490 k307 k567 k743126 k347298 k47 k      1913 11323 k1 432 k111911314,4 k 661102 k1126,1 k11116314811
dez 20074,5 M473 k295 k542 k710121 k341285 k43 k      1913 11322 k1 415 k111911314,3 k 66194 k1125,7 k11116314811
nov 20074,4 M458 k284 k513 k674115 k334275 k41 k      1913 11322 k1 400 k111811314,1 k 65181 k1125,3 k11116314811
out 20074,2 M443 k274 k486 k648111 k327267 k39 k      1913 11321 k1 385 k111711314,0 k 63171 k1124,9 k11116314811
set 20074,1 M426 k263 k465 k622105 k324257 k38 k      1913 11320 k1 369 k111411313,8 k 61167 k1124,5 k11116314811
ago 20074,0 M410 k253 k447 k609100 k319249 k36 k      1913 11319 k1 354 k111211313,7 k 59165 k1124,2 k11116313811
jul 20073,9 M394 k245 k426 k60095 k315238 k35 k      1913 11319 k1 337 k111111313,6 k 58162 k1123,8 k11116313811
jun 20073,7 M377 k236 k404 k58191 k302227 k33 k      1913 11318 k1 320 k110711313,5 k 54159 k1123,5 k11116313711
mai 20073,6 M360 k228 k384 k57387 k302216 k32 k      1913 11317 k1 303 k110511313,3 k 48157 k1123,2 k11116313711
abr 20073,5 M341 k220 k363 k53783 k293206 k30 k      1913 11317 k1 286 k19911313,1 k 44154 k1122,8 k11116313511
mar 20073,4 M320 k212 k343 k52779 k290194 k28 k      1913 11316 k1 270 k19111313,0 k 42151 k1122,4 k11116313511
fev 20073,3 M297 k203 k323 k51274 k284184 k24 k      1913 11315 k1 254 k18711312,9 k 40148 k1122,1 k11116313411
jan 20073,1 M277 k195 k304 k50570 k279175 k23 k      1913 11314 k1 240 k18111312,7 k 38146 k1121,9 k11116313411
dez 20063,0 M257 k185 k284 k49065 k271165 k21 k      1913 11313 k1 223 k17911312,6 k 33143 k1121,8 k111163134 1
nov 20062,9 M239 k177 k265 k48861 k259155 k18 k      1913 11313 k1 207 k17811312,3 k 33141 k1121,5 k111163134 1
out 20062,8 M222 k169 k246 k48153 k246147 k15 k      1913 11312 k1 192 k17611312,2 k 31138 k1121,3 k111163134 1
set 20062,7 M206 k162 k228 k47949 k238139 k13 k      1913 11311 k1 178 k17011312,0 k 29136 k1121,1 k111163133 1
ago 20062,6 M191 k154 k211 k47746 k236131 k12 k     90%1913 11310 k1 164 k16511311,9 k 28134 k112975111163133 1
jul 20062,4 M173 k145 k191 k47243 k226122 k11 k     90%1913 1139,7 k1 147 k16111311,8 k 27131 k112860111163133 1
jun 20062,3 M158 k136 k174 k46439 k223114 k10,0 k     89%1913 1138,9 k1 134 k15911311,6 k 27129 k112666111163133 1
mai 20062,2 M143 k128 k157 k46036 k218105 k8,6 k     89%1913 1137,8 k1 120 k15611311,4 k 24126 k112550111163133 1
abr 20062,0 M127 k122 k141 k45333 k20497 k7,1 k     88%1913 1137,1 k1 107 k14411311,3 k 24124 k112461111163133 1
mar 20061,9 M115 k115 k126 k45130 k18990 k6,0 k     87%1913 1136,4 k1 96 k1431131749 24123 k112367111163133 1
fev 20061,8 M102 k109 k113 k44927 k17385 k4,9 k     87%1913 1135,5 k1 85 k1421131697 24121 k112294111163123 1
jan 20061,7 M91 k103 k101 k44525 k15779 k4,2 k     86%1913 1134,9 k1 75 k1351131612 23119 k112167111163123 1
dez 20051,6 M79 k95 k88 k43622 k13973 k3,7 k     85%1913 1134,3 k1 66 k1321131569 21117 k112103111163123 1
nov 20051,5 M69 k87 k78 k41519 k13467 k2,7 k     83%1913 1133,7 k1 58 k1301131493 21115 k11270111163122 1
out 20051,4 M63 k80 k71 k41217 k7961 k2,4 k     83%1913 1133,4 k1 53 k1281131459 14114 k11239111163122 1
set 20051,4 M57 k72 k64 k40615 k7556 k2,2 k     83%1913 1132,9 k1 47 k1231131419 11113 k11219111163122 1
ago 20051,3 M52 k49 k58 k39813 k7453 k1,8 k     82%1913 1132,6 k1 42 k1221131352 8112 k11213111163122 1
jul 20051,2 M46 k42 k51 k39412 k7049 k1,5 k     82%1913 1132,2 k1 37 k1131131336 7111 k11213111163122 1
jun 20051,1 M41 k37 k46 k38911 k6446 k1,2 k     82%1913 1132,0 k1 33 k1121131325 7110 k11213111163122 1
mai 20051,0 M37 k32 k41 k3609,1 k6243 k870     82%1913 1131,7 k1 30 k1121131307 719,1 k11212111163122 1
abr 2005960 k34 k29 k37 k3598,0 k5940 k261     81%1913 1131,6 k1 27 k1111131280 618,0 k11212111163121 1
mar 2005895 k30 k25 k33 k3586,8 k5837 k167     80%1913 1131,3 k1 24 k1111131264 617,4 k11212111163121 1
