Estatísticas da Wikipédia guzerate

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Articles per size range / Records per namespace / Most edited articles / Zeitgeist

Most metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.

Some metrics have been collected from the full archive dump which runs on lower frequency than the usual monthly cycle.
These metrics are columns F,I,J,K,M,N,O,P,Q,R from the first table.


See also metrics definitions


 
Monthly counts & Quarterly rankings: julho 2015
 
DataWikipedistasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
jul 20150%   0%      +7%      0%
jun 2015+2%   0%      -37%      +1%
mai 2015+1%   0%      +46%      +1%
abr 20150%   0%      -27%      0%
mar 20150%   0%      +114%      0%
fev 2015+1%   0%      -9%      0%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P____Q____R____S__
jul 201524019226 k 210,7   830      1,8 k
jun 2015239412226 k 110,7   777      1,8 k
mai 2015235212326 k 210,7   1,2 k      1,8 k
abr 201523318226 k 310,7   850      1,7 k
mar 201523219126 k 110,7   1,2 k      1,7 k
fev 2015231210126 k 110,7   541      1,7 k
jan 201522927226 k 210,7   594      1,7 k
dez 2014227 12126 k 110,7   661      1,7 k
nov 2014227110226 k 210,7   1,2 k      1,7 k
out 2014226510325 k 110,6   903      1,7 k
set 201422119125 k 110,6   569      1,7 k
ago 201422017325 k 110,6   755      1,7 k
jul 201421925 25 k  10,6   350      1,7 k
jun 2014217110 25 k  10,6   460      1,7 k
mai 2014216212225 k 210,6   795      1,7 k
abr 2014214212425 k 310,6   1,4 k      1,6 k
mar 2014212210225 k  10,5   988      1,6 k
fev 2014210 7225 k25 k 10,5238189%9%822136 Mb8,3 M473 k7,9 k3,4 k44 k1,6 k
jan 201421029325 k25 k310,5239889%10%1,7 k137 Mb8,3 M470 k7,9 k3,4 k43 k1,6 k
dez 2013208110325 k25 k1910,4240189%10%1,9 k137 Mb8,3 M469 k7,9 k3,4 k43 k1,6 k
nov 2013207211425 k24 k3910,6243488%10%3,4 k135 Mb8,2 M459 k8,0 k3,4 k43 k1,6 k
out 2013205215623 k23 k2211246887%9%3,4 k131 Mb8,0 M443 k7,9 k3,4 k41 k1,6 k
set 2013203313423 k22 k111,2249686%9%1,5 k129 Mb7,9 M431 k8,8 k3,3 k40 k1,6 k
ago 2013200213223 k22 k111,1249486%9%820129 Mb7,9 M431 k8,8 k3,3 k40 k1,5 k
jul 201319819223 k22 k111,1249686%9%5,6 k129 Mb7,9 M430 k10,0 k3,3 k39 k1,5 k
jun 2013197110323 k22 k410,9249686%9%19 k129 Mb7,9 M430 k10 k3,3 k39 k1,5 k
mai 2013196315322 k22 k110,1245184%9%3,3 k126 Mb7,7 M428 k10 k3,3 k39 k1,5 k
abr 2013193112122 k22 k 9,9239082%9%2,3 k124 Mb7,6 M425 k10 k3,3 k39 k1,5 k
mar 2013192320222 k22 k19,8234582%9%13 k122 Mb7,5 M424 k11 k3,3 k39 k1,5 k
fev 2013189421522 k22 k29,3213478%9%6,7 k119 Mb7,1 M417 k177 k3,3 k39 k1,5 k
jan 2013185522322 k22 k39213078%9%3,2 k118 Mb7,1 M416 k174 k3,2 k39 k1,5 k
dez 2012180627622 k22 k28,9212978%8%4,3 k117 Mb7,0 M414 k173 k3,1 k39 k1,4 k
nov 2012174317322 k22 k48,8210778%8%12 k116 Mb7,0 M413 k171 k3,1 k38 k1,4 k
out 2012171517322 k22 k18,2201975%8%12 k113 Mb6,8 M411 k170 k3,0 k38 k1,4 k
set 2012166714322 k22 k17,7200774%8%2,3 k112 Mb6,7 M410 k169 k2,9 k38 k1,4 k
ago 2012159614122 k22 k17,6200174%8%1,9 k112 Mb6,7 M410 k168 k3,0 k38 k1,4 k
jul 2012153216222 k22 k17,5200074%8%3,0 k112 Mb6,7 M410 k167 k3,0 k38 k1,4 k
jun 2012151518522 k21 k37,4199773%8%3,4 k111 Mb6,7 M408 k166 k3,0 k38 k1,4 k
mai 2012146516422 k21 k17,3198773%8%2,7 k111 Mb6,7 M407 k165 k3,1 k38 k1,4 k
abr 2012141513222 k21 k17,2198273%8%2,2 k110 Mb6,6 M406 k164 k3,3 k37 k1,3 k
mar 2012136111122 k21 k17,1198373%8%1,9 k110 Mb6,6 M406 k163 k3,3 k37 k1,3 k
fev 2012135214322 k21 k17198273%8%2,3 k110 Mb6,6 M406 k162 k3,3 k37 k1,3 k
jan 2012133419322 k21 k36,9198273%8%3,2 k110 Mb6,6 M405 k162 k3,3 k37 k1,3 k
dez 2011129315522 k21 k46,8198073%8%3,8 k109 Mb6,6 M404 k160 k3,1 k37 k1,3 k
nov 201112639322 k21 k76,7197573%8%3,1 k108 Mb6,5 M401 k159 k3,0 k37 k1,3 k
out 2011123312321 k21 k96,6198273%8%3,0 k108 Mb6,5 M399 k158 k3,0 k37 k1,3 k
set 2011120 9321 k20 k116,5199772%8%3,6 k107 Mb6,4 M392 k157 k3,1 k37 k1,3 k
ago 2011120211221 k20 k76,5201372%8%2,9 k106 Mb6,4 M385 k157 k3,1 k37 k1,2 k
jul 2011118310221 k20 k136,4201872%8%3,6 k105 Mb6,3 M382 k156 k3,1 k36 k1,2 k
jun 2011115312320 k20 k126,3203071%7%3,4 k104 Mb6,3 M373 k155 k3,1 k36 k1,2 k
mai 2011112314420 k19 k136,3199270%7%5,0 k100 Mb6,0 M365 k153 k3,0 k35 k1,2 k
abr 201110919319 k19 k136,2196469%7%3,5 k96 Mb5,8 M357 k149 k3,0 k34 k1,2 k
mar 201110817319 k18 k136,1194867%7%4,1 k94 Mb5,7 M348 k147 k3,1 k33 k1,1 k
fev 2011107618319 k18 k136193463%7%3,1 k91 Mb5,5 M337 k145 k3,1 k32 k1,1 k
jan 2011101315518 k17 k136187160%7%4,4 k87 Mb5,2 M328 k142 k2,8 k30 k1,1 k
dez 201098114518 k17 k135,8184757%7%3,6 k84 Mb5,0 M320 k140 k2,6 k28 k1,1 k
nov 201097816517 k17 k135,8179756%7%3,8 k80 Mb4,8 M312 k137 k2,3 k27 k1,0 k
out 201089412517 k16 k145,7175152%7%4,1 k76 Mb4,5 M304 k134 k2,1 k25 k1,0 k
set 201085316617 k16 k155,6167650%6%3,8 k71 Mb4,2 M293 k130 k2,2 k23 k998
ago 201082115516 k15 k165,5155745%6%8,2 k65 Mb3,8 M280 k126 k1,8 k21 k966
jul 201081312416 k15 k155,2144442%6%3,5 k59 Mb3,4 M264 k121 k1,8 k18 k877
jun 201078311315 k14 k145,1134338%5%3,6 k53 Mb3,1 M247 k116 k1,7 k16 k851
mai 201075110415 k14 k145126034%5%4,1 k49 Mb2,8 M231 k113 k1,4 k14 k828
abr 201074110214 k13 k174,9125427%5%4,3 k47 Mb2,7 M223 k111 k1,4 k14 k815
mar 201073416214 k13 k274,7122822%5%5,2 k45 Mb2,6 M212 k108 k1,4 k13 k806
fev 201069415213 k12 k184,6115420%5%4,4 k40 Mb2,3 M190 k102 k1,5 k11 k791
jan 20106528212 k11 k214,5108619%5%4,2 k36 Mb2,0 M175 k96 k1,4 k9,3 k785
dez 20096329112 k10 k214,4108419%5%3,8 k34 Mb1,9 M164 k90 k1,4 k8,8 k725
nov 20096136111 k9,8 k254,3104119%5%3,3 k31 Mb1,7 M150 k84 k1,4 k7,4 k638
out 200958112310 k8,9 k294,3105020%5%3,4 k29 Mb1,6 M135 k79 k1,4 k6,9 k557
set 200957 949,4 k7,8 k374,395820%5%3,3 k24 Mb1,4 M115 k70 k1,2 k5,4 k520
ago 20095761538,3 k6,7 k334,594321%5%3,5 k21 Mb1,2 M96 k60 k9834,7 k360
jul 2009512827,3 k5,7 k254,698023%5%2,2 k19 Mb1,1 M82 k52 k1,0 k4,4 k320
jun 2009491726,5 k4,9 k214,8100624%5%2,0 k17 Mb996 k70 k46 k8904,2 k309
mai 200948 645,9 k4,3 k27575823%5%5,4 k12 Mb686 k53 k38 k7222,1 k278
abr 2009482925,1 k3,4 k604,878519%6%2,8 k11 Mb612 k43 k34 k7722,0 k249
mar 200946 823,3 k1,7 k196,589123%7%1,6 k7,6 Mb448 k25 k28 k7291,6 k244
fev 200946 1012,7 k1,1 k37,489225%8%7646,4 Mb369 k18 k25 k5861,3 k224
jan 200946 7 2,6 k1,1 k17,386725%8%8065,9 Mb348 k17 k24 k5721,2 k218
dez 20084626 2,6 k1,0 k17,177824%8%6145,5 Mb310 k16 k22 k534970210
nov 200844 712,6 k1,0 k16,974923%7%8845,2 Mb296 k16 k21 k514858206
out 2008441712,5 k96026,671422%7%7744,9 Mb277 k15 k20 k478784196
set 200843311 2,5 k88536,565220%6%8304,5 Mb246 k14 k19 k366635191
ago 20084031012,4 k851216,464220%6%1,9 k4,2 Mb233 k13 k19 k333595182
jul 200837 711,7 k638147,874524%7%1,9 k3,6 Mb194 k10 k17 k306540177
jun 2008372811,3 k5938989329%8%1,1 k3,2 Mb170 k8,2 k16 k289496155
mai 2008354921,0 k5631510,1106435%10%1,2 k3,0 Mb160 k7,4 k14 k283458143
abr 20083125 541391216,9148043%14%5092,1 Mb118 k5,4 k14 k264421122
mar 200829151494346117,5149139%14%5612,0 Mb108 k5,0 k13 k261412116
fev 20082847 455303117,7154037%14%4831,8 Mb100 k4,7 k13 k251371111
jan 20082435 423280 17,9161638%14%4521,7 Mb96 k4,7 k13 k246373110
dez 20072135 412273117,3155137%14%4581,6 Mb90 k4,6 k12 k238332108
nov 20071821 396266 16,8152536%13%4031,6 Mb87 k4,4 k12 k235310107
out 200716 1 383265216,4152037%13%4851,6 Mb86 k4,4 k12 k235302107
set 20071612 335265 17,3171242%15%3411,5 Mb86 k4,4 k11 k234299105
ago 20071511 322261 16,9170743%15%2281,5 Mb85 k4,4 k11 k231285103
jul 200714   319261 16,3170042%15%731,5 Mb84 k4,4 k11 k232283102
jun 20071414 318260 16,2168442%15%2321,5 Mb84 k4,4 k11 k233278102
mai 20071313 315255115,6169742%16%3991,5 Mb83 k4,4 k11 k231276101
abr 200712141299242115,1142640%13%3851,2 Mb66 k3,7 k10,0 k220236100
mar 200711131267210115,4121639%12%498953 kb47 k3,3 k8,2 k19622482
fev 20071012 248196114,6126440%12%276867 kb45 k3,3 k7,7 k18223072
jan 20079   231180 14,5119936%10%261774 kb39 k3,0 k7,4 k16322471
dez 20069 1 228174 13,5121235%11%329760 kb39 k3,0 k7,0 k16321971
nov 20069   224171 12,3123235%10%44730 kb38 k3,0 k6,1 k16221270
out 2006911 223172 12,2123535%10%70730 kb38 k3,0 k6,0 k16321270
set 20068   218166 12,1122834%11%47709 kb37 k2,9 k6,0 k16321270
ago 20068   214165 12,1122335%11%75691 kb37 k2,9 k5,8 k16321270
jul 20068   211166 12122335%11%122689 kb37 k2,9 k5,7 k16321070
jun 20068   210165 11,4122235%11%130681 kb37 k2,9 k5,5 k16221070
mai 20068 1 208164 10,9121735%11%124668 kb36 k2,9 k5,3 k15920870
abr 20068   207164 10,4119635%10%150658 kb36 k2,9 k5,2 k16020869
mar 20068   205164 9,7119535%10%128651 kb36 k2,9 k4,9 k16020869
fev 20068 1 202163 9,3119636%10%25633 kb36 k2,9 k4,4 k16020868
jan 20068 21201162 9,2119836%9%217630 kb35 k2,9 k4,4 k16020868
dez 20058 1118714718,7135434%10%177611 kb37 k2,9 k3,7 k15721054
nov 20058 1 146117 9,9162641%12%24555 kb35 k2,7 k2,8 k12520345
out 20058   143117 10164541%13%15553 kb35 k2,7 k2,8 k12420345
set 20058 1 142117 9,9165542%13%29551 kb35 k2,7 k2,8 k12420345
ago 20058 1 141117 9,8165842%13%20549 kb35 k2,7 k2,7 k12420344
jul 20058 1 141117 9,7171442%13%42545 kb37 k2,7 k2,6 k12421844
jun 20058 3214111729,4170042%13%455516 kb36 k2,6 k2,5 k12422244
mai 2005823 907219,6168349%14%382315 kb24 k1,7 k9845414918
abr 20056 1 6549 7,4120940%6%84153 kb12 k676540155611
mar 20056 1 583916,972033%5%9295 kb6,1 k574242104011
fev 2005611 4117 7,585327%7%2468 kb4,0 k389179895
jan 2005512 3716 7,674627%5%4661 kb3,4 k334147784
dez 20044 4 3215 7,477831%6%4753 kb3,3 k317146783
nov 2004412 2410 7,985625%8%6040 kb2,5 k237102462
out 20043 1 154 8,747427%7%2918 kb6967522342
set 20043 2 123 8,425517% 6111 kb2991420 32
ago 2004311 93 4,453733%11%1116 kb4654133 91
jul 2004211 63 4,891750%17%1415 kb4534127 91
jun 20041   2  7,5   111 kb     1
mai 20041   1  14   17,5 kb     1
abr 20041   1  13   37,5 kb     1
mar 20041   1  10   57,3 kb     1
fev 20041   1  5   27,3 kb     1
jan 20041   1  3   27,3 kb     1
dez 200311  1  1   12,7 kb      
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
The following table ranks this project in relation to projects in other languages with 1000+ articles
abr 2015891331059497 98199   106      242
jan 201589931049897 119199   119      242
out 20148865948297 129199   100      242
jul 20148791112 96  197   134      242
abr 201486101897796 101195   94      242
jan 2014861081018795821051974333139976677746212273242
out 20138610076659585481923943143736878756312075242
jul 201386109949093841211923843144636677746411973242
abr 2013861178211593831612004253143986676747411972242
jan 2013867367849181107203526314112668757214811868242
out 201287697280877912320457701467266746914911964242
jul 20129192801018678128202567114511664716614411763242
abr 2012917083958375131202567014512664716614410461242
jan 2012917676868074101201556414111161706514210459242
out 201193838783797174201566214112359676414110559242
jul 201194819297787173197526013911259646513710358242
abr 2011961129784777063193566714110060666213610558242
jan 201197828065777165190589514210861666413510262242
out 2010100748269777364186631071399464696613511563242
jul 2010101798275807256181841221369870796813511769242
abr 20109911892908174621809214613910671837113712372242
jan 20101029197928578531771081581379178857914111981242
out 2009103106798290854117310815513510181898014511786242
jul 2009107107929194944816610814613214093999415913198242
abr 200910492869210310428163124149128114107112108167141112242
jan 200910413299130120139127150113136112162125125132175148125241
out 200810211394106121136106148124136113153127129132174150131240
jul 20081061459811013414356136111126109118136139142178170141239
abr 200811189112131163149109147147146144158146152154173169143239
jan 200812083119133160153154142142141140153145152153167161142236
out 2007134141171132154147116140140138138161145150150163155144234
jul 2007136142191124151144136133133132130175139148146154148141231
abr 2007134109113102149141118128128127125138140146147147139138226
jan 2007142124183124152143136122122122120148144152145145145131223
out 2006137111146118142132137115115115114163129138134136131124220
jul 2006129129163108132122121105105105105136119129122121121115209
abr 200611012016210512211611893939392121109115111112106103204
jan 200610010210578110106106868686851011011041001039491189
out 200591981278410610098818181801379998941008986188
jul 200582861068098929070707070106898685928481179
abr 200584849575979585595959598796909210294106172
jan 200581687362979776545454548697979210691132168
out 200486678155969870515151518210110810112288144167
jul 200480637450908759434343438289991148284115146
abr 200497   100      9187     131
jan 200488   89      9172     120
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
 WikipedistasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikipedistas (usuários registrados)
A = Wikipedistas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikipedistas que editaram pelo menos dez vezes desde que chegaram
C = Wikipedistas que contribuíram cinco vezes ou mais este mês
D = Wikipedistas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Artigos que contêm pelo menos uma ligação interna e 200 caracteres de texto legível, não contando códigos wiki e html,
      ligações ocultas, etc.; títulos também não contam (outras colunas são baseadas no método oficial de contagem)
G = Novos artigos por dia no mês passado
H = Número médio de revisões por artigo
I = Tamanho médio dos artigos em bytes
J = Porcentagem de artigos com pelo menos 0,5 kb de texto legível (veja F)
K = Porcentagem de artigos com pelo menos 2 kb de texto legível (veja F)

Base de dados
L = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
M = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
N = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
O = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
P = Total de ligações para outras wikipédias
Q = Total de imagens apresentadas
R = Total de ligações para outros sítios
S = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  2500  5  10  100  1000  10000  1  3  5  10  25  100  250  5  10  100  1000  1  3  5  10  25  100  250  5  10  100 
jul 201536169852        18654211    31128531    
jun 20154417121152   1    17866411    271210641 1  
mai 201546191210631  211  14865411    29137642    
abr 2015331387521  1    2186421122222410762  11 
mar 201540139631   111  2696411111113112742  1  
fev 2015231110951        20872211    287421     
jan 201528117632   11   14764111    3414103111   
dez 2014291412961   11   11765311    3710864     
nov 201442131010822  11   201497711    502314951    
out 2014361410853   211  14554111    4515843     
set 201441139521        16762211    3110631     
ago 201437157663   1    14443211    4716832     
jul 20142913533   11   9422111    461913731    
jun 201431141073   11   11332111    39137741    
mai 2014461512862   11   1255521     52161294     
abr 20143715128541  22   1676531     451713751    
mar 20143412107521  11   1375541     3712854     
fev 20142787532   221  1188711     308742     
jan 2014321198632  331  9664411    43129631    
dez 20133815107432  1    14976211    511610752    
nov 201333131198431 111  1586641     56169852    
out 2013482215107631 1    17998721    4918118642   
set 201346191311641  11   14987411    5517963  21 
ago 2013401613932   32   18973111    4112621  221
jul 201334129742   4211 18874211    389643  22 
jun 20133617107631  322211997651     49141072  5  
mai 20134519151063   4321 17988611    5013965  22 
abr 2013491812941   5411 1955421 1   5011542  43 
mar 20135525201572   11832 208641111   8029191153 851
fev 2013532521181251  201741 23995311    94342413521531
jan 201360272215931  24175  211296411    7020141071 761
jul 201536169852        18654211    31128531    
abr 2015331387521  1    2186421122222410762  11 
jan 201528117632   11   14764111    3414103111   
out 2014361410853   211  14554111    4515843     
jul 20142913533   11   9422111    461913731    
abr 20143715128541  22   1676531     451713751    
jan 2014321198632  331  9664411    43129631    
out 2013482215107631 1    17998721    4918118642   
jul 201334129742   4211 18874211    389643  22 
abr 2013491812941   5411 1955421 1   5011542  43 
jan 201360272215931  24175  211296411    7020141071 761
out 20126029178431  271752 226553  111 11331197311842
jul 2012462516952   25148  21764321111 105381693  741
abr 20124722131072   22173  24118551     983521883176 
jan 201261231913933  26215  1898541     1152819106  52 
out 20113417127332  28215  116642      92231342  97 
jul 201142161083221 28194  1022111     101281751  41 
abr 20113415954321 22164  74211      80231341  84 
jan 2011511915119511 26194  1665411     11026181321 118 
out 201046201286521 19124  86322      9722151031 73 
jul 2010552212119411 25183  137532      1133118123  63 
abr 201031191096211 18144  92222      79271162  82 
jan 20102812875211117122  136442      83221394  21 
out 200925131275321 20145  1065421     99282093  21 
jul 2009231187421  17132  128663      1183123111     
abr 20091910985211 1815   168651      1384024137  4  
jan 20092311764   2114   96541      135382072  32 
out 200817107641   107   156321      125361882  3  
jul 200814875311  991  148421      1594731941 2  
abr 200887543   87   63321      1162614106  51 
jan 2008128542   85   83332      130291672  2  
out 2007741     951  711        16545281472 21 
jul 200752     4               1704525931 2  
abr 2007854331   42   63111      16155281252 2  
jan 20073      321  2          16548271471131 
out 200642111   1    2          158341772  11 
jul 20063      21   1          159522371     
abr 20063      111  1          1224221111     
jan 2006632111   11   521        14850261231 1  
out 20051                      901982      
jul 20054111    11   3          87261731     
abr 200532111        32         71187411    
jan 20053221         1          361121      
out 20044311         321        179741     
jul 20042111         1          13421      
abr 20041                      2         
jan 2004                       1      1  

 

Distribuição de edições de artigos por wikipedistas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikipedistasEdições total
11,753100.0%119,925100.0%
354230.9%118,11598.5%
1024313.9%116,42197.1%
321096.2%114,09395.1%
100563.2%111,05492.6%
316321.8%107,07689.3%
1000150.9%98,58282.2%
316260.3%84,63170.6%
1000010.1%50,86942.4%
3162310.1%50,86942.4%

 

34 wikipedistas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdições 
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
 agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
સતિષચંદ્રUC1 050,86942,5522fev 15, 2008272217,404---
Sushant savlaUC2 09,81132,0891nov 05, 200824581,375---
Ashok modhvadiaUC3 08,7831674,50446ago 27, 200825281,409---
DsvyasUC4 07,906637,200150dez 13, 200727861042--
KartikMistryUC6 03,4402241,671111jan 01, 2012130613718--
ArbhattUC25+3424354984out 07, 2014296222--
AniketUC42+30168993117mai 08, 2005373551--
Nizil ShahUC44+2153181619jun 30, 2008258612---
હમઝા ઘાંચીUC50-1118272-dez 02, 2011133661--
KokilaMistryUC79+6591018-ago 21, 2013708163--
Deeprana94UC135+72418-jun 26, 2012112911--
Lala khanUC144...232355jul 13, 2015171515--
Syum90UC164+161832-out 28, 2014275----
BillinghurstUC207+29122182dez 10, 20111328----
LakhanSamaniUC243+131104--jun 30, 2015301---
Keyur.tithalUC264+2791--fev 03, 2014542----
DineshdanUC268...99--jul 17, 201513----
BlacknclickUC297+7582--nov 23, 2014249----
Chirag4UC522+105443--dez 16, 2013591----
Raj VanrajUC541...4433jul 14, 201516----
પગી દિલીપકુમાર કે.UC542...44--jul 24, 20156----
Patelbhavu14UC990...22--jul 09, 201521----
MydreamsparrowUC991...22--jul 17, 201513----
Md aminUC1743...11--jul 06, 201524----
P8ruralUC1744...11--jul 09, 201521----
राजु सुथारUC1745...11--jul 10, 20152011--
લગ્ધિરસિંહ ગોહિલUC1746...11--jul 11, 201519----
Loup Solitaire 81UC1747...11--jul 12, 201518----
Daniel-BrownUC1748...11--jul 14, 201516----
રાજુ ગીલાતરUC1749...11--jul 17, 201513----
સંતોષ વ્યાસUC1750...11--jul 22, 20158----
Kishor boghaniUC1751...11--jul 24, 20156----
Jay m trivediUC1752...11--jul 28, 20152----
Lucas559UC1753...11--jul 30, 2015 11--

 

20 wikipedistas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
  Primeira ediçãoúltima edição
 posiçãototaldatadias
atrás
datadias
atrás
PSPatelUC53,822abr 29, 20092283dez 26, 20111312
Maharshi675UC72,665set 29, 20072861jun 07, 201553
વિહંગUC81,935jun 30, 20121125out 07, 2014296
Harsh4101991UC91,747jan 22, 20121285dez 01, 2013606
Sam.lditeUC101,648set 15, 20121048jun 07, 2013783
Vyom25UC111,292nov 17, 20111351mai 06, 201585
SpundunUC121,241jul 21, 20044026mai 01, 20073012
જીતેન્દ્રસિંહUC131,216set 14, 20082510mar 10, 2014507
SunilUC141,129mar 05, 20101973ago 09, 2013720
TekinaUC151,078jun 08, 20111513jun 30, 20121125
મહાથીUC16985set 22, 2013676fev 15, 2014530
DBhavsar709UC17735nov 08, 2012994ago 09, 2013720
Sanjay BalotiyaUC18597abr 13, 20111569abr 23, 2014463
JaishreeUC19568fev 07, 20101999jul 18, 20101838
Rangilo GujaratiUC20556out 17, 20111382out 03, 2013665
Akash96UC21537jul 20, 20121105dez 08, 2014234
SushilmishraUC22528nov 14, 2014258dez 16, 2014226
V dasUC23457fev 20, 20101986out 29, 20101735
યોગેશ કવીશ્વરUC24438mai 17, 2013804nov 01, 2014271
PranayUC26422mai 15, 20111537mar 13, 20121234

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 17.279 edições foram feitas por usuários anônimos, de um total de 278.989 edições ( 6e %)
  


50 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições 
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
 datadias
atrás
datadias
atrás
GubotUC138,934mai 17, 20092265mai 28, 201563--
HarshBotUC215,940set 27, 20121036nov 16, 2012986--
SamkbotUC312,476nov 23, 2012979jun 04, 2013786--
EmausBotUC48,747jul 09, 20101847jan 12, 2014564--
XqbotUC57,224jan 19, 20092383mai 06, 2014450--
Luckas-botUC65,851nov 30, 20082433mai 20, 20121166--
SieBotUC74,136ago 18, 20072903jan 25, 20111647--
AddbotUC84,057mar 06, 2013876ago 27, 2013702--
MerlIwBotUC93,325abr 24, 20111558ago 08, 2013721--
TXiKiBoTUC103,273dez 12, 20063152dez 20, 2012952--
WikitanvirBotUC112,320out 20, 20101744mai 15, 20121171--
VolkovBotUC122,277abr 20, 20073023mar 04, 2013878--
ZéroBotUC132,269out 16, 20101748mar 06, 2013876--
MelancholieBotUC142,217abr 03, 20082674nov 28, 20092070--
EscarbotUC152,069jul 01, 20063316fev 07, 2013903--
ArthurBotUC161,602jan 07, 20092395out 07, 20121026--
ChuispastonBotUC171,373dez 14, 20101689abr 28, 20121188--
FoxBotUC181,334out 01, 20092128fev 04, 20121272--
JAnDbotUC191,196nov 08, 20063186jul 03, 2013757--
Thijs!botUC201,090dez 12, 20063152jul 30, 20121095--
KamikazeBotUC211,051jul 04, 20101852jan 26, 2013915--
RedBotUC22945set 01, 20101793ago 21, 20121073--
TjBotUC23790jun 01, 20101885mar 06, 2013876--
CommonsDelinkerUC24695mai 31, 20072982jul 13, 201517--
LegobotUC25650mar 11, 2013871abr 02, 2013849--
JotterbotUC26629jul 27, 20092194jan 22, 2013919--
AlexbotUC27623jan 30, 20082738ago 23, 20111437--
HRoestBotUC28586jun 19, 20101867mar 05, 2013877--
Idioma-botUC29581set 05, 20082519mar 03, 2013879--
LaaknorBotUC30554jul 27, 20082559mar 07, 2013875--
JackieBotUC31542out 21, 20101743nov 16, 2014256--
YurikBotUC32534jan 07, 20063491ago 25, 20063261--
Ripchip BotUC33533mar 10, 20111603fev 17, 20121259--
PtbotgourouUC34521set 29, 20082495mar 05, 2013877--
SynthebotUC35518jun 07, 20082609jan 31, 2013910--
AlleborgoBotUC36510out 28, 20072832dez 03, 20082430--
Dinamik-botUC37494fev 07, 20101999dez 23, 2012949--
Movses-botUC38459dez 21, 20101682mar 18, 20121229--
RubinbotUC39449abr 06, 20092306mar 04, 2013878--
AvicBotUC40408jun 20, 20111501dez 09, 2012963--
YFdyh-botUC41379jun 20, 20121135fev 24, 2013886--
AvocatoBotUC42373out 21, 20111378fev 27, 2013883--
DragonBotUC43347out 19, 20072841fev 04, 2013906--
ZorrobotUC44342set 07, 20082517set 06, 20121057--
VagobotUC45340set 20, 20111409set 06, 20121057--
MystBotUC46334mai 16, 20101901mar 03, 20121244--
MastiBotUC47333nov 29, 20092069fev 28, 2013882--
CarsracBotUC48332nov 17, 20082446mar 01, 2013881--
RobbotUC49324jul 08, 20053674jan 03, 2013938--
PipepBotUC50324ago 20, 20072901jun 09, 20082607--