fev 2005842 k28 k22 k30 k3555,6 k5434 k121     78%1913 1131,1 k1 21 k1111131241 516,8 k11212111163121 1
jan 2005803 k26 k19 k27 k3544,8 k5232 k9     77%1913 1139611 19 k1101131212 416,3 k11212111163111 1
dez 2004760 k24 k16 k25 k3544,2 k4929 k9     75%1913 1138651 17 k191131195 415,8 k11212111163111 1
nov 2004700 k21 k13 k21 k3243,3 k4726 k9     73%1913 1136331 15 k181131191 215,2 k11212111163111 1
out 2004652 k19 k11 k18 k3242,8 k4721 k9     63%1913 1135111 13 k181131189 214,7 k11212111163111 1
set 2004610 k18 k9,1 k15 k3222,5 k4617 k9     53%1913 1134071 10 k181131180 114,2 k11212111163111 1
ago 2004570 k16 k7,7 k13 k3222,1 k714 k9     45%1913 1123081 8,6 k181121159 113,7 k1129111160 11 1
jul 2004532 k14 k6,2 k11 k3211,7 k78,7 k7     34%1012 1122281 6,9 k161 21138 113,2 k1128 1156 11 1
jun 2004465 k13 k5,0 k8,8 k3201,3 k65,8 k6     24%10   1121821 5,6 k161 21133 1 2,8 k1125 1154 11  
mai 2004430 k12 k4,3 k7,0 k3051,1 k56766     4%9    111311 4,5 k151 2 108   2,2 k  24 1151 11  
abr 2004396 k10 k3,6 k5,7 k75897516     0%6    1 821 3,7 k12  1 106   1,8 k  2  1151     
mar 2004362 k9,2 k3,0 k4,5 k75549516     0%       561 2,8 k 2  1 98   1,5 k  2  1151     
fev 2004320 k7,9 k2,6 k2,7 k75253516     0%       40  1,8 k 2    94   768  2  11      
jan 2004294 k7,0 k1,9 k1,9 k7424416     0%       30  1,3 k 2    48   551  1  11      
dez 2003275 k6,5 k1,8 k1,4 k6915416     0%       27  984 2    39   364  1   1      
nov 2003255 k5,9 k1,6 k1,1 k1 416     0%       9  816 2    39   267  1   1      
out 2003238 k5,4 k1,5 k8601 316     0%       6  625 2    38   188      1      
set 2003225 k4,9 k1,4 k7841 316     0%       6  572 2    38   165      1      
ago 2003211 k4,5 k1,3 k7061 316     0%       5  513 2    38   147      1      
jul 2003197 k4,1 k1,2 k6551 316     0%       3  476 1    38   136      1      
jun 2003183 k3,6 k1,1 k5961 316     0%       2  430      36   127      1      
mai 2003173 k3,3 k1,0 k5351 316     0%       1  387      36   111             
abr 2003161 k3,0 k9544851 316     0%       1  351      36   97             
mar 2003152 k2,8 k8864161 316     0%       1  299      36   80             
fev 2003143 k2,6 k8272331 316     0%       1  130      36   66             
jan 2003136 k2,3 k726187  316     0%       1  120      36   30             
dez 2002127 k2,0 k666170  3 6             1  111      36   22             
nov 2002120 k1,9 k644133  3 6             1  78      36   18             
out 2002113 k1,7 k605103  3 5                49      36   18             
set 200272 k1,5 k51472  3 4                21      36   15             
ago 200259 k1,3 k47459  3 4                10      36   13             
jul 200251 k1,2 k4221  2 4                1                        
jun 200246 k1,1 k405   2 3                                         
mai 200242 k1,0 k395   2 3                                         
abr 200239 k936383   2 3                                         
mar 200236 k855318   2 3                                         
fev 200233 k668307   2 3                                         
jan 200221 k384238   2 3                                         
dez 200119 k310227   1 3                                         
nov 200116 k261193     2                                         
out 200113 k213156     1                                         
set 20018,9 k15699                                               
ago 20016,2 k12361                                               
jul 20014,6 k9644                                               
jun 20013,6 k7435                                               
mai 20013,2 k5633                                               
abr 20011,9 k5027                                               
mar 20011,3 k4321                                               
fev 2001589239                                               
jan 2001173136                                               

 

ZeitGeist

For each month articles with most contributors in that month are shown.
Sometimes an article has been renamed repeatedly. For this reason the English Wikipedia article 'October 2003' features as article with most editors for many months.

x y z    ⇐    x = rank, y = contributors in that month, z = article title

jan 2001: 1 2 Usenet cabal , 2 2 SlavicLanguages , 3 2 RationalNumbers , 4 2 NirvanaBuddhism , 5 2 MappinG , 6 2 AbbevilleFrance , 7 2 AlbaniaHistory , 8 1 AlchemY

fev 2001: 1 5 SportS , 2 4 Poverty in the United States , 3 2 ZeuS , 4 2 WolfgangAmadeusMozart , 5 2 VisualArtsAndDesign , 6 2 UnitedStates/StandardOfLiving , 7 2 UnitedStates , 8 2 Therapy/Occupational , 9 2 TheRationalityOfAtheism , 10 2 TitaniC , 11 2 TheoryOfConduct , 12 2 StatisticalModel , 13 2 StatisticalAssumptions , 14 2 StratifiedSampling , 15 2 StatisticalTheory , 16 2 ScienceFictionFilm , 17 2 SurveySampling , 18 2 SeT , 19 2 ScienCe , 20 2 ResearchSubjects , 21 2 PaulEhrlich , 22 2 PoetrY , 23 2 ObservationalError , 24 2 MacroeconomicS , 25 2 LiteraTure

mar 2001: 1 3 William Jefferson Clinton , 2 2 Georges Méliès , 3 2 Geek , 4 2 Gnu , 5 2 Land-grant university , 6 2 Zimbabwe/Transational Issues , 7 2 Vostok 1 , 8 2 Article Three of the United States Constitution , 9 2 Types of Colloids , 10 2 Tile based games , 11 2 TheoremProving , 12 2 The Doors (album) , 13 2 The Origin of Species/Chapter 1 , 14 2 States in Medieval Britain , 15 2 Signature , 16 2 Scepticism , 17 2 Stop , 18 2 ScienceFiction , 19 2 Romania , 20 2 Physical therapy , 21 2 Pseudo science , 22 2 Playing cards , 23 2 PseudoScience , 24 2 Periodic Table , 25 2 Other games

abr 2001: 1 3 Turkish , 2 2 Mustafa Kemal Atatürk , 3 2 White elephant , 4 2 Tensors , 5 2 Silence of the Lambs , 6 2 Sanctions , 7 2 Richard Petty , 8 2 Paul Robeson , 9 2 Nonexistence , 10 2 NobelPrize , 11 2 Johnny Unitas , 12 2 Hypoglycemia , 13 2 Hormone , 14 2 History of the petroleum industry in the United States , 15 2 Go Down Moses , 16 2 Endocrine system , 17 2 Drunk , 18 2 Deposition , 19 2 Double-hulled tanker , 20 2 Critical philosophy , 21 1 Hand (poker)

mai 2001: 1 4 User friendly , 2 3 World Wide Fund for Nature , 3 3 Swiss cheese (generic) , 4 2 List of film noir , 5 2 Afrika Bambaataa , 6 2 Thyroid hormone , 7 2 Mustafa Kemal Atatürk , 8 2 AbdicatioN , 9 2 Eye , 10 2 Christian Democratic Union (Germany) , 11 2 Z , 12 2 Y , 13 2 Whiskey , 14 2 WWF (wildlife) , 15 2 Valerian , 16 2 Uppsala , 17 2 The Running Man , 18 2 Tübingen , 19 2 Qt Development Frameworks , 20 2 The Coen brothers , 21 2 Telecommunications in Swaziland , 22 2 Section 508 Amendment to the Rehabilitation Act of 1987 , 23 2 Snare drum , 24 2 Sequential access , 25 2 SPD (disambiguation)

jun 2001: 1 6 Unamerican activities , 2 4 Oberkommando des Heeres , 3 3 Software development process , 4 3 When Harry Met Sally... , 5 2 House Un-American Activities Committee , 6 2 Human–computer interaction , 7 2 Isotope , 8 2 John Cabot , 9 2 Operation Fortitude , 10 2 Adrenoleukodystrophy , 11 2 William DeVries , 12 2 War film , 13 2 Double Cross System , 14 2 Andreas Vesalius , 15 2 Vladimir Arnold , 16 2 Statistical hypothesis testing , 17 2 Night of the Living Dead , 18 2 Tyburn , 19 2 Troll , 20 2 Sacred (version 2) , 21 2 Red Army , 22 2 Rammstein , 23 2 Robert Rodriguez , 24 2 Quentin Tarantino , 25 2 Mandrake (plant)

jul 2001: 1 3 William Morris , 2 3 Sir Thomas More , 3 2 Annexation , 4 2 Gazetteer , 5 2 Ainulindalë , 6 2 De Moivre's formula , 7 2 Cambridge , 8 2 Wisława Szymborska , 9 2 W H Auden , 10 2 Juan Pujol , 11 2 Vitamins , 12 2 Vancouver (disambiguation) , 13 2 United Nations/Member States , 14 2 The Church of Jesus Christ of Latter-day Saints/Standard Works , 15 2 The Cunctator , 16 2 T. H. Huxley , 17 2 Trier , 18 2 The Most Remarkable Formula In The World , 19 2 The Canon of Scripture , 20 2 Slashdotted , 21 2 Samuel Beckett , 22 2 Star Trek: The Original Series , 23 2 Skinheads , 24 2 Regex , 25 2 Ring

ago 2001: 1 5 US Taxes , 2 4 Útgarðar , 3 4 Trans-Neptunian object , 4 4 Tyrannosaurus , 5 4 String (computer science) , 6 4 Sir Thomas More , 7 3 Well-order , 8 3 United States Civil War , 9 3 Trans-Neptunian objects , 10 3 The Seventeenth Amendment , 11 3 Scientific Method , 12 2 Abu'l-Fida , 13 2 Diabetes , 14 2 Aesop , 15 2 Demographics of Antarctica , 16 2 White , 17 2 Books about Stephen King , 18 2 Disability , 19 2 AutoLISP , 20 2 Straw man , 21 2 Beta particle , 22 2 Xerox Parc , 23 2 Xenophobia , 24 2 Wing , 25 2 Wizard Of Space And Time