 

Artigos que contêm pelo menos uma ligação interna e .. caracteres de texto legível, não contando códigos wiki e html,
ligações ocultas, etc.; títulos também não contam  (excluindo páginas de redirecionamento)

DataArtigos
 < 32 ch< 64 ch< 128 ch< 256 ch< 512 ch< 1 k ch< 2 k ch< 4 k ch< 8 k ch< 16 k ch< 32 k ch< 64 k ch
out 20100.1%0.3%1.1%9.8%48.6%89.6%93.5%95.9%97.0%97.8%98.6%99.6%
set 20100.1%0.3%1.2%10.2%50.9%89.8%93.8%96.2%97.2%97.9%98.7%99.6%
ago 20100.1%0.3%1.2%10.4%55.5%90.1%94.0%96.3%97.3%98.0%98.7%99.5%
jul 20100.2%0.4%1.3%11.2%59.1%90.6%94.4%96.7%97.7%98.3%98.9%99.6%
jun 20100.2%0.4%1.3%11.6%62.4%90.9%94.7%96.9%97.9%98.5%99.0%99.7%
mai 20100.2%0.4%1.4%12.2%66.6%91.3%95.0%97.2%98.2%98.8%99.2%99.8%
abr 20100.2%0.4%1.4%12.5%73.2%91.4%95.0%97.2%98.2%98.8%99.2%99.8%
mar 20100.2%0.4%1.4%13.0%78.6%91.3%94.9%97.1%98.1%98.6%99.0%99.6%
fev 20100.2%0.4%1.5%14.2%80.0%91.3%95.0%97.3%98.3%98.8%99.2%99.7%
jan 20100.2%0.4%1.6%14.8%80.5%91.4%95.0%97.3%98.3%98.8%99.2%99.6%
dez 20090.2%0.5%2.4%15.9%81.4%91.5%95.1%97.4%98.5%99.0%99.4%99.8%
nov 20090.2%0.5%3.4%16.4%81.0%91.3%95.1%97.5%98.6%99.1%99.5%99.9%
out 20090.2%0.5%3.6%17.7%80.3%90.9%94.8%97.2%98.4%98.9%99.3%99.7%
set 20090.3%0.7%5.2%21.3%80.0%91.1%95.1%97.4%98.6%99.1%99.5%99.8%
ago 20090.3%0.7%5.7%23.9%78.9%90.9%95.1%97.4%98.6%99.1%99.5%99.8%
jul 20090.4%0.9%6.3%26.8%77.4%90.5%95.0%97.4%98.7%99.2%99.6%99.9%
jun 20090.4%0.9%6.7%30.2%76.0%90.0%94.7%97.3%98.5%99.0%99.4%99.8%
mai 20090.5%1.1%7.4%33.5%76.5%90.3%95.0%97.8%99.1%99.7%100.0%100.0%
abr 20090.5%1.2%8.2%38.8%81.0%89.4%94.3%97.3%98.7%99.3%99.6%99.8%
mar 20090.8%1.9%12.3%57.4%76.8%85.8%92.7%96.7%98.8%99.5%99.9%100.0%
fev 20091.0%2.3%14.7%62.7%74.4%84.2%91.7%96.2%98.6%99.4%99.7%99.9%
jan 20091.0%2.4%15.2%62.9%74.8%84.3%91.7%96.2%98.7%99.5%99.8%100.0%
dez 20081.1%2.5%15.5%64.1%75.8%85.2%92.3%96.6%99.0%99.7%100.0%100.0%
nov 20081.1%2.5%15.6%64.8%76.4%85.6%92.6%96.6%98.8%99.5%99.9%100.0%
out 20081.1%2.6%16.0%66.6%77.9%86.6%92.9%96.8%98.9%99.7%100.0%100.0%
set 20081.2%2.7%16.4%68.4%79.7%88.0%93.9%97.2%98.9%99.6%99.9%100.0%
ago 20081.2%2.8%17.0%68.6%79.8%88.1%94.1%97.5%99.1%99.8%100.0%100.0%
jul 20081.8%4.1%22.2%65.1%75.6%85.5%93.1%96.9%98.8%99.6%100.0%100.0%
jun 20082.4%5.4%30.5%55.7%69.3%81.6%91.3%96.0%98.6%99.4%100.0%100.0%
mai 20083.1%6.6%20.6%47.0%63.1%78.1%89.2%95.0%98.1%99.0%99.7%99.8%
abr 20086.2%12.9%17.4%31.6%54.7%72.4%85.8%92.9%97.0%98.7%99.8%100.0%
mar 20086.8%14.3%19.7%34.6%58.7%73.4%86.1%92.7%96.6%98.3%99.8%100.0%
fev 20089.0%17.6%21.1%36.8%60.2%73.2%85.7%92.4%96.6%98.2%99.8%100.0%
jan 20088.7%17.1%19.9%34.7%58.1%71.8%84.5%91.9%96.2%98.2%99.7%100.0%
dez 20078.8%17.6%20.2%35.5%59.9%72.9%85.9%92.6%96.5%98.3%99.9%100.0%
nov 20079.3%17.8%20.7%36.6%61.2%73.9%86.6%92.7%96.4%98.3%99.9%100.0%
out 20079.3%17.8%20.7%36.9%61.3%74.0%86.7%92.5%96.2%98.1%99.7%100.0%
set 20070.3%2.8%6.0%25.2%54.5%69.3%84.4%91.0%95.4%97.6%99.5%99.8%
ago 20070.3%2.5%6.0%25.2%55.2%69.9%84.3%91.3%95.5%97.7%99.6%99.9%
jul 20070.3%2.5%6.0%25.2%55.9%70.3%84.4%91.4%95.6%97.8%99.7%100.0%
jun 20070.6%2.8%6.3%26.0%56.3%70.6%84.3%91.3%95.4%97.6%99.5%99.8%
mai 20070.6%3.2%6.7%26.7%56.7%70.2%84.1%91.2%95.4%97.7%99.6%99.9%
abr 20070.7%3.4%6.8%27.5%58.0%72.2%86.4%93.2%96.6%98.3%100.0%100.0%
mar 20070.4%3.5%9.2%31.0%59.7%73.9%88.1%95.4%98.1%98.5%100.0%100.0%
fev 20071.3%2.6%7.2%29.0%58.0%73.1%87.4%95.4%97.9%98.3%100.0%100.0%
jan 20072.2%3.5%8.4%30.8%61.7%76.0%89.0%95.7%97.5%97.9%99.7%99.7%
dez 20062.3%3.7%8.7%31.2%62.4%75.7%89.0%95.9%97.7%98.2%100.0%100.0%
nov 20061.9%2.4%6.7%29.7%61.8%76.2%89.1%95.8%97.7%98.2%100.0%100.0%
out 20061.4%1.9%6.2%29.2%61.7%76.1%89.0%95.7%97.6%98.1%100.0%100.0%
set 20061.0%1.5%6.4%31.8%63.0%78.1%88.8%95.6%97.6%98.1%100.0%100.0%
ago 20061.0%1.5%5.9%31.9%62.8%78.5%88.8%95.7%97.7%98.2%100.0%100.0%
jul 20061.0%1.5%5.9%31.9%62.8%78.5%88.8%95.7%97.7%98.2%100.0%100.0%
jun 20061.0%1.5%6.9%32.4%62.8%78.5%88.8%95.7%97.7%98.2%100.0%100.0%
mai 20060.5%1.0%6.4%32.1%62.8%78.6%89.0%95.4%97.4%97.9%99.9%99.9%
abr 20060.5%1.0%6.4%32.1%63.3%79.1%90.0%95.4%97.4%97.9%99.9%99.9%
mar 20060.5%1.0%6.0%32.2%63.4%79.2%90.1%95.5%97.5%98.0%100.0%100.0%
fev 20060.5%1.0%6.0%32.2%62.9%79.2%90.1%95.5%97.5%98.0%100.0%100.0%
jan 20060.5%1.0%6.0%32.4%62.7%79.1%90.5%95.5%97.5%98.0%100.0%100.0%
dez 20050.5%1.6%6.5%33.3%64.4%79.2%89.6%94.5%96.7%97.2%99.9%99.9%
nov 20050.7%2.1%8.3%27.5%58.3%74.1%87.8%93.3%96.0%96.7%100.0%100.0%
out 20050.7%2.8%7.0%26.4%58.3%73.6%87.5%93.1%95.9%96.6%100.0%100.0%
set 20050.7%2.1%6.3%25.9%58.1%73.5%87.5%93.1%95.9%96.6%100.0%100.0%
ago 20050.7%2.1%6.3%25.9%58.1%73.5%87.5%93.1%95.9%96.6%100.0%100.0%
jul 20050.7%2.1%6.3%25.9%58.1%73.5%87.5%93.1%95.9%96.6%100.0%100.0%
jun 20050.7%2.1%6.3%25.9%58.1%73.5%87.5%93.1%95.9%96.6%100.0%100.0%
mai 20051.1%4.3%11.7%26.6%52.1%68.1%86.2%93.6%95.7%97.8%99.9%99.9%
abr 20050.0%4.6%9.2%27.7%58.5%75.4%93.9%97.0%98.5%98.5%100.0%100.0%
mar 20053.6%9.0%14.4%35.8%66.2%80.5%94.8%98.4%100.0%100.0%100.0%100.0%
fev 20053.2%9.7%22.6%45.2%64.6%80.7%90.4%96.9%100.0%100.0%100.0%100.0%
jan 20053.3%10.0%23.3%46.6%66.6%83.3%93.3%96.6%99.9%99.9%99.9%99.9%
dez 20043.6%10.7%25.0%46.4%64.3%82.2%92.9%96.5%100.0%100.0%100.0%100.0%
nov 20045.0%15.0%30.0%45.0%70.0%85.0%90.0%95.0%100.0%100.0%100.0%100.0%
out 200418.2%45.5%45.5%54.6%63.7%91.0%91.0%100.0%100.0%100.0%100.0%100.0%
set 200425.0%37.5%37.5%50.0%75.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
ago 200437.5%37.5%37.5%50.0%62.5%87.5%87.5%100.0%100.0%100.0%100.0%100.0%
jul 20040.0%0.0%0.0%20.0%40.0%80.0%80.0%100.0%100.0%100.0%100.0%100.0%

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.