set 2001: 1 8 World Trade Center/Plane crash , 2 6 Writing system , 3 5 Wheel , 4 5 Tattoo , 5 5 Sinn Féin , 6 5 Skateboarding , 7 4 Ten Commandments , 8 4 Yaohushua , 9 4 United States Congress , 10 4 Train , 11 4 Smiley , 12 3 Tux , 13 3 List of tenants in One World Trade Center , 14 3 Wipe (transition) , 15 3 Visigoths , 16 3 UCS-16 , 17 3 Polytetrafluoroethylene , 18 3 Tales of the Reaching Moon , 19 3 Terrorist , 20 3 Talking heads , 21 3 Traveller (role-playing game) , 22 3 Tennis , 23 3 September 25 , 24 3 Seek time , 25 3 Singular they

out 2001: 1 9 Werewolf , 2 7 Witch-hunt , 3 7 Vitamin C , 4 6 Western canon , 5 6 The Sophia of Jesus Christ , 6 6 TARDIS , 7 6 Principality of Sealand , 8 6 String theory , 9 5 Theodore Kaczynski , 10 5 Gray Wolf , 11 5 Teletubbies , 12 5 San Francisco Giants , 13 4 Year 2000 problem , 14 4 XP , 15 4 Venice , 16 4 Vinyl (organic compound) , 17 4 Conservative Party (UK) , 18 4 The Sun (newspaper) , 19 4 Tom Daschle , 20 4 Torah , 21 4 Screaming Lord Sutch , 22 4 Strategos , 23 4 Sappho , 24 3 Sinclair Research , 25 3 ZX81

nov 2001: 1 7 Go (game) , 2 7 British Isles , 3 6 Commonwealth of Nations , 4 6 Yngwie Malmsteen , 5 6 List of islands , 6 6 Ethic of reciprocity , 7 6 Danse Macabre , 8 6 Boxing Day , 9 6 Big Bang , 10 5 1 E+11 m² , 11 5 Wends , 12 5 Third Reich , 13 5 Pope Joan , 14 5 Malleus Maleficarum , 15 5 London Underground , 16 5 Jan Hus , 17 5 Intelligent design , 18 5 Timeline of Polish history , 19 5 George Harrison , 20 5 Edinburgh , 21 4 War in Afghanistan (2001–present) , 22 4 HavenCo , 23 4 1 megametre , 24 4 1971 , 25 4 1970

dez 2001: 1 9 Human , 2 9 Napoleon I of France , 3 9 List of cocktails , 4 9 Resurrection of Jesus , 5 9 Deaths in 2003 , 6 9 Quantum mechanics , 7 8 Anne Frank , 8 8 The Lord of the Rings , 9 8 Feminazi , 10 8 Original sin , 11 8 New Age , 12 8 Noam Chomsky , 13 8 Intelligent design , 14 8 Falsifiability , 15 8 Christian Mythology , 16 8 Christianity and antisemitism , 17 7 Opera (web browser) , 18 7 Fundamental unit , 19 7 Scientific creationism , 20 7 Menachem Begin , 21 7 Myth , 22 7 Korean language , 23 7 Flat Earth , 24 6 Norse mythology , 25 6 Weight

jan 2002: 1 23 Larry Sanger , 2 12 Global warming , 3 9 Main Page , 4 9 Deaths in 2003 , 5 8 War , 6 8 Vietnam War , 7 8 Religion , 8 8 Nuclear weapon , 9 8 Fascism , 10 8 October 2003 , 11 7 Augusto Pinochet , 12 7 2002 , 13 7 List of Latin place names in Continental Europe, Ireland and Scandinavia , 14 7 List of battles , 15 7 Grammatical gender , 16 7 Euro , 17 6 Middle-earth , 18 6 List of cocktails , 19 6 Racism , 20 6 The Rocky Horror Picture Show , 21 6 Latin Names of German Cities , 22 6 List of saints , 23 6 Language family , 24 6 Jerry Falwell , 25 6 Galileo Galilei

fev 2002: 1 14 Main Page , 2 9 Novelists , 3 9 Deep England , 4 9 Beryllium , 5 8 2002 Winter Olympics , 6 7 River , 7 7 October 2003 , 8 7 Hostility towards America , 9 6 Imagery of nude celebrities , 10 6 Spam , 11 6 Sport , 12 6 Mathematician , 13 6 Easter , 14 6 Dumpster diving , 15 5 Infinity , 16 5 Copyright Term Extension Act , 17 5 Nudity , 18 5 Mars , 19 5 Helicopter , 20 5 Prussia (disambiguation) , 21 5 Monarchy of the United Kingdom , 22 5 Bohemian Rhapsody , 23 5 James A. Garfield , 24 5 Battle of the Teutoburg Forest , 25 5 Correlation does not imply causation

mar 2002: 1 14 Sex education , 2 8 Fish and chips , 3 8 Regional accents of English , 4 8 Novelists , 5 8 October 2003 , 6 8 Chess , 7 7 Anti-communism , 8 7 Academy Award for Best Picture , 9 7 James Bond , 10 7 False friend , 11 6 Main Page , 12 6 McDonald's , 13 6 Human , 14 6 Ozone depletion , 15 6 Moulin Rouge , 16 6 Religion and sexuality , 17 6 Science fiction , 18 6 Deaths in 2003 , 19 6 Meme , 20 6 Homeopathy , 21 6 Graph theory , 22 6 Gdańsk , 23 6 Britannica Public Domain , 24 6 Atom , 25 5 Poisson distribution

abr 2002: 1 9 October 2003 , 2 8 Coup d'état , 3 8 Main Page , 4 7 Harry Potter and the Philosopher's Stone , 5 7 Ice cream , 6 7 Article (grammar) , 7 7 Shark , 8 7 List of Latin place names in Continental Europe, Ireland and Scandinavia , 9 7 Julius Caesar , 10 6 Journaling file system , 11 6 Linda Lovelace , 12 6 Family , 13 6 Oswald Avery , 14 6 Clergy , 15 6 Scientific reductionism , 16 6 Palestinian homeland , 17 6 All your base are belong to us , 18 6 Military fiat , 19 6 Giacomo Leopardi , 20 6 Economics , 21 6 Caffeine , 22 6 Cannibalism , 23 6 Chess , 24 6 American and British English differences , 25 5 Transport

mai 2002: 1 11 Nicolaus Copernicus , 2 10 Main Page , 3 9 Jenin , 4 9 Deaths in 2003 , 5 8 Ten Commandments , 6 8 Noam Chomsky , 7 7 May 23 , 8 7 Free software , 9 6 American Pie , 10 6 List of countries by Independence Day , 11 6 October 2003 , 12 5 War on Terrorism , 13 5 Sloth , 14 5 Palestinian political violence , 15 5 Wizard (fantasy) , 16 5 Chomsky and anti-semitism , 17 5 Vulgar Latin , 18 5 Acme Corporation , 19 5 Progressive rock , 20 5 Light rail , 21 5 Yom Kippur War , 22 5 Stephen Jay Gould , 23 5 Physics , 24 5 Novelists , 25 5 Function

jun 2002: 1 16 2002 FIFA World Cup , 2 12 October 2003 , 3 8 Pledge of Allegiance , 4 7 Private Eye , 5 7 Many-worlds interpretation , 6 6 Taraxacum , 7 6 English language , 8 6 Arab–Israeli conflict , 9 6 List of timelines , 10 6 Radiological weapon , 11 6 List of national capitals , 12 6 Deaths in 2003 , 13 6 Master Boot Record , 14 6 List of battles , 15 6 Gdańsk , 16 5 Orc , 17 5 Antichrist , 18 5 Main Page , 19 5 File system , 20 5 Bracket , 21 5 Peanut , 22 5 Incest taboo , 23 5 Early infanticidal childrearing , 24 5 TI-89 series , 25 5 Proposals for a Palestinian state

jul 2002: 1 22 List of novelists by nationality , 2 20 October 2003 , 3 11 Main Page , 4 10 Proposals for a Palestinian state , 5 10 Israeli–Palestinian conflict , 6 9 2002 , 7 9 20th century , 8 9 Tour de France , 9 9 Intelligent design , 10 9 Dwight D. Eisenhower , 11 9 People's Republic of China , 12 8 Accounting scandals , 13 8 Breastfeeding , 14 8 List of cemeteries , 15 8 Nigger , 16 8 Palestine (disambiguation) , 17 8 Evolution , 18 8 Board game , 19 7 List of science fiction television programs , 20 7 Temple Mount , 21 7 Chaim Potok , 22 7 Aqua regia , 23 7 Greasy spoon , 24 7 MCI Inc. , 25 7 English plural

ago 2002: 1 20 October 2003 , 2 17 List of islands , 3 14 United States , 4 14 Jesus , 5 13 List of novelists by nationality , 6 12 Paris , 7 11 List of city listings by country , 8 10 Main Page , 9 10 Zionist political violence , 10 9 Nazism , 11 9 South Africa under apartheid , 12 9 Iraq disarmament crisis , 13 9 Proposals for a Palestinian state , 14 9 Richard Burton , 15 9 Deaths in 2003 , 16 9 List of battles , 17 9 Genocide , 18 9 Belgium , 19 9 Antisemitism , 20 8 War in Afghanistan (2001–present) , 21 8 BBC , 22 8 Scientology , 23 8 Arab–Israeli conflict , 24 8 God , 25 8 Orange (fruit)

set 2002: 1 20 October 2003 , 2 19 George W. Bush , 3 16 Jehovah's Witnesses , 4 15 List of French people , 5 13 Main Page , 6 12 Moon landing conspiracy theories , 7 11 Anti-metrication , 8 11 Fuck , 9 11 Jesus , 10 11 List of comedy television series , 11 11 List of Germans , 12 11 Iraq disarmament crisis , 13 11 Genocide , 14 10 East Timor , 15 10 United States , 16 10 Adolf Hitler , 17 10 Use of capital punishment by nation , 18 10 List of novelists by nationality , 19 10 List of religions and spiritual traditions , 20 10 Zeus , 21 10 BASIC , 22 9 Maurice Papon , 23 9 Civil union , 24 9 Lists of television programs , 25 9 Deaths in 2003