See also Category Overview Complete
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110GifJpgOggPdfPngSvg
jul 201528 k1,6 k1,2 k2771044,5 k111,2 k       424742191
jun 201528 k1,6 k1,2 k2771044,5 k111,2 k       424742191
mai 201528 k1,6 k1,1 k2771014,5 k111,2 k       424742191
abr 201528 k1,6 k1,1 k2771014,5 k111,1 k       424742191
mar 201527 k1,6 k1,1 k2771014,5 k111,1 k       424742191
fev 201527 k1,6 k1,0 k2771014,5 k111,1 k       424742191
jan 201527 k1,5 k9962771014,5 k111,1 k       424742191
dez 201427 k1,5 k9742771014,4 k111,1 k       424742191
nov 201427 k1,5 k9312771014,4 k101,1 k       424742191
out 201427 k1,5 k8952771014,4 k101,1 k       424742191
set 201427 k1,5 k8682771014,4 k101,1 k       424742191
ago 201427 k1,5 k8342771014,4 k101,1 k       424742191
jul 201427 k1,5 k7962771014,4 k101,1 k       424742191
jun 201427 k1,5 k7612771014,3 k101,1 k       424742191
mai 201427 k1,5 k7402771004,3 k101,1 k       424742191
abr 201427 k1,5 k709277994,3 k101,1 k       424742191
mar 201427 k1,5 k674276994,3 k91,1 k       424742181
fev 201427 k1,4 k617276994,3 k81,1 k      497424742181
jan 201427 k1,4 k596276994,2 k81,1 k      1211424742181
dez 201327 k1,4 k573276994,2 k81,1 k      1791424742181
nov 201326 k1,4 k558276984,2 k81,1 k      2849424742181
out 201325 k1,4 k546275984,2 k81,0 k      2993424742171
set 201324 k1,4 k519275984,1 k81,0 k      1038424742171
ago 201324 k1,4 k498275984,1 k81,0 k      522424742171
jul 201324 k1,4 k477275984,1 k8996      506424742171
jun 201324 k1,3 k443275984,0 k8987      811424742171
mai 201324 k1,3 k417275984,0 k8975      753424742171
abr 201324 k1,3 k381275984,0 k8961      401424742171
mar 201324 k1,3 k333275974,0 k8961      864424742171
fev 201324 k1,3 k304275974,0 k8952      1515424742171
jan 201324 k1,3 k279275974,0 k8941      1138424742171
dez 201224 k1,2 k242275953,9 k8936      2260424742171
nov 201224 k1,2 k212274893,7 k7885      1146424642171
out 201223 k1,2 k200274873,6 k7851      822424642171
set 201223 k1,1 k189274843,5 k7840      836424642171
ago 201223 k1,1 k156273843,5 k7832      521424642161
jul 201223 k1,1 k141273843,4 k7831      692424642161
jun 201223 k1,1 k138273833,4 k7822      1377424642161
mai 201223 k1,0 k136273773,0 k7815      1319424642161
abr 201223 k1,0 k133273772,8 k5806      696424642161
mar 201223 k990131269772,5 k5798      4854246 2161
fev 201223 k966128261772,5 k5794      8714244 2101
jan 201223 k943124261772,5 k5790      15454244 2101
dez 201123 k908122258772,4 k5758      16784241 2101
nov 201123 k890122255772,3 k5717      12274238 2101
out 201123 k856121255772,2 k5707      14944238 2101
set 201122 k840118251772,2 k5698      15224235 291
ago 201122 k823115251772,2 k5687      10794235 291
jul 201122 k810115250772,2 k5684      17104235 281
jun 201121 k791115250772,2 k4680      17364235 281
mai 201121 k778113245772,2 k4676      20224230 281
abr 201120 k763111240772,2 k4670      20284225 281
mar 201120 k750111238772,1 k4661      22384223 281
fev 201120 k737111233772,1 k4654      15304218 281
jan 201119 k722111227772,1 k4651      24604212 281
dez 201019 k704109220772,1 k4617      19964205 281
nov 201018 k692109218772,0 k4610      22874203 281
out 201018 k681109218772,0 k4600      22494203 281
set 201018 k669105218772,0 k4585      26124203 281
ago 201017 k655105218772,0 k4576      29124203 281
jul 201016 k623103214771,9 k4559      19904200 28 
jun 201016 k609102206771,9 k4541      24004192 28 
mai 201016 k585102203771,9 k4527      29184190 18 
abr 201015 k574102200771,8 k4499      25304187 18 
mar 201015 k562102198771,8 k4485      36823186 18 
fev 201014 k537101174771,8 k4467      30233162 18 
jan 201013 k523101167771,8 k4409      30633155 18 
dez 200912 k503100165771,8 k4391      26743153 18 
nov 200912 k493100161771,7 k4372      21463149 18 
out 200911 k477100160771,7 k4361      21523148 18 
set 200910,0 k473100160771,7 k4344      23973148 18 
ago 20098,7 k458100160771,7 k4299      18763148 18 
jul 20097,7 k43599156771,6 k4263      12843144 18 
jun 20096,9 k41798136771,6 k4241      12713124 18 
mai 20096,2 k40798125771,6 k4222      14083113 18 
abr 20095,3 k39996122771,6 k4198      22193110 18 
mar 20093,5 k38496103771,5 k4149      1086391 18 
fev 20092,9 k3759398771,5 k4118      321386 18 
jan 20092,8 k3619298771,5 k4117      326386 18 
dez 20082,8 k3488995771,5 k4113      233383 18 
nov 20082,8 k3388995771,5 k4112      333383 18 
out 20082,7 k3208877771,4 k4106      397367 16 
set 20082,7 k2978665771,4 k497      429356 15 
ago 20082,5 k2848660771,4 k380      936351 15 
jul 20081,9 k2698657771,4 k376      707348 15 
jun 20081,4 k2518555771,4 k375      614346 15 
mai 20081,2 k2278555771,4 k270      843346 15 
abr 20086632158448771,4 k270      221339 15 
mar 20086102088448771,3 k268      301339 15 
fev 20085661958439761,3 k256      192330 15 
jan 20085331908338741,3 k256      173230 15 
dez 20075201818132741,3 k256      147225 14 
nov 20075031768028741,2 k256      37221 14 
out 20074901717926741,2 k256      22219 14 
set 20074401607223741,2 k250      28216 14 
ago 20074251567017741,1 k250      11111 14 
jul 20074211486717741,1 k250      14111 14 
jun 20074201446617741,1 k250      51111 14 
mai 20074161396613741,1 k248      9017 14 
abr 20073991346613731,1 k247      20817 14 
mar 2007349123581019998136      23414 14 
fev 200732011354818934135      9512 14 
jan 200730210353618924135      41  14 
dez 200629910153518606135      151   4 
nov 20062949453418597135      2    4 
out 20062939353418583135      33    4 
set 20062889053418582135      3    4 
ago 20062848752418581135      3    4 
jul 20062818051418577135      4    4 
jun 20062807751418575134      7    4 
mai 20062787651418560134      13    4 
abr 20062767251418558134      4    4 
mar 20062747151418548134      2    4 
fev 20062706951418539134      8    4 
jan 20062696751418462134      179    4 
dez 20052414447418373 29      123    4 
nov 20051914347417320 28      13    4 
out 20051883946417318 27      2    4 
set 20051873846417312 27      7    4 
ago 20051853646417310 27      7    4 
jul 20051853444417304 27      17    4 
jun 20051853043417300 27      444    4 
mai 20051082932317245 22      284    3 
abr 2005762630217149 19      62    2 
mar 200569222721758 13      90    2 
fev 200546212621744 2      16    2 
jan 200541172621734 2      26    2 
dez 200435162521733 2      40    2 
nov 200426142321629 2      47    2 
out 200417132121622 2      23    2 
set 200414916 1614 1      34      
ago 200410612 157               
jul 20047410 157               
jun 2004349 154               
mai 2004229 104               
abr 2004225 64               
mar 20042 4 63               
fev 20042 2 63               
jan 20042 1 62               
dez 20031 1  1               

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

jan 2004: 1 1 HomePage

mar 2004: 1 1 મુખપૃષ્ઠ

abr 2004: 1 1 મુખપૃષ્ઠ

mai 2004: 1 1 મુખપૃષ્ઠ

jul 2004: 1 2 મુખપૃષ્ઠ , 2 1 પ્રતિજ્ઞા પત્ર

ago 2004: 1 1 મહાત્મા ગાંધી

set 2004: 1 2 ગુજરાત , 2 1 Main Page

out 2004: 1 2 ભારત , 2 2 મીરાંબાઈ , 3 2 ગુજરાતી દૈનિકપત્રોની યાદી

nov 2004: 1 3 મુખપૃષ્ઠ , 2 2 પાકિસ્તાન , 3 2 ૧૯૯૩ , 4 2 કાશ્મીર , 5 1 દયારામ

dez 2004: 1 2 બિહાર , 2 2 વર્જિન એટલાંટિક , 3 2 ઢાકા , 4 1 વેલિંગ્ટન

jan 2005: 1 2 આસામ

fev 2005: 1 2 ગૉડફ્રે હારૉલ્ડ હાર્ડિ , 2 2 અમદાવાદ

mar 2005: 1 2 ઐશ્વર્યા રાય , 2 2 જગદીશચંદ્ર બોઝ , 3 2 આશિત દેસાઈ , 4 2 નરેન્દ્ર મોદી , 5 2 મીરાંબાઈ , 6 1 અબૅલ

abr 2005: 1 2 મહાત્મા ગાંધી , 2 2 મુખપૃષ્ઠ , 3 1 ભારત

mai 2005: 1 3 ભુજ , 2 3 વડોદરા , 3 2 ચંદ્ર , 4 2 કાર્બન , 5 2 મોહનદાસ કરમચંદ ગાંધી , 6 2 સૂર્યમંડળ , 7 2 ભારતના વડાપ્રધાન , 8 2 ભારતના રાષ્ટ્રપતિ , 9 1 ભારત

jun 2005: 1 3 નક્ષત્ર , 2 3 અમદાવાદ , 3 2 ભારત , 4 2 છત્તીસગઢ , 5 2 મધ્ય પ્રદેશ , 6 2 મહારાષ્ટ્ર , 7 2 બળ , 8 2 દળ , 9 2 તરંગલંબાઇ , 10 2 વિદ્યુત-ચુંબકીય તરંગો , 11 2 ગંગા નદી , 12 2 ક્ષ-કિરણો , 13 2 ધૂમકેતુ , 14 2 ઉષ્મા

jul 2005: 1 1 ધૂમકેતુ

ago 2005: 1 1 ભૂમિતિ

set 2005: 1 1 ખગોળ શાસ્ત્ર

out 2005: 1 1 જન ગણ મન

nov 2005: 1 1 ઇમરાન ખાન

dez 2005: 1 2 ચલાલા (તા. ધારી) , 2 2 લોકશાહી , 3 1 ભારત

jan 2006: 1 3 કેટલાક જાણીતા ગુજરાતીઓ , 2 2 ગાંધીનગર , 3 2 સાબરકાંઠા જિલ્લો , 4 2 ચલાલા (તા. ધારી) , 5 2 ઇમરાન ખાન , 6 2 હિન્દુ-અરેબીક અંકો , 7 2 અમિતાભ બચ્ચન , 8 2 ગુજરાત , 9 1 ભારત

fev 2006: 1 2 સુરત , 2 1 રોટલી

mar 2006: 1 1 ઇસ્‍લામ

abr 2006: 1 1 ભારત

mai 2006: 1 2 કનૈયાલાલ મુનશી , 2 1 હીન્દી

jun 2006: 1 1 રમેશ પારેખ

jul 2006: 1 1 પાલનપુર

ago 2006: 1 1 ગાંધી આશ્રમ

set 2006: 1 1 સત્ય ઇસુ દેવળ

out 2006: 1 2 રાની મુખર્જી , 2 1 યાક

nov 2006: 1 1 ચીન

dez 2006: 1 1 નેપાલ સ્કાઉટ

jan 2007: 1 1 મુખપૃષ્ઠ/જુનું-૧

fev 2007: 1 2 ભારતના ભાગલા , 2 2 ચાણક્ય , 3 2 રામાયણ , 4 1 શ્રીમદ્ ભગવદ્ ગીતા

mar 2007: 1 3 મુખપૃષ્ઠ/જુનું-૧ , 2 2 વાદળ , 3 2 સંસ્કૃત ભાષા , 4 2 કુરોવ , 5 2 વેગમાન સંરક્ષણનો નિયમ , 6 2 કાઠમંડુ , 7 2 મૌર્ય વંશ , 8 2 રામાયણ , 9 2 વંદે માતરમ્ , 10 1 ભારત

abr 2007: 1 3 સરદાર પટેલ , 2 3 સુભાષચંદ્ર બોઝ , 3 3 સ્વામી વિવેકાનંદ , 4 3 અકબર , 5 3 અશોક , 6 3 આર્યભટ્ટ , 7 3 કાલિદાસ , 8 2 ભારત , 9 2 કરમસદ , 10 2 રાજા રવિ વર્મા

mai 2007: 1 2 સરદાર પટેલ , 2 2 મહાભારત , 3 2 સુરત , 4 2 અમદાવાદ , 5 1 યજ્ઞ

jun 2007: 1 2 ભારત , 2 2 સંયુક્ત રાજ્ય અમેરિકા , 3 2 જામનગર , 4 2 ગુજરાત

jul 2007: 1 1 ભરૂચ

ago 2007: 1 1 સંસ્કૃત

set 2007: 1 1 રવિશંકર રાવળ

out 2007: 1 1 લોયાધામ

nov 2007: 1 1 ઝૂલતા મિનારા

dez 2007: 1 4 ગુજરાત , 2 2 વડનગર , 3 1 ચૈતન્ય મહાપ્રભુ

jan 2008: 1 5 ગુજરાત , 2 3 સત્ય ઇસુ દેવળ , 3 2 બાઇબલ , 4 2 ઇસ્કોન , 5 2 દાળ , 6 2 અમેરિકન ગૅંગ્સ્ટર , 7 1 ભારત

fev 2008: 1 2 ભારત , 2 2 સંગણક , 3 2 વડોદરા જિલ્લો , 4 2 રાજકોટ જિલ્લો , 5 2 રણોત્સવ , 6 2 ડેબિયન , 7 2 મરાઠી લોકો , 8 2 બ્રિટીશ એશિયન , 9 2 અમરેલી , 10 2 વઘઇ

mar 2008: 1 3 નરસિંહ મહેતા , 2 2 ઉમરગામ , 3 2 વ્યારા , 4 2 આદિવાસી , 5 2 ઝઘડીયા , 6 2 તિથલ , 7 2 નારેશ્વર , 8 2 હાલોલ તાલુકો , 9 2 ઉનાઇ , 10 2 પંચમહાલ જિલ્લો , 11 2 બીગરી , 12 2 મઢી , 13 2 ભગવદ્ ગીતા , 14 2 લોયા , 15 2 ઇશ્વર પેટલીકર , 16 2 કલાપી , 17 2 દલપતરામ , 18 2 મનસુખલાલ ઝવેરી , 19 2 કે. કા. શાસ્ત્રી , 20 2 નાનાભાઈ ભટ્ટ , 21 2 બકુલ ત્રિપાઠી , 22 2 ભગવતીકુમાર શર્મા , 23 2 તારક મહેતા , 24 2 નિર્મિશ ઠાકર , 25 2 ધીરુબેન પટેલ

abr 2008: 1 3 હિંદુ ધર્મ , 2 2 વીર નર્મદ દક્ષિણ ગુજરાત યુનિવર્સિટી, સુરત , 3 2 રામનવમી , 4 2 હનુમાન ચાલીસા , 5 2 ત્રિકમ સાહેબ , 6 2 રંગ અવધૂત , 7 2 દાસી જીવણ , 8 2 ભિક્ષુ અખંડાનંદ , 9 2 શ્રીમદ્ રાજચંદ્ર , 10 2 પૂ. મોટા , 11 2 પુનિત મહારાજ , 12 2 પૃથિવીવલ્લભ , 13 2 સત્યના પ્રયોગો અથવા આત્મકથા , 14 2 જ્યોતીન્દ્ર હ. દવે , 15 2 સાત પગલાં આકાશમાં , 16 1 ખીજડીયા

mai 2008: 1 5 બગસરા , 2 3 ગણેશ , 3 3 શિવ , 4 3 ઓખાહરણ , 5 3 સી. વી. રામન , 6 3 વીણા , 7 3 વલ્લભાચાર્ય , 8 3 નેલ્સન મંડેલા , 9 3 સિહોર , 10 3 હિંદુ ધર્મ , 11 3 અમદાવાદ , 12 2 આઇઝેક ન્યુટન , 13 2 માઉન્ટ આબુ , 14 2 મિર્ઝા ગ઼ાલિબ , 15 2 રતન તાતા , 16 2 સોનીપત જિલ્લો , 17 2 રોહતક જિલ્લો , 18 2 સિરસા જિલ્લો , 19 2 કરનાલ જિલ્લો , 20 2 ફરીદાબાદ જિલ્લો , 21 2 યમુનાનગર જિલ્લો , 22 2 પાનીપત જિલ્લો , 23 2 અંબાલા જિલ્લો , 24 2 કરસનભાઇ પટેલ , 25 2 પશ્ચિમી સિંહભૂમ જિલ્લો

jun 2008: 1 4 આસારામ બાપુ , 2 3 બાલાસિનોર ગોળ ભાવસાર સમાજ , 3 3 અંજા જિલ્લો , 4 3 લખનૌ , 5 3 ઇટાનગર , 6 3 ઓખાહરણ , 7 3 ઝવેરચંદ મેઘાણી , 8 3 સુરત , 9 2 ગાઝિયાબાદ , 10 2 નેધરલેંડ , 11 2 બ્લૉગ , 12 2 હંસ , 13 2 અત્રિ , 14 2 ભારદ્વાજ , 15 2 અગસ્ત્ય , 16 2 કુર્નૂલ જિલ્લો , 17 2 પશ્ચિમ ગોદાવરી જિલ્લો , 18 2 પૂર્વ ગોદાવરી જિલ્લો , 19 2 નાલગોંડા જિલ્લો , 20 2 નેલ્લોર જિલ્લો , 21 2 પ્રકાસમ જિલ્લો , 22 2 રંગારેડ્ડી જિલ્લો , 23 2 ચિત્તૂર જિલ્લો , 24 1 બસ્તી