out 2002: 1 30 October 2003 , 2 29 Christopher Columbus , 3 20 Jehovah's Witnesses , 4 18 Jimmy Carter , 5 17 Beltway sniper attacks , 6 17 List of fictional cats , 7 15 Main Page , 8 14 Anti-metrication , 9 14 List of Canadians , 10 14 Anarchism , 11 12 50000 Quaoar , 12 12 War on Terrorism , 13 12 The Holocaust , 14 12 Wikipedia , 15 12 George W. Bush , 16 12 Adolf Hitler , 17 12 Jesus , 18 12 Index of mathematics articles , 19 12 List of novelists by nationality , 20 12 The Beatles , 21 11 Paris , 22 11 Germany , 23 10 Aria Giovanni , 24 10 Stoning , 25 10 Luiz Inácio Lula da Silva

nov 2002: 1 29 October 2003 , 2 16 George W. Bush , 3 14 List of suicides , 4 13 War on Terrorism , 5 12 Jesus , 6 12 Gas chamber , 7 12 Conductor , 8 11 List of items for which possession is restricted , 9 11 Deaths in 2003 , 10 11 Christopher Columbus , 11 10 Main Page , 12 10 The Holocaust , 13 10 Harry Potter , 14 10 Christian views on magic , 15 10 UK firefighter dispute 2002–2003 , 16 10 Bushism , 17 10 Racism , 18 9 Gay , 19 9 Wikipedia , 20 9 Vampirism , 21 9 Discrediting tactic , 22 9 Vampire , 23 9 Holocaust revisionism , 24 9 Christianity and homosexuality , 25 9 Beer

dez 2002: 1 24 October 2003 , 2 16 List of fictional dogs , 3 15 Fluorine , 4 15 War on Terrorism , 5 15 Iraq disarmament crisis , 6 15 Richard Wagner , 7 14 One-hit wonder , 8 14 Henry Kissinger , 9 14 Longest word in English , 10 14 American and British English differences , 11 13 Homophobia , 12 12 Joseph Stalin , 13 12 Republic of Ireland , 14 11 Trent Lott , 15 11 Gender-neutral pronoun , 16 11 Social work , 17 11 Pol Pot , 18 11 Britney Spears , 19 10 George W. Bush , 20 10 Chargoggagoggmanchauggagoggchaubunagungamaugg , 21 10 1985 in music , 22 10 Information Awareness Office , 23 10 Bowling for Columbine , 24 10 Occam's razor , 25 10 World War II

jan 2003: 1 31 October 2003 , 2 26 Iraq disarmament crisis , 3 22 Great Famine (Ireland) , 4 21 Jesus , 5 21 SQL slammer (computer worm) , 6 21 Micronation , 7 20 Deaths in 2003 , 8 19 New Imperialism , 9 16 Nigger , 10 16 2002 , 11 15 Clonaid , 12 15 Kosovo War , 13 14 Wikipedia , 14 14 The Beatles , 15 13 Penis , 16 13 Maurice Gibb , 17 13 2003 , 18 13 Genocide , 19 12 Main Page , 20 12 George W. Bush , 21 12 Menachem Mendel Schneerson , 22 12 Pol Pot , 23 12 Pi , 24 11 Place names considered unusual , 25 11 September 11 attacks

fev 2003: 1 44 October 2003 , 2 38 Space Shuttle Columbia disaster , 3 24 Space Shuttle Columbia , 4 23 Woman , 5 22 Richard Wagner , 6 20 Iraq disarmament crisis , 7 18 Protests against the Iraq War , 8 17 American and British English differences , 9 16 February 5 , 10 15 Fred Rogers , 11 15 List of city listings by country , 12 14 London congestion charge , 13 14 2003 , 14 14 Deaths in 2003 , 15 14 Ethnocentrism , 16 13 Sea of Japan naming dispute , 17 12 Phil Spector , 18 12 Adolf Hitler , 19 12 Jesica Santillan , 20 12 Pennsylvania Dutch , 21 12 List of comedy television series , 22 12 The Beatles , 23 12 George Washington , 24 12 Association football , 25 11 Main Page

mar 2003: 1 58 October 2003 , 2 41 2003 Iraq war timeline , 3 35 Severe acute respiratory syndrome , 4 26 Rachel Corrie , 5 22 Shock and awe , 6 22 Protests against the Iraq War , 7 22 Saddam Hussein , 8 19 List of one-word stage names , 9 18 Iraq disarmament crisis , 10 17 2003 invasion of Iraq , 11 17 Governmental positions on the Iraq War prior to the 2003 invasion of Iraq , 12 16 Zoran Đinđić , 13 16 Idol worship , 14 15 Robert Mugabe , 15 15 2003 , 16 14 Main Page , 17 14 Iraq , 18 14 Coalition of the willing , 19 14 List of assassinated people , 20 14 Elizabeth Smart kidnapping , 21 14 Deaths in 2003 , 22 13 Jesus , 23 13 List of official languages , 24 13 Hate speech , 25 13 French fries

abr 2003: 1 49 October 2003 , 2 46 Severe acute respiratory syndrome , 3 26 Saddam Hussein , 4 26 Deaths in 2003 , 5 25 2003 invasion of Iraq , 6 21 List of one-word stage names , 7 19 Johnny Reb , 8 18 Jessica Lynch , 9 18 Hostility towards America , 10 17 People's Republic of China , 11 16 Battle of Baghdad (2003) , 12 16 Anti-French sentiment in the United States , 13 16 Baghdad International Airport , 14 15 Nigger , 15 14 Jesus , 16 14 Nina Simone , 17 13 Leslie Cheung , 18 13 Prime minister , 19 13 Concorde , 20 12 Main Page , 21 12 Automobile , 22 12 George W. Bush , 23 12 List of historical elephants , 24 12 Rumours of the death of Saddam Hussein , 25 12 2003 Iraq war timeline