jul 2008: 1 3 ઉલૂપી , 2 3 ભીષ્મ , 3 3 શાંતનુ , 4 3 પુરી જિલ્લો , 5 3 નવોદય વિદ્યાલય , 6 3 ગુજરાત , 7 2 ઉત્તરા , 8 2 અંબાલિકા , 9 2 અંબિકા , 10 2 વિચિત્રવિર્ય , 11 2 નાગેશ્વર , 12 2 અર્જુન , 13 2 ચિત્રાંગદા , 14 2 ચિત્રાંગદ , 15 2 ત્ર્યંબકેશ્વર , 16 2 તમિલ ભાષા , 17 2 કારેલું , 18 2 દૂધી , 19 2 સફરજન , 20 2 રીંગણ , 21 2 જાન્યુઆરી ૩૦ , 22 2 સિરોહી , 23 2 સવાઇ માધોપુર , 24 2 સિકર , 25 1 સિમન્ટેક વૅબ ક્રૉલીંગ

ago 2008: 1 4 જુનાગઢ , 2 3 પાલનપુર , 3 2 આસો , 4 2 અષાઢ , 5 2 ડિસેમ્બર , 6 2 નવેમ્બર , 7 2 ઓક્ટોબર , 8 2 સપ્ટેમ્બર , 9 2 ઓગસ્ટ , 10 2 જુલાઇ , 11 2 જૂન , 12 2 મે , 13 2 એપ્રિલ , 14 2 માર્ચ , 15 2 ફેબ્રુઆરી , 16 2 જાન્યુઆરી , 17 2 મૈથિલી ભાષા , 18 2 કસ્તુરબા , 19 2 સંજય , 20 2 ભવભૂતિ , 21 2 ગયા , 22 2 ભોજપુરી ભાષા , 23 1 ભેંસાણ, જૂનાગઢ જિલ્લો

set 2008: 1 3 મિથુન રાશી , 2 3 વૃષભ રાશી , 3 3 મેષ રાશી , 4 3 રાશી , 5 3 શ્રી નાથજીદાદાની જગ્યા - દાણીધાર , 6 3 જામનગર જિલ્લો , 7 2 મહાબળેશ્વર , 8 2 કલિંગનુ યુધ્ધ , 9 2 કૃષ્ણા નદી , 10 2 ભક્ત કવિઓ , 11 2 કાળું કાણું , 12 2 મીન રાશી , 13 2 કુંભ રાશી , 14 2 વૃશ્ચિક રાશી , 15 2 કન્યા રાશી , 16 2 સિંહ રાશી , 17 2 કર્ક રાશી , 18 2 ગજહ મદ , 19 2 વેદવ્યાસ , 20 2 ખેડા , 21 2 વિક્રમ સંવત , 22 2 સાતારા જિલ્લો , 23 2 ડૉ. ભીમરાવ રામજી આંબેડકર , 24 2 ઉપનિષદ , 25 1 પાટણ, મહારાષ્ટ્ર

out 2008: 1 3 ગુજરાત , 2 2 ધન તેરસ , 3 2 પ્રાથમિક સારવાર , 4 2 દીપ , 5 2 પંચાંગ , 6 2 વાઘ બારસ , 7 2 નોબેલ પારિતોષિક વડે સન્માનીત મહિલાઓ , 8 2 ભારતનાં વિશ્વ ધરોહર સ્થળો , 9 2 દશેરા , 10 2 રામચકલી-પીળી ચોટલી , 11 2 દિવાળી , 12 2 ભીષ્મ , 13 2 શનિદેવ , 14 2 ધોરાજી , 15 2 ગુજરાતના મુખ્યમંત્રીઓ , 16 2 પોરબંદર જિલ્લો , 17 2 મહેસાણા , 18 2 અશોક , 19 2 ગિરનાર , 20 2 બનાસકાંઠા જિલ્લો , 21 2 રાજકોટ , 22 1 નોબેલ પારિતોષિક વડે સન્માનીત મહાનુભાવો

nov 2008: 1 3 આદિલ મન્સુરી , 2 3 ભરૂચ , 3 2 પ્રભાશંકર પટ્ટણી , 4 2 કાર્બ્યુરેટર , 5 2 અચલેશ્વર , 6 2 ચિત્રવિચિત્રનો મેળો , 7 2 ઉપગ્રહ પ્રક્ષેપણ યાન , 8 2 ગીતા પ્રેસ , 9 2 પ્રમબનન , 10 2 વિસાવાડા , 11 2 ભગત સિંહ , 12 2 અભિમન્યુ , 13 2 શ્રી નાથજીદાદાની જગ્યા - દાણીધાર , 14 2 અબુલ ફઝલ

dez 2008: 1 3 દેવાયત પંડિત , 2 3 મદીના , 3 3 મક્કા , 4 3 નવા સુદાસણા , 5 3 રાવણ , 6 3 નરસિંહ મહેતા , 7 2 લીરબાઈ , 8 2 હમીરજી ગોહિલ , 9 2 ઝીંઝરી , 10 2 કેરી , 11 2 કમળ , 12 2 વડ , 13 2 માણાવદર , 14 2 અંશુમાન ગાયકવાડ , 15 2 દ્વારકા , 16 2 ભીષ્મ , 17 2 ગાયત્રી , 18 2 શિવ , 19 2 કુતિયાણા , 20 2 અંજીર , 21 2 દાસી જીવણ , 22 2 ભારત , 23 2 હેમચંદ્રાચાર્ય , 24 2 ઇસ્લામ , 25 1 ખરોિલ

jan 2009: 1 4 કનકાઈ-ગીર , 2 3 પ્રબોધિની એકાદશી , 3 3 જુનાગઢ , 4 2 અડાલજની વાવ , 5 2 કાળાપાણ , 6 2 મકર સંક્રાંતિ , 7 2 કામદા એકાદશી , 8 2 પાપમોચિની એકાદશી , 9 2 આમલકી એકાદશી , 10 2 જયા એકાદશી , 11 2 ષટતિલા એકાદશી , 12 2 પુત્રદા એકાદશી , 13 2 સફલા એકાદશી , 14 2 મોક્ષદા એકાદશી , 15 2 ઉત્પતિ એકાદશી , 16 2 બહાદુર શાહ ઝફર , 17 2 એકાદશી વ્રત , 18 2 આગ્રાનો કિલ્લો , 19 2 ગુરુત્વાકર્ષણ , 20 1 કે.લાલ

fev 2009: 1 3 અવાજની ઝડપ , 2 3 તારાપુર , 3 3 વડ , 4 3 નોબેલ પારિતોષિક વડે સન્માનીત મહિલાઓ , 5 3 સ્વામી વિવેકાનંદ , 6 2 અપ્પુઘર , 7 2 વિશ્વની સાત મોટી ભૂલો , 8 2 અંબિકા નદી , 9 2 નવનીત મદ્રાસી , 10 2 વલંદી, વલસાડ તાલુકો , 11 2 વાંકલ (તા.વલસાડ) , 12 2 વેજલપોર, વલસાડ તાલુકો , 13 2 સારંગપુર, વલસાડ તાલુકો , 14 2 કુબેર , 15 2 ભગવદ્ગોમંડલ , 16 2 બાગેફિરદોશ કમ્યુનિટિ હોલ,સી.ટી.એમ. , 17 2 કે.લાલ , 18 2 એરિસ્ટોટલ , 19 2 કૃતવર્મા , 20 2 દિવાળી , 21 1 વાંઝણા

mar 2009: 1 4 ક્ષત્રિય , 2 3 બોપલ , 3 3 જાન્યુઆરી ૧ , 4 3 માર્ચ ૨૪ , 5 3 વિશ્વ જળ દિન , 6 3 સારાવાક ગુફા , 7 3 નાસિક , 8 3 નથુરામ ગોડસે , 9 2 માર્ચ ૨૩ , 10 2 સિદ્ધગિરિ ગ્રામજીવન સંગ્રહાલય , 11 2 માર્ચ ૨૧ , 12 2 ઓગસ્ટ ૧૫ , 13 2 વિશ્વ ક્ષય દિન , 14 2 આંતરરાષ્ટ્રીય મહિલા દિન , 15 2 માર્ચ ૧૨ , 16 2 માર્ચ ૮ , 17 2 માર્ચ ૨૦ , 18 2 માર્ચ ૨૨ , 19 2 ઔદિચ્ય બ્રાહ્મણ , 20 2 પ્રહલાદ , 21 2 શનિવાર , 22 2 શુક્રવાર , 23 1 સાદડવેરા

abr 2009: 1 4 રાજકોટ , 2 3 ગીઝાનો મહાન પિરામિડ , 3 3 પિરામિડ , 4 2 વૈશાખ સુદ ૬ , 5 2 એપ્રિલ ૨૭ , 6 2 ચૈત્ર વદ ૦)) , 7 2 પ્રમુખ સ્વામી , 8 2 એપ્રિલ ૨૨ , 9 2 એપ્રિલ ૨૦ , 10 2 એપ્રિલ ૨૧ , 11 2 કુતુબ મિનાર , 12 2 એપ્રિલ ૧૪ , 13 2 ખારાઘોડા , 14 2 પીઝાનો ઢળતો મિનારો , 15 2 સરદાર પટેલ યુનિવર્સિટી , 16 2 એપ્રિલ ૧૦ , 17 2 એપ્રિલ ૯ , 18 2 એપ્રિલ ૮ , 19 2 આજી નદી , 20 2 ચૈત્ર સુદ ૧૧ , 21 2 ચૈત્ર સુદ ૯ , 22 2 એપ્રિલ ૨ , 23 2 એપ્રિલ ફૂલ્સ ડે , 24 2 ભીચરી , 25 2 મંગળના ચંદ્રો

mai 2009: 1 4 ગુજરાત , 2 3 બોલપેન , 3 2 ઉપાસની મહારાજ , 4 2 ૧૦ (અંક) , 5 2 ૧૦૨ (અંક) , 6 2 આંબેડકર નેશનલ કોંગ્રેસ , 7 2 કાચબો , 8 2 સંચળ , 9 2 મે ૧૧ , 10 2 મે ૯ , 11 2 ગુજરાતના અભયારણ્યો તથા રાષ્ટ્રીય ઉદ્યાનો , 12 2 મે ૬ , 13 2 આંતરરાષ્ટ્રીય પરીચારિકા દિવસ , 14 2 આંતરરાષ્ટ્રીય દાયણ દિવસ , 15 2 મે ૫ , 16 2 મે ૪ , 17 2 મે ૨ , 18 2 મે ૧ , 19 2 શક્તિ દર્શનમ્ , 20 2 વિરસા મુંડા , 21 2 કઠોર (કામરેજ) , 22 2 રાજપૂત , 23 2 કોલોસીયમ , 24 2 ભગવદ્ગોમંડલ , 25 2 હઠ યોગ

jun 2009: 1 3 ઇજનેરી , 2 3 ટેક્લોબેન , 3 3 બાહુબલી , 4 3 માઉન્ટ એવરેસ્ટ , 5 3 કંથારીયા (તા.ભરૂચ) , 6 3 કેરી , 7 3 શ્રી નાથજીદાદાની જગ્યા - દાણીધાર , 8 3 વેરાવળ , 9 3 ખોડિયાર , 10 3 નવકાર મંત્ર , 11 2 અષાઢ સુદ ૬ , 12 2 વાર , 13 2 માઇકલ જેકસન , 14 2 વૈશ્વિક સ્થળનિર્ધારણ પ્રણાલી , 15 2 અષાઢ સુદ ૨ , 16 2 બેસતુ વર્ષ , 17 2 પાંડુરંગ શાસ્ત્રી આઠવલે , 18 2 જૂન ૧૩ , 19 2 શુકલતીર્થ , 20 2 બિલ ગેટ્સ , 21 2 છાણીયું ખાતર , 22 2 જેઠ વદ ૪ , 23 2 જેઠ સુદ ૧૫ , 24 2 નગોદ (કામરેજ) , 25 2 નેત્રંગ

jul 2009: 1 5 ગાંઠિયા , 2 4 બાહુબલી , 3 4 શ્રી નિષ્કલંક મહાદેવ કોળિયાક , 4 3 ઉરુગ્વે , 5 3 અષાઢ સુદ ૧૧ , 6 3 હાલોલ તાલુકો , 7 3 ગુજરાતી સાહિત્યકારો , 8 2 અમરસિંહ ચૌધરી , 9 2 શ્રાવણ સુદ ૭ , 10 2 શ્રાવણ સુદ ૬ , 11 2 શ્રાવણ સુદ ૫ , 12 2 સુરીનામ , 13 2 ભીખુદાન ગઢવી , 14 2 સાબરમતી આશ્રમ , 15 2 જુલાઇ ૨૧ , 16 2 મહાત્મા ગાંધી સેતુ (બિહાર) , 17 2 ગુજરાતી ભોજન , 18 2 અષાઢ વદ ૯ , 19 2 બાજરો , 20 2 અષાઢ સુદ ૧૫ , 21 2 અષાઢ સુદ ૧૩ , 22 2 બાર્ટન પુસ્તકાલય , 23 2 બાંદ્રા-વરલી સમુદ્રસેતુ , 24 2 એપ્રિલ ફૂલ્સ ડે , 25 2 ખરોલિ

ago 2009: 1 7 રોઝવા (તા. છોટાઉદેપુર) , 2 6 રોઝકુવા (તા. છોટાઉદેપુર) , 3 6 વલ્લભભાઈ પટેલ , 4 6 તુલસીદાસ , 5 5 રાણીખેડા , 6 5 ઓળી આંબા (તા. છોટાઉદેપુર) , 7 5 નાના રામપુરા (તા. છોટાઉદેપુર) , 8 5 સીમળ ફળીયા (તા. છોટાઉદેપુર) , 9 5 રૂનવાડ (તા. છોટાઉદેપુર) , 10 5 બ્લેકપૂલનો ટાવર , 11 5 કચ્છ જિલ્લો , 12 4 સીંગળાજા , 13 4 રીંછવેલ (તા. છોટાઉદેપુર) , 14 4 રાયસીંગપુરા (હરવાંટ) , 15 4 પુનીયાવાંટ , 16 4 પોટીયા (તા. છોટાઉદેપુર) , 17 4 પીપલેજ (તા. છોટાઉદેપુર) , 18 4 ઓઢી (તા. છોટાઉદેપુર) , 19 4 ઓડી (તા. છોટાઉદેપુર) , 20 4 નવાગામ (તા. છોટાઉદેપુર) , 21 4 નાની સાધલી , 22 4 સનાડા (તા. છોટાઉદેપુર) , 23 4 સીલોદ (તા. છોટાઉદેપુર) , 24 4 પંડિત રામ નારાયણ , 25 4 વિશ્વ કાચબા દિવસ

set 2009: 1 3 એલિફન્ટાની ગુફાઓ , 2 3 તૌરાત , 3 3 સિંગાપુર , 4 3 નબીપુર , 5 3 વામકુક્ષિ , 6 3 ઈમાન , 7 3 માઉન્ટ એવરેસ્ટ , 8 3 નમાજ઼ , 9 3 અરવિંદ આશ્રમ , 10 3 ઇસ્લામ , 11 2 હઠીસિંહનાં દેરા , 12 2 વિદ્યા બાલન , 13 2 આસો સુદ ૮ , 14 2 અર્ધનારીશ્વર , 15 2 આકાશગંગા , 16 2 કચ્છનો અખાત , 17 2 વચનામૃત , 18 2 દુર્વાસા ઋષિ , 19 2 મનોવિજ્ઞાન , 20 2 એસોટેરિક , 21 2 પ્રારંભિક જાહેર ભરણું (આઈપીઓ) , 22 2 બાળગીતો , 23 2 કવ્વાલી , 24 2 અઝેરબીજાન , 25 2 આર્મેનિયા

out 2009: 1 4 રોટલી , 2 3 ધારી , 3 3 ગીગાસણ , 4 3 મનુષ્ય ગૌરવદિન , 5 3 સ્વામિનારાયણ સંપ્રદાય , 6 3 ભારતનાં વિશ્વ ધરોહર સ્થળો , 7 3 ભારત , 8 2 લોદરા , 9 2 મહાબલીપુરમ , 10 2 હમ્પી , 11 2 કારતક સુદ ૧૦ , 12 2 છત્રપતિ શિવાજી ટર્મિનસ , 13 2 લોહલંગરી આશ્રમ (ગોંડલ) , 14 2 છપિયા , 15 2 ફૉકલેન્ડ ટાપુઓ , 16 2 બોલીવિયા , 17 2 સ્વિત્ઝરલૅન્ડ , 18 2 નિત્યાનંદ સ્વામી , 19 2 ઓક્ટોબર ૧૨ , 20 2 ઓક્ટોબર ૧૧ , 21 2 મોલ્દોવા , 22 2 વાસદ (તા. આણંદ) , 23 2 શરદ પૂર્ણિમા , 24 2 આસો સુદ ૧૫ , 25 2 લક્ઝેમ્બર્ગ

nov 2009: 1 3 મહાબોધિ મંદિર , 2 3 વાયુ , 3 3 મીરાંબાઈ , 4 2 ગળધરા , 5 2 ચંદ્ર યાન , 6 2 કારતક વદ ૦)) , 7 2 જિહાદ , 8 2 કારતક વદ ૭ , 9 2 દશરથ , 10 2 ઇલોરાની ગુફાઓ , 11 2 ભારતની પર્વતીય રેલ્વે , 12 2 પત્તાદકલ , 13 2 ભીમ બેટકાની ગુફાઓ , 14 2 મહાબલીપુરમ , 15 2 ખજુરાહો , 16 2 નદીસર (તા. ગોધરા) , 17 2 જૈન ધર્મ , 18 2 વેડચ (તા.જંબુસર) , 19 2 દીવા (તા.અંકલેશ્વર) , 20 2 મોહણી(તા.ચોર્યાસી) , 21 2 મૈથિલીશરણ ગુપ્ત , 22 2 ધામણ , 23 2 ચામુંડા , 24 2 ભારતનાં વિશ્વ ધરોહર સ્થળો , 25 2 મહેમદાવાદ

dez 2009: 1 3 ઉસ્તીયા (તા. અબડાસા) , 2 3 ગીગાસણ , 3 3 નારગોલ , 4 3 અબ્દુલ કલામ , 5 3 જંબુસર , 6 2 પક્ષી , 7 2 ક્રિકેટનું મેદાન , 8 2 ડિસેમ્બર ૨૫ , 9 2 મનોવિષ્લેષણ , 10 2 ડિસેમ્બર ૧૯ , 11 2 કૃષિ , 12 2 તોરણીયા , 13 2 જળ , 14 2 ઓપન શોર્ટેસ્ટ પાથ ફર્સ્ટ , 15 2 અનિદ્રા , 16 2 ડિસેમ્બર ૧૭ , 17 2 સ્લમડોગ મિલિયોનેર , 18 2 ફિઝિયોથેરાપી , 19 2 પીપળો , 20 2 રૂપિયાપુરા , 21 2 નંદાદેવી રાષ્ટ્રીય ઉદ્યાન , 22 2 માનસ રાષ્ટ્રીય ઉદ્યાન , 23 2 કેવલાદેવ રાષ્ટ્રીય ઉદ્યાન , 24 2 કાઝીરંગા રાષ્ટ્રીય ઉદ્યાન , 25 2 અજંતાની ગુફાઓ

jan 2010: 1 3 આમેરનો કિલ્લો , 2 3 ઇએમઇ મંદિર , 3 3 લહેરીપુરા દરવાજા , 4 3 સયાજી બાગ (કમાટી બાગ) , 5 3 હવા મહેલ , 6 3 વાંસદા રાષ્ટ્રીય ઉદ્યાન , 7 3 દરિયાઈ રાષ્ટ્રીય ઉદ્યાન અને અભયારણ્ય , 8 3 ક્રિસમસ દ્વીપ , 9 3 સુએઝ નહેર , 10 3 જય વસાવડા , 11 2 કુંભ મેળો , 12 2 મહારાજા ફતેહસિંહ મ્યુજીયમ , 13 2 અશોક કુરજીભાઇ પટેલ , 14 2 ચેતેશ્વર પુજારા , 15 2 જલ મહેલ , 16 2 વિશ્વામિત્રી નદી , 17 2 નજર બાગ મહેલ , 18 2 કિર્તિ મંદિર, વડોદરા , 19 2 સરદાર પટેલ પ્લેનેટેરીયમ , 20 2 ઈંડિયા ગેટ , 21 2 રણછોડરાય , 22 2 પ્રાણી , 23 2 રોક ગાર્ડન , 24 2 સુવર્ણ મંદિર, અમૃતસર , 25 2 જાન્યુઆરી ૧૫

fev 2010: 1 4 તુલસી , 2 4 ગુજરાત , 3 3 ગળતેશ્વર , 4 3 સંપ્રદાય , 5 3 પાનકી , 6 3 રણછોડરાય , 7 3 ભારત , 8 3 ડાકોર , 9 3 મહાભારત , 10 2 આતંકવાદ , 11 2 અસોસિએશન ફુટબોલ , 12 2 પ્રાગજી ભગત , 13 2 સેવપુરી , 14 2 સયાજી સરોવર , 15 2 કોથમીર-મરચાંની ચટણી , 16 2 ઈદડાં , 17 2 જે. બી. વોટસન , 18 2 પંડોળી , 19 2 મકબરા (હજીરા) , 20 2 ઝકાત , 21 2 ખંડેરાવ માર્કેટ , 22 2 માંડવી દરવાજા , 23 2 લાલબાગ , 24 2 શેર (તા. માંડલ) , 25 2 વડાપાવ

mar 2010: 1 3 બટાકાં , 2 3 મોગલબારા , 3 3 શેર (તા. માંડલ) , 4 2 એના નિકોલ સ્મિથ , 5 2 મહાકાળેશ્વર જ્યોતિર્લિંગ , 6 2 અરનાથજી દેવ , 7 2 ચૈત્ર સુદ ૫ , 8 2 થુમ્બા , 9 2 ફાગણ વદ ૧૪ , 10 2 ટૅડગાફળિયુ(ઉમરપાડા) , 11 2 બ્રાહ્મણી નદી , 12 2 બળદ ગાડું , 13 2 જીરું , 14 2 કણભા (તા.કરજણ) , 15 2 શક્કરીયાં , 16 2 ડાંગર , 17 2 કામલી , 18 2 ખારા રૂપાલ , 19 2 ધાંધુસણ , 20 2 દેદીયાસણ , 21 2 આખજ , 22 2 દીવાનપુરા-અલીયાસ-અપાપુરા , 23 2 મેમદપુરા , 24 2 વીરસોડા , 25 2 હાડવી

abr 2010: 1 3 લીંભોઈ , 2 3 ખારવા , 3 3 વલ્લભ વિદ્યાનગર , 4 3 સ્વામિનારાયણ સંપ્રદાય , 5 3 ઉચ્છલ , 6 3 સુરત , 7 2 બેગુની , 8 2 વિક્રમાદિત્ય , 9 2 ખીચડી , 10 2 કફોત્પાદક ગ્રંથિ , 11 2 રવાનો શીરો , 12 2 દૂધપાક , 13 2 સંદેશ , 14 2 દિવ્ય ભાસ્કર , 15 2 બરડીયા (તા. વિસાવદર) , 16 2 ભાગળ , 17 2 સુરતી બોલી , 18 2 ગામીત બોલી , 19 2 બોલી , 20 2 ભક્તિવેદાંત બુક ટ્રસ્ટ , 21 2 એ.સી. ભક્તિવેદાંત સ્વામી પ્રભુપાદ , 22 2 માર્કની લખેલી સુવાર્તા , 23 2 કડવા પાટીદારોની પેટા જ્ઞાતિ , 24 2 હરિલાલ ઉપાધ્યાય , 25 2 નરસિંહ

mai 2010: 1 3 સમરસ ગ્રામ પંચાયત , 2 3 ચેવડો , 3 3 ગૂગલ અનુવાદ , 4 3 કચ્છ જિલ્લો , 5 3 સુરત , 6 2 પરોઠા , 7 2 મિસળ , 8 2 એચએએલ તેજસ , 9 2 રોહિણી , 10 2 કૃષ્ણદાસ કવિરાજ , 11 2 ચૈતન્ય ચરિતામૃત , 12 2 જયપતાકા સ્વામી , 13 2 સંન્યાસ , 14 2 ભક્તિબલ્લભ તીર્થ ગોસ્વામી મહારાજ , 15 2 શુભા મુદ્ગલ , 16 2 તમાકુની ખળી , 17 2 થાળી , 18 2 જપમાળા , 19 2 બ્લેક સબાથ , 20 2 લોકનાથ સ્વામી મહારાજ , 21 2 ગોપાલ કૃષ્ણ ગોસ્વામી , 22 2 રાધાનાથ સ્વામી , 23 2 ડો. જીવરાજ નારાયણ મહેતા , 24 2 ગોપીપુરા , 25 2 લિંભોઇ

jun 2010: 1 3 મગની દાળનો શીરો , 2 3 ટાવર ઓફ લંડન , 3 3 કુલેર , 4 3 પેંડા , 5 3 દુધીનો હલવો , 6 3 વાવ , 7 3 ઇએમઇ મંદિર , 8 3 રતનપુર (કાંટડી) , 9 3 ગુજરાતી ભોજન , 10 2 અગ્રસેન , 11 2 પાલિ ભાષા , 12 2 ફૂલવડી , 13 2 પૌંઆ , 14 2 સમોસા , 15 2 શરીર વૃદ્ધી અંતઃસ્ત્રાવ , 16 2 કચોરી , 17 2 પંડિત દીનદયાળ પેટ્રોલિયમ યુનિવર્સિટી , 18 2 ગોળ , 19 2 ગુર્જીય્ફ , 20 2 ભગવદ્ દર્શન , 21 2 લેધરબેક કાચબો , 22 2 મેઘ , 23 2 સૈફ અલી ખાન , 24 2 સેવ , 25 2 બરફી

jul 2010: 1 3 રંગાવલી નદી , 2 3 દેવ-ચાંદની નદી , 3 3 આંકડો (વનસ્પતિ) , 4 3 ઝુલાસણ (તા. કડી) , 5 3 હરેલા ઉત્સવ , 6 3 અશોક ચક્ર , 7 3 આદમ અને હવા , 8 3 અમૃતા શેરગિલ , 9 3 રૂપાયતન આશ્રમશાળા , 10 3 યતી (હિમ માનવ) , 11 3 અગસ્ત્ય , 12 3 ગુજરાતી સાહિત્યકારો , 13 2 રુથ , 14 2 મીંઢોળા નદી , 15 2 ઇબ્રાહિમ , 16 2 કનોડા (તા. બહુચરાજી) , 17 2 ઇંગ્લેન્ડના એલિઝાબેથ પ્રથમ , 18 2 રવિ શંકર , 19 2 ધૌમ્ય , 20 2 શૃંગ , 21 2 ફ્રેન્ક લેમ્પાર્ડ , 22 2 રાપ્તી પ્રાંત (નેપાળ) , 23 2 ધવલાગિરી પ્રાંત (નેપાળ) , 24 2 લુમ્બિની પ્રાંત (નેપાળ) , 25 2 ગંડકી પ્રાંત (નેપાળ)

ago 2010: 1 4 શીખ , 2 4 દાલ બાટી , 3 4 મનમોહન સિંહ , 4 3 દૂરદર્શન , 5 3 ક્રોપ સર્કલ , 6 3 માછલીઘર , 7 3 શિક્ષક , 8 3 ઊંડ નદી , 9 3 દઢવાવ (તા. વિજયનગર) , 10 3 ભડીયાદ (તા. ધંધુકા) , 11 3 પૂ. મોટા , 12 3 કૃષ્ણ , 13 2 પિયાસણ (બતક) , 14 2 આન્દ્રે અગાસી , 15 2 મેનહટન , 16 2 ઑક્સફર્ડ વિશ્વવિદ્યાલય , 17 2 મહુડો , 18 2 જામીનગીરીઓ , 19 2 ભારતીય વાનગીઓ , 20 2 હ્યુસ્ટન , 21 2 ઇન્ડિયાના , 22 2 એમિથિસ્ટ , 23 2 ન્યાયશાસ્ત્ર , 24 2 ફોર્બ્સ , 25 2 બ્રુસ સ્પ્રિન્ગસ્ટીન

set 2010: 1 6 જાપાન , 2 4 ટિમ્બક્ટુ , 3 4 એ. આર. રહેમાન , 4 3 સોનલવા , 5 3 સ્ટેનફોર્ડ યુનિવર્સિટી , 6 3 વાળ ખરવા , 7 3 જયોર્જ સોરોસ , 8 3 નર્ક , 9 3 ચેસ્ટર કાર્લસન , 10 3 સોલોમન , 11 3 પાણી , 12 3 સરઢવ (તા. ગાંધીનગર) , 13 3 યુ.કે. પોસ્ટકોડ્સ , 14 3 ઓક્લાહોમા , 15 3 ૧૯૬૨નું ભારત-ચીન યુદ્ધ , 16 3 ચેરાપુંજી , 17 3 પાટણ , 18 3 ગુજરાતી , 19 2 કાંડુ (શરીર) , 20 2 એબીએન એમ્રો , 21 2 રાહુલ બજાજ , 22 2 સ્થાનકવાસી , 23 2 અન્ના કુર્નિકોવા , 24 2 વિરમપુર (તા. અમીરગઢ) , 25 2 ધ પ્રોડિજિ