mai 2003: 1 56 October 2003 , 2 22 Woman , 3 21 Main Page , 4 20 Clitoris , 5 17 Deaths in 2003 , 6 16 Eurovision Song Contest 2003 , 7 16 People's Republic of China , 8 15 2003 in music , 9 15 Earth , 10 14 List of railway companies , 11 14 Communist state , 12 14 2003 invasion of Iraq , 13 14 Severe acute respiratory syndrome , 14 14 World War II , 15 14 Germany , 16 14 Eurovision Song Contest , 17 13 List of gay, lesbian or bisexual people , 18 13 Prime Minister of the United States , 19 13 Most-wanted Iraqi playing cards , 20 13 List of French monarchs , 21 13 Saddam Hussein , 22 12 Donald Duck , 23 12 Overpopulation , 24 12 United States , 25 12 George W. Bush

jun 2003: 1 52 October 2003 , 2 30 Main Page , 3 26 Harry Potter , 4 26 Deaths in 2003 , 5 24 Monkeypox , 6 20 George W. Bush , 7 20 Pyromania (album) , 8 20 Martha Stewart , 9 20 Harry Potter and the Order of the Phoenix , 10 20 Same-sex marriage , 11 19 Dinosaur Jr. , 12 18 Strom Thurmond , 13 17 Wikipedia , 14 17 Goo Goo Dolls , 15 16 Jürgen Möllemann , 16 16 Gregory Peck , 17 15 List of ethnic slurs , 18 15 History of China , 19 15 People's Republic of China , 20 14 Social class in the United States , 21 14 Butthole Surfers , 22 14 Index of mathematics articles , 23 14 World War II , 24 14 Scientific method , 25 13 Descriptive knowledge

jul 2003: 1 59 October 2003 , 2 36 Main Page , 3 35 Deaths in 2003 , 4 24 David Kelly (weapons expert) , 5 24 World War II , 6 21 Catholicism , 7 19 New Imperialism , 8 18 Creationism , 9 17 Hong Kong Tramways , 10 17 Ladan and Laleh Bijani , 11 17 Saddam Hussein , 12 17 Qusay Hussein , 13 16 Homosexuality , 14 16 George W. Bush , 15 16 SCO v. IBM , 16 16 Uday Hussein , 17 16 Dim sum , 18 15 New York City , 19 15 Chinese White Dolphin , 20 15 Barry White , 21 15 List of airports , 22 14 Martin Luther , 23 14 Apple Daily , 24 14 Hong Kong Basic Law Article 23 , 25 14 Bob Hope

ago 2003: 1 73 October 2003 , 2 72 Northeast Blackout of 2003 , 3 44 Main Page , 4 28 Creationism , 5 24 Israel , 6 23 California gubernatorial recall election, 2003 , 7 23 SCO v. IBM , 8 23 Deaths in 2003 , 9 22 List of films considered the worst , 10 22 Canal Hotel bombing , 11 22 Idi Amin , 12 21 Arnold Schwarzenegger , 13 20 World War II , 14 19 Sérgio Vieira de Mello , 15 18 Circumcision , 16 17 Toronto , 17 17 Microsoft , 18 16 Jesus , 19 16 Timeline of computer and video games , 20 16 Nikola Tesla , 21 16 People's Republic of China , 22 15 Wikipedia , 23 15 Catholicism , 24 15 George W. Bush , 25 15 Gray Davis

set 2003: 1 73 October 2003 , 2 47 Main Page , 3 26 Adolf Hitler , 4 26 Deaths in 2003 , 5 24 Johnny Cash , 6 24 Anna Lindh , 7 22 George W. Bush , 8 21 Edward Teller , 9 20 Hezbollah , 10 19 BBC , 11 19 Edward Said , 12 18 Charles Bronson , 13 17 Recording Industry Association of America , 14 17 Robert Palmer (singer) , 15 17 California gubernatorial recall election, 2003 , 16 17 Wesley Clark , 17 17 2003 , 18 17 British National Party , 19 16 John Ritter , 20 15 Neoconservatism , 21 15 SMART-1 , 22 15 Mel Gibson , 23 14 Wikipedia , 24 14 Ann Coulter , 25 14 List of assassinated people

out 2003: 1 95 October 2003 , 2 42 Main Page , 3 41 Arnold Schwarzenegger , 4 37 Mother Teresa , 5 34 Shenzhou 5 , 6 34 Deaths in 2003 , 7 31 Jesus , 8 24 World War II , 9 21 Gdańsk , 10 20 United States , 11 20 Yang Liwei , 12 20 Pope John Paul II , 13 19 David Blaine , 14 19 Silesia , 15 19 Concorde , 16 18 George W. Bush , 17 18 California gubernatorial recall election, 2003 , 18 18 Poznań , 19 18 Antisemitism , 20 17 Rush Limbaugh , 21 16 Phoenix Television , 22 16 Radio Television Hong Kong , 23 16 J. M. Coetzee , 24 16 Abortion in the United States , 25 16 Toronto