out 2010: 1 3 એર ઈન્ડિયા ફ્લાઇટ ૧૮૨ , 2 3 કોર્ન , 3 3 ગ્રીક મૂળાક્ષરો , 4 3 ધનતેરશ , 5 3 પીરોજી માખીમાર , 6 3 દિવાળી , 7 3 માળીયા હાટીના , 8 3 મહાત્મા ગાંધી , 9 2 લાઓત્સે , 10 2 સિમા ગુઆંગ , 11 2 શાલીગ્રામ , 12 2 સીમા સુરક્ષા દળ , 13 2 પહાડિયા જનજાતિ , 14 2 શૈલી , 15 2 પીડોફિલિયા (બાળ યૌનશોષણ) , 16 2 હુઆંગ ઝીયાન-ફાન , 17 2 હરિવંશ , 18 2 સિમા કીઆન , 19 2 ડોનાલ્ડ ડક , 20 2 મિનેપોલિસ , 21 2 એલિસ ઇન ચેઇન્સ , 22 2 કેન્સાસ , 23 2 એલન શીયરર , 24 2 બજરંગ દળ , 25 2 સંચય

nov 2010: 1 3 પર્યાયોક્તિ , 2 3 કેસ્પિયન સમુદ્ર , 3 3 ઘડિયાલ , 4 3 આહિર , 5 2 કાતરા (ઈયળ) , 6 2 પોર્ટલેન્ડ, ઑરેગોન , 7 2 ચિત્રકૂટ ધામ , 8 2 પરસ્પરોપગ્રહો જીવાનામ્ , 9 2 સંસ્કૃતિ , 10 2 થોર , 11 2 ચિત્તભ્રમણા , 12 2 બ્લૂઝ , 13 2 સત્રીયા નૃત્ય , 14 2 પેટન્ટ , 15 2 સિટીગ્રુપ , 16 2 કપડાં , 17 2 નિવસન તંત્ર , 18 2 મદ્યાર્ક યુક્ત પીણું , 19 2 એશિયાઈ રમતોત્સવ , 20 2 એશિયન રમતોત્સવ ૨૦૧૦ , 21 2 કાળા મરી , 22 2 સિસ્કો , 23 2 કુપોષણ , 24 2 અનુકૂલન , 25 2 કાળો સમુદ્ર

dez 2010: 1 3 પેન્શન , 2 3 મડાણા ડાંગીયા (તા. પાલનપુર) , 3 3 વિલવણીકરણ , 4 3 સુવર્ણ માનક , 5 3 ફેડએક્સ , 6 3 વિંધ્યાચલ , 7 3 સૂર્યમંદિર, મોઢેરા , 8 3 વચનામૃત , 9 3 કૃષ્ણ વિવર , 10 3 પાલનપુર , 11 3 ચીન , 12 2 ઊન , 13 2 વિષ્ણુ સહસ્રનામ , 14 2 વાયરલેસ સુરક્ષા , 15 2 જળ શુદ્ધિકરણ , 16 2 સ્વચ્છતા , 17 2 હથિયારો , 18 2 વિટામિન બી૬ , 19 2 મેરેથોન , 20 2 ટ્યૂલિપ , 21 2 ઓર્લાન્ડો, ફ્લોરિડા , 22 2 કૅટરિના કૈફ , 23 2 કનિષ્ક , 24 2 યુનિલિવર , 25 2 કોલંબિયા, દક્ષિણ કેરોલિના

jan 2011: 1 5 પ્રાથમિક શાળા , 2 4 ડી. ડી. કૌશામ્બી , 3 3 એસ. એમ. કૃષ્ણ , 4 3 મકડાલા (તા. દિયોદર) , 5 3 જુલિયન અસાંજે , 6 3 ગોળવી (તા. દિયોદર) , 7 3 ખારાખોડા (તા. થરાદ) , 8 3 ઉમરેઠ , 9 3 દસ્ક્રોઇ , 10 3 હિંદુ ધર્મ , 11 3 સ્વામિનારાયણ , 12 3 ભારત , 13 3 સુરત , 14 2 અર્થીંગ , 15 2 વિદ્યુતજનીન , 16 2 ચુંબકીયક્ષેત્ર , 17 2 મડકરી નાયક , 18 2 કિરણ મઝુમદાર-શો , 19 2 ગિનિ પિગ , 20 2 યુનાઇટેડ સ્ટેટ્સ આર્મી , 21 2 સંજીવ કુમાર , 22 2 તમિલનાડુનો ઈતિહાસ , 23 2 સર્વમિત્ર સિકરી , 24 2 એમપીથ્રી , 25 2 ચીરોડા (રાજપરા)

fev 2011: 1 4 સાલ્ઝબર્ગ , 2 4 મેઘપુર , 3 4 નરેન્દ્ર મોદી , 4 3 પ્રણવ મુખર્જી , 5 3 મૃણાલ સેન , 6 3 સામાજિક સાહસિકતા , 7 3 મોહમ્મદ રફી , 8 3 યુનિક આઇડેન્ટિફિકેશન નંબર , 9 3 ૩જી , 10 3 સ્વયં-સહાયક જૂથ (નાણાં વ્યવસ્થા) , 11 3 નિરદ સી. ચૌધુરી , 12 3 બિરજુ મહારાજ , 13 3 અપર્ણા સેન , 14 3 ૨-જી સ્પેક્ટ્રમ કૌભાંડ , 15 3 મેજર ડિપ્રેસિવ ડિસઓર્ડર , 16 3 દ્વિસંગી તારો , 17 3 ઈન્ટરનેટ એક્ટીવિઝમ (ચળવળ) , 18 3 મુનસર તલાવ, વિરમગામ , 19 3 નોર્ધન આયર્લેન્ડ , 20 3 રજકો , 21 3 માઇક્રોસોફ્ટ ઓફિસ ૨૦૦૭ , 22 3 ઈન્સીડ , 23 3 મકડાલા (તા. દિયોદર) , 24 3 કોદરામ (તા. વડગામ) , 25 3 રક્ત

mar 2011: 1 4 ઍલન ટ્યુરિંગ , 2 3 યશવંત સિન્હા , 3 3 જાણદી (તા. થરાદ) , 4 3 ધારોલી (તા.ઝઘડીયા) , 5 3 કકવાડીદાંતી , 6 3 બાલાસિનોર , 7 3 પદમડુંગરી , 8 3 રાજકોટ , 9 2 એસ્સાર ગ્રુપ , 10 2 લૅરી પેજ , 11 2 ભારતીય ઇસ્પાત પ્રાધિકરણ લિમિટેડ , 12 2 બ્રાયન લારા , 13 2 ગૅરી કિર્સ્ટન , 14 2 જામા મસ્જિદ, દિલ્હી , 15 2 ભારતનું સર્વોચ્ચ ન્યાયાલય , 16 2 એન્ડ્રુ કાર્નેગી , 17 2 રૅનબૅક્સી લેબોરેટરીઝ લિમિટેડ , 18 2 આર. કે. નારાયણ , 19 2 હિન્દુસ્તાન પેટ્રોલિયમ , 20 2 ટેક મહિન્દ્રા , 21 2 લાલા લાજપતરાય , 22 2 ટાટા ટી , 23 2 વિરપુર (તા. જેતપુર) , 24 2 ભારતીય સંસદ , 25 2 બૌદ્ધ ગુફાઓ, ખંભાલીડા

abr 2011: 1 3 હિલેરી ક્લિન્ટન , 2 3 કાનજી સ્વામી , 3 3 તારંગા હિલ , 4 3 બાષ્પોત્સર્જન , 5 3 સાકરિયા (તા. મોડાસા) , 6 3 સાંકલી (તા. ગોધરા) , 7 3 રફાળા,તા.રાજકોટ , 8 3 ઇસરો , 9 3 ઈન્દ્રા નૂયી , 10 3 સુરેન્દ્રનગર જિલ્લો , 11 3 વડોદરા , 12 2 સેર્ગેઈ બ્રિન , 13 2 અળવી (વનસ્પતિ) , 14 2 રાઈતું , 15 2 પાલમપુર , 16 2 ઓનલાઈન વિજ્ઞાપન , 17 2 સેમસંગ , 18 2 એસ.ડી. બર્મન , 19 2 ખાંડવપ્રસ્થ , 20 2 બાલોતા (તા.હાંસોટ) , 21 2 અણ્ણા હઝારે , 22 2 મસૂરી , 23 2 તરબૂચ , 24 2 પ્રભાતદેવજી , 25 2 ખાખી જાળીયા (તા. ઉપલેટા)

mai 2011: 1 3 હર્ષદ , 2 3 ગાંધવી (તા. કલ્યાણપુર) , 3 3 ગોરાણા (તા. કલ્યાણપુર) , 4 3 આશિયાવદર (તા. કલ્યાણપુર) , 5 3 હોલો , 6 3 કતાર (અરબસ્તાન) , 7 3 શ્વેતા નંદા , 8 3 દાસી જીવણ , 9 3 નરસિંહ મહેતા , 10 2 જેપુર (તા. કલ્યાણપુર) , 11 2 પટેલકા (તા. કલ્યાણપુર) , 12 2 લાંબા (તા. કલ્યાણપુર) , 13 2 રાણ (તા. કલ્યાણપુર) , 14 2 રાણપરડા (તા. કલ્યાણપુર) , 15 2 નગડિયા (તા. કલ્યાણપુર) , 16 2 હનુમાનધાર , 17 2 બારિયાધાર (તા. કલ્યાણપુર) , 18 2 જામ રાવલ (તા. કલ્યાણપુર) , 19 2 સુર્યાવદર (તા. કલ્યાણપુર) , 20 2 ટંકારિયા (તા. કલ્યાણપુર) , 21 2 ભાટિયા (તા. કલ્યાણપુર) , 22 2 ડાંગરવડ (તા. કલ્યાણપુર) , 23 2 નાણાકીય વર્ષ , 24 2 ચાઇનીઝ ભાષા , 25 2 સ્વાઝીલેન્ડ

jun 2011: 1 3 પડાણા (તા. લાલપુર) , 2 3 ફિંગર ઇલેવન , 3 3 પ્રભાશંકર માસ્તર , 4 3 સ્પેન , 5 3 ઝવેરચંદ મેઘાણી , 6 2 નરગીસ , 7 2 ઇન્ટેલ કોર્પોરેશન , 8 2 નાઈટ્સ ટેમ્પ્લર , 9 2 હાથીના પગ તળે દેહાંતદંડ , 10 2 વિકેટ કીપર , 11 2 મહાશ્વેતા દેવી , 12 2 હલવો , 13 2 ભારતમાં પરીવહન , 14 2 રફેલ નડાલ , 15 2 એલર્જી , 16 2 દિગીશ મહેતા , 17 2 હીમોફીલિયા , 18 2 હૃદયસ્તંભતા , 19 2 હૃદયરોગનો હુમલો , 20 2 બાંયધરી (વોરંટી) , 21 2 પ્રિફર્ડ સ્ટોક , 22 2 હર્ષદ (તા. કલ્યાણપુર) , 23 2 ચાર્લ્સ લુસિઅન બોનાપાર્ટ , 24 2 ભારતીય ઓલિમ્પિક સંઘ , 25 2 ઝડપી ગોલંદાજી

jul 2011: 1 2 પલસદરી (જિ. રાયગઢ) , 2 2 પદ્મનાભસ્વામી મંદિર , 3 2 બલરાજ સહાની , 4 2 દેરડી (તા. ગોંડલ) , 5 2 લાભશંકર ઠાકર , 6 2 અડપોદરા , 7 2 સાયરા (તા. મોડાસા) , 8 2 કંબોયા (તા. ઇડર) , 9 2 થુવાવી , 10 2 બ્રાઝિલ , 11 2 ઉદય મર્ચંટ , 12 2 હળવદ , 13 2 કાલાવડ , 14 2 ભીસ્યા , 15 2 વડનગર , 16 2 નર્મદ , 17 2 ભાવનગર , 18 1 રામફળ

ago 2011: 1 4 જગદ્ગુરુ રામભદ્રાચાર્ય , 2 2 શરબત , 3 2 માથક (તા. હળવદ) , 4 2 ચુરાચાંદપુર , 5 2 આર્ય સમાજ , 6 2 અજાણી ઊડતી વસ્તુ , 7 2 ધર્મજ , 8 2 પ્રિયંકા ચોપરા , 9 2 ઇડર , 10 2 મુખપૃષ્ઠ , 11 1 મહેસૂલી તલાટી

set 2011: 1 3 હંગ્રી પેઢીના , 2 3 સુરજપુરા (તા. હિંમતનગર) , 3 2 સોરઠા (તા. કાલાવડ) , 4 2 નાની ભગેડી (તા. કાલાવડ) , 5 2 પેટન્ટ , 6 2 માતપુર (તા. પાટણ) , 7 2 કનોડા (તા. બહુચરાજી) , 8 2 ઉપાધ્યાય , 9 2 પાલેજ , 10 2 લોકગીત , 11 2 રાયપુર (છત્તીસગઢ) , 12 2 યુરેનસ (ગ્રહ) , 13 2 સુરત , 14 1 મોભીયાણા નવા (તા. રાજુલા)

out 2011: 1 3 ભુટકિયા , 2 3 લોથલ , 3 3 દત્તવાડા , 4 3 તાપી જિલ્લો , 5 2 આરઝી હકૂમત , 6 2 ઉર્વીશ કોઠારી , 7 2 ઈટ્રીયમ , 8 2 બ્રોમિન , 9 2 સેલિનીયમ , 10 2 વર્ણાતુ , 11 2 વેનેડિયમ , 12 2 ટાઇટેનિયમ , 13 2 એશિયાઇ ચિત્તો , 14 2 ગંધક , 15 2 મેગ્નેશિયમ , 16 2 નિકલ , 17 2 વૈશ્વિક આરોગ્ય , 18 2 ભાણ સાહેબ , 19 2 ખામતા (તા. પડધરી) , 20 2 નોલી (તા. સાયલા) , 21 2 પટોસણ (તા. પાલનપુર) , 22 2 કનોડા (તા. બહુચરાજી) , 23 2 રતુભાઇ અદાણી , 24 2 વ્યવસાય , 25 2 કામલી

nov 2011: 1 4 બ્લેક સબાથ , 2 3 સુબ્રમણ્યન ચંદ્રશેખર , 3 3 ફીજી હિન્દી , 4 3 પાનસડ (તા. બાબરા) , 5 3 ભુટકિયા , 6 3 ગુજરાતી સાહિત્ય પરિષદ , 7 3 ઘંટીયાળી (તા. થરાદ) , 8 3 જેનપુર (તા. પ્રાંતિજ) , 9 3 દત્તવાડા , 10 3 રાપર , 11 3 ધોળાવીરા , 12 3 ખગોળશાસ્ત્ર , 13 3 મુંબઈ , 14 2 ચારણ , 15 2 નારાયણ સરોવર અભયારણ્ય , 16 2 રીડગુજરાતી.કોમ , 17 2 ભીમડાદ (તા.ગઢડા) , 18 2 પેજ રેન્ક , 19 2 અર્બિયમ , 20 2 યોગસૂત્ર , 21 2 ગોરખનાથ , 22 2 નેશનલ સ્ટોક એક્સચેન્જ , 23 2 ખારી જળાશય (ભુટકિયા) , 24 2 ટેલુરિયમ , 25 2 ટીન