nov 2003: 1 96 November 2003 , 2 33 Michael Jackson , 3 32 Main Page , 4 29 Islam , 5 29 Deaths in 2003 , 6 28 Adolf Hitler , 7 27 Eduard Shevardnadze , 8 27 2003 , 9 23 Jesus , 10 23 Reptilian humanoid , 11 22 Cetacean intelligence , 12 21 Republic of Macedonia , 13 20 Scientific method , 14 20 Canon , 15 19 Mother Teresa , 16 19 List of United States political families , 17 19 Arnold Schwarzenegger , 18 18 Names of European cities in different languages , 19 18 United States , 20 18 George W. Bush , 21 18 Thanksgiving (disambiguation) , 22 18 Mecca , 23 18 Antisemitism , 24 17 Concorde , 25 16 Google search

dez 2003: 1 107 December 2003 , 2 57 Saddam Hussein , 3 45 Deaths in 2003 , 4 44 Main Page , 5 34 Operation Red Dawn , 6 33 2003 , 7 29 Alternative medicine , 8 27 September 11 attacks , 9 27 Wright brothers , 10 26 Nuclear and radiation accidents , 11 23 George W. Bush , 12 23 List of political parties by United Nations geoscheme , 13 22 Adolf Hitler , 14 22 Ozzy Osbourne , 15 21 List of gay, lesbian or bisexual people , 16 21 New York City , 17 19 Elizabeth II of the United Kingdom , 18 19 United States , 19 18 Oder-Neisse line , 20 18 Canada , 21 18 Soham murders , 22 18 Joseph Stalin , 23 17 Al Gore , 24 17 Dershowitz–Finkelstein affair , 25 17 Rick Santorum

jan 2004: 1 92 January 2004 , 2 41 Main Page , 3 39 Deaths in 2004 , 4 30 Wikipedia , 5 30 Mars Exploration Rover , 6 29 United States presidential election, 2004 , 7 28 2004 , 8 26 September 11 attacks , 9 26 George W. Bush , 10 25 Communism , 11 25 Howard Dean , 12 25 2003 , 13 23 Al Gore , 14 23 Socialism , 15 22 God , 16 22 Hutton Inquiry , 17 21 Atheism , 18 21 Tea , 19 20 Antisemitism , 20 19 Spirit rover , 21 19 History of antisemitism , 22 19 State of the Union address , 23 18 Blog , 24 18 President of the United States , 25 17 GloFish

fev 2004: 1 128 February 2004 , 2 51 Main Page , 3 47 John Kerry , 4 46 George W. Bush , 5 41 Deaths in 2004 , 6 38 2004 , 7 35 Howard Dean , 8 32 Same-sex marriage in the United States , 9 31 The Passion of the Christ , 10 29 United States , 11 28 September 11 attacks , 12 28 Wikipedia , 13 27 Joseph Stalin , 14 25 Gdańsk , 15 24 Ricin , 16 23 Japan , 17 22 Jesus , 18 22 January 2004 , 19 22 Mozilla Firefox , 20 22 Winston Churchill , 21 21 United States presidential election, 2004 , 22 21 French law on secularity and conspicuous religious symbols in schools , 23 21 Democratic Party (United States) presidential primaries, 2004 , 24 20 The Holocaust , 25 20 Same-sex marriage

mar 2004: 1 161 March 2004 , 2 112 2004 Madrid train bombings , 3 68 George W. Bush , 4 57 90377 Sedna , 5 55 Ahmed Yassin , 6 53 John Kerry , 7 47 Deaths in 2004 , 8 42 Wikipedia , 9 42 United States , 10 40 Jesus , 11 39 Adolf Hitler , 12 39 2004 , 13 33 Nuclear weapon , 14 31 September 11 attacks , 15 31 Buddhism , 16 31 Germany , 17 30 List of acronyms and initialisms , 18 29 Linux , 19 29 76th Academy Awards , 20 29 Villain , 21 28 The Passion of the Christ , 22 28 Propaganda , 23 27 February 2004 , 24 27 Wiki , 25 27 Jet engine

abr 2004: 1 140 April 2004 , 2 77 Jew , 3 59 George W. Bush , 4 47 Deaths in 2004 , 5 44 Jesus , 6 42 Google search , 7 34 Asperger syndrome , 8 33 Wikipedia , 9 33 Post-invasion Iraq, 2003–present , 10 32 United States , 11 32 Beer , 12 31 European Union , 13 31 Assassination , 14 30 Israel , 15 30 Buddhism , 16 30 Adolf Hitler , 17 30 List of acronyms and initialisms , 18 30 2004 , 19 30 Rock-paper-scissors , 20 29 Islam , 21 29 List of gay, lesbian or bisexual people , 22 29 The Simpsons , 23 28 Mordechai Vanunu , 24 28 Canada , 25 28 Google bomb

mai 2004: 1 131 May 2004 , 2 91 Nick Berg , 3 85 Baghdad Central Prison , 4 63 George W. Bush , 5 46 Deaths in 2004 , 6 44 Wikipedia , 7 42 Star Trek , 8 42 Adolf Hitler , 9 42 Jesus , 10 42 European Union , 11 41 Floppy disk , 12 39 Lynndie England , 13 38 Chess , 14 35 2004 , 15 33 United States , 16 33 Abu Ghraib torture and prisoner abuse , 17 32 Manmohan Singh , 18 32 Fahrenheit 9/11 , 19 32 Enlargement of the European Union , 20 32 Jew , 21 32 Belgium , 22 31 Chinatown , 23 31 Wiki , 24<