dez 2011: 1 4 માતપુર (તા. પાટણ) , 2 3 મહારાજા સયાજીરાવ ગાયકવાડ ત્રીજા , 3 3 ધોળીધજા ડેમ , 4 3 રેશમ , 5 3 સલામત મૈથુન , 6 3 કાર્તિકેય , 7 3 મૌલાના આઝાદ , 8 3 નેસડી (તા. સાવરકુંડલા) , 9 3 સુરખાબ , 10 3 ખોખલા (તા. ચાણસ્મા) , 11 3 વાંચ (તા. દસ્ક્રોઇ) , 12 3 કુરાન , 13 3 દેથલી , 14 3 એરથાણ , 15 3 યમનોત્રી , 16 3 સુત્રાપાડા , 17 3 જસદણ , 18 3 લીંબડી , 19 3 ખગોળશાસ્ત્ર , 20 3 ભાવનગર , 21 3 મહાભારત , 22 3 ગુજરાતી , 23 2 બકાસુર , 24 2 શ્રીહરિકોટા , 25 2 ઘાંચી

jan 2012: 1 4 મહેશ ભટ્ટ , 2 4 આંકડો (વનસ્પતિ) , 3 4 ગોઝારીયા , 4 4 અમદાવાદ , 5 3 જાંબુઘોડા અભયારણ્ય , 6 3 છૂંદો , 7 3 અમૂલ , 8 3 નેસડી (તા. સાવરકુંડલા) , 9 3 પાણીપૂરી , 10 3 જામા મસ્જિદ, અમદાવાદ , 11 3 ગીર રાષ્ટ્રીય ઉદ્યાન અને અભયારણ્ય , 12 3 ઉદવાડા , 13 3 નિશાના , 14 3 ડેબિયન , 15 3 પીરમબેટ , 16 3 પાલનપુર , 17 3 રાજ્ય સભા , 18 3 કાંકરિયા તળાવ , 19 2 પ્રભાશંકર પટ્ટણી , 20 2 કોઠી , 21 2 તલાટી-કમ-મંત્રી , 22 2 ચિત્રા (તા. ભાવનગર) , 23 2 દ્રાક્ષાસવ , 24 2 દીવાદાંડી , 25 2 જામા મસ્જિદ

fev 2012: 1 5 અમદાવાદ , 2 4 અલકા યાજ્ઞિક , 3 4 લેઉવા પટેલ , 4 3 શકરપુર (તા.ખંભાત) , 5 3 સોનૂ નિગમ , 6 3 સુનિધિ ચૌહાણ , 7 3 આહિર , 8 3 અક્ષરધામ (દિલ્હી) , 9 3 ગુરુત્વાકર્ષણ , 10 3 મહાત્મા ગાંધી , 11 2 વિદ્યુત ક્ષેત્ર , 12 2 આલિશા ચિનોઇ , 13 2 નિરમા યુનિવર્સિટી , 14 2 ડૉ.કમલા બેનિવાલ , 15 2 ભીમપુરા (તા. તલોદ) , 16 2 તેરા , 17 2 અંબાડી , 18 2 પપૈયાં , 19 2 અમૂલ , 20 2 મહેશ ભટ્ટ , 21 2 વાગડીયા (તા. જામનગર) , 22 2 પીપર (તા. કાલાવડ) , 23 2 કાળો કોશી , 24 2 ખીલ (રોગ) , 25 2 દૈયપ (તા. વાવ)

mar 2012: 1 4 ભીમાશંકર , 2 4 ગુજરાતની નદીઓની યાદી , 3 4 નરેન્દ્ર મોદી , 4 3 વિદ્યુત ક્ષેત્ર , 5 3 સાયના નેહવાલ , 6 3 ખડાણા (તા. પેટલાદ) , 7 3 ક્ષત્રિય , 8 2 તાલુકા વિકાસ અધિકારી , 9 2 ધુંઆધાર ધોધ , 10 2 આરસ ખડકો , 11 2 સ્ટ્રોબેરી , 12 2 પીએચપી , 13 2 બાખલકા (તા. તળાજા) , 14 2 ફ્લોપી ડિસ્ક , 15 2 ઇમેજ સ્કેનર , 16 2 મણિશંકર રત્નજી ભટ્ટ ‘કાન્ત’ , 17 2 નૃસિંહપ્રસાદ ભટ્ટ , 18 2 નંદકુમાર પાઠક , 19 2 શેખ આદમ આબુવાલા , 20 2 અનવર આગેવાન , 21 2 હિંમતલાલ અંજારિયા , 22 2 હાજી અલારખિયા , 23 2 ભૂપેશ અધ્વર્યુ , 24 2 આયેશા ટાકિયા , 25 2 મુકેશ અમૃતલાલ આચાર્ય

abr 2012: 1 4 કુરુક્ષેત્ર , 2 4 વસ્ત્રાપુર તળાવ , 3 4 ઍફીલ ટાવર , 4 4 ક્ષેત્રફળ , 5 4 અમદાવાદ , 6 3 ગુજરાતના પુરસ્કારો , 7 3 ભૂરિશ્રવા , 8 3 લાલભાઈ દલપતભાઈ ઈજનેરી મહાવિદ્યાલય , 9 3 ધરણીધર , 10 3 છૂંદો , 11 3 જગદ્ગુરુ રામભદ્રાચાર્ય , 12 3 પંડોળી , 13 3 સત્યના પ્રયોગો અથવા આત્મકથા , 14 3 ઝવેરચંદ મેઘાણી , 15 3 રાજકોટ , 16 3 નરેન્દ્ર મોદી , 17 2 જીસ્વાન , 18 2 ધૃષ્ટકેતુ , 19 2 વૃષકેતુ , 20 2 એકમ , 21 2 ગબ્બર , 22 2 સ્વચ્છ ગામ સ્વસ્થ ગામ યોજના , 23 2 દિકરી યોજના , 24 2 મહાત્મા ગાંધી રાષ્ટ્રીય ગ્રામીણ રોજગાર બાહેધરી યોજના , 25 2 રાષ્ટ્રીય ગ્રામીણ રોજગાર બાહેધરી યોજના

mai 2012: 1 5 દીક્ષાભૂમિ , 2 5 તરખંડા , 3 5 અમલનેર , 4 5 ડૉ. ભીમરાવ રામજી આંબેડકર , 5 4 અજમો , 6 4 મહાત્મા જ્યોતિરાવ ફુલે , 7 4 ડૉ.બાબાસાહેબ આંબેડકર , 8 4 અંતરા , 9 4 અમદાવાદ સીટી તાલુકો , 10 4 નાનાભાઈ ભટ્ટ , 11 3 વિશ્વનાથ ભટ્ટ , 12 3 ડો. બાબાસાહેબ આંબેડકર , 13 3 Portal:સબસ્ટબ કાર્યકારિણી , 14 3 પાળેલાં પશુઓ પર થતી શસ્ત્રક્રિયાની યાદી , 15 3 ખડિયા , 16 3 ભીમાશંકર , 17 3 માધુરી દીક્ષિત , 18 3 પટ્ટદકલ , 19 3 સિદસર (તા. ભાવનગર) , 20 3 રબારી , 21 3 ભૂસ્તરશાસ્ત્રી , 22 3 સપ્તપર્ણી , 23 3 આહિર , 24 3 ખાંટિયાવાંટ , 25 3 ઢીંકવા

jun 2012: 1 6 નરેન્દ્ર મોદી , 2 5 સુહાસી ધામી , 3 4 અમૃતા રાવ , 4 4 મહાભારત , 5 4 ગુજરાત , 6 3 રૂપશંકર ઓઝા , 7 3 શશિન્ ઓઝા , 8 3 કૃષ્ણકાન્ત કડકડિયા , 9 3 રામજીભાઈ કડિયા , 10 3 યશવંત કડીકર , 11 3 ધનવંત ઓઝા , 12 3 દિગન્ત ઓઝા , 13 3 તનસુખરાય ઓઝા , 14 3 મીનું એડનવાળા , 15 3 ઉષા ઉપાધ્યાય , 16 3 ઉમર ઉઘરાતદાર , 17 3 વઝીરુદ્દીન અલવી , 18 3 રમણિક અરાલવાળા , 19 3 સ્વામી સચ્ચિદાનંદ , 20 3 રમણ સોની , 21 3 હિમાંશી શેલત , 22 3 ગુલામમોહમ્મદ શેખ , 23 3 ધનંજય શાહ , 24 3 સતીશ વ્યાસ , 25 3 યોગેન્દ્ર વ્યાસ

jul 2012: 1 4 અનુષ્કા શેટ્ટી , 2 4 ધાનેરા , 3 4 ગણદેવી , 4 3 વૈદ્યનાથં , 5 3 રોઝાવાડા (તા. કપડવંજ) , 6 3 છોટાઉદેપુર , 7 3 વડગામ , 8 3 ત્રિકમ સાહેબ , 9 3 સોનગઢ , 10 3 વ્યારા , 11 3 કડી , 12 3 ચંદ્રકાંત બક્ષી , 13 3 માંડવી , 14 2 ગરબી , 15 2 તલીયારા , 16 2 બાલુચરી સાડી , 17 2 ખોપાળા (તા.ગઢડા) , 18 2 કાકરાપાર અણુ શક્તિ મથક , 19 2 ગઢડા તાલુકો , 20 2 ધણફુલીયા (તા. વંથલી) , 21 2 ચકરી , 22 2 લીંબુનું અથાણું , 23 2 બાપા સીતારામ , 24 2 તાજ ફાર્માસ્યૂટિકલ્સ ગ્રુપ , 25 2 આમરા (તા. જામનગર)

ago 2012: 1 3 એકવાર પીયુને મળવા આવજે (ચલચિત્ર) , 2 3 વડગામ (તા. દસાડા) , 3 3 સાયના નેહવાલ , 4 3 મહાત્મા ગાંધી , 5 2 જાળીયાળા (તા. લીંબડી) , 6 2 અબડાસા , 7 2 કલ્પના ચાવલા , 8 2 મીથુન ચક્રવર્તી , 9 2 પાયથાગોરસ , 10 2 સઈ , 11 2 મગ , 12 2 જસત , 13 2 ઝારેરા નેસ (તા. રાણાવાવ) , 14 2 હડમતીયા (તા. જામનગર) , 15 2 ધોળી (તા. લીંબડી) , 16 2 નીરજી , 17 2 ક્ષારાતુ , 18 2 આચાર્ય હજારી પ્રસાદ દ્વિવેદી , 19 2 અરજણસર (તા. રાધનપુર) , 20 2 કોલીવાડા (તા. સાંતલપુર) , 21 2 મિસળ , 22 2 ભારતનાં રાજ્યોના મુખ્ય મંત્રીઓ , 23 2 ભોળાદ (તા. ધોળકા) , 24 2 ડિસેમ્બર ૨૨ , 25 2 આહિર

set 2012: 1 4 શ્રી હરિલીલામૃત , 2 4 ઇ-મેઇલ , 3 4 અબ્દુલ કલામ , 4 4 સ્વામિનારાયણ , 5 4 ગુજરાતી દૈનિકપત્રોની યાદી , 6 3 દરબારી દેતાલ , 7 3 શીખ , 8 3 ભૂમિતિ , 9 2 TV9 ગુજરાત , 10 2 શ્રી હરિ દિગ્વિજય , 11 2 શ્રી હરિલીલાકલ્પતરુ , 12 2 આકાશવાણી , 13 2 મુઝફ્ફર વંશ , 14 2 વિશ્વ સાક્ષરતા દિન , 15 2 દિવાન બલ્લુભાઇ શાળા , 16 2 ભૌતિક અનુસંધાન પ્રયોગશાળા , 17 2 નાનીધારી , 18 2 ફરેણી , 19 2 અક્ષરધામ (ગાંધીનગર) , 20 2 નિરુપા રોય , 21 2 વીર્ય દાન , 22 2 રાવલા મંડી , 23 2 શિક્ષાપત્રી , 24 2 દીના પાઠક , 25 2 બાલુચરી સાડી

out 2012: 1 3 તારક મેહતા કા ઉલ્ટા ચશ્મા , 2 3 પ્રેમાનંદ , 3 3 નાઈટ્સ ટેમ્પ્લર , 4 3 ભારતીય રૂપિયો , 5 3 અમીયા (તા. બાયડ) , 6 3 ગણોલ (તા. ધોળકા) , 7 3 આનંદપુરા (તા. ધોળકા) , 8 3 બીજું વિશ્વ યુદ્ધ , 9 3 રાજેન્દ્ર શુક્લ , 10 3 બકુલ ત્રિપાઠી , 11 3 મીરાંબાઈ , 12 2 ગુજરાત વિધાનસભા , 13 2 ભારતીય થલસેના , 14 2 ધુમા , 15 2 ગૌરીશંકર ગોવર્ધનરામ જોષી , 16 2 પ્રભાશંકર પટ્ટણી , 17 2 મધુસૂદન પારેખ , 18 2 ગજડી , 19 2 ફુલઝર (તા. જસદણ) , 20 2 પ્રણવ મિસ્ત્રી , 21 2 ગુણવંત શાહ , 22 2 તાજપુર કેમ્પ (તા. તલોદ) , 23 2 કૃષ્ણનગર (સાબલી) (તા. ઇડર) , 24 2 રાજાસોરસ , 25 2 ભારતીય ભૂમિસેના

nov 2012: 1 5 ભાઈ બીજ , 2 4 કમ્પ્યુટર નેટવર્ક , 3 4 PHP (પ્રોગ્રામિંગ ભાષા) , 4 4 જાવા (પ્રોગ્રામિંગ ભાષા) , 5 4 અણ્ણા હઝારે , 6 3 કલ્પના (કંપની) , 7 3 પોન્ટી ચઢ્ઢા , 8 3 પાયથોન(પ્રોગ્રામિંગ ભાષા) , 9 3 ગો (પ્રોગ્રામિંગ ભાષા) , 10 3 કોમ્પ્યુટર નેટવર્ક , 11 3 C++(પ્રોગ્રામિંગ ભાષા) , 12 3 તારક મેહતા કા ઉલ્ટા ચશ્મા , 13 3 લાલભાઈ દલપતભાઈ ઈજનેરી મહાવિદ્યાલય , 14 3 પીએચપી , 15 3 પાનેસડા (તા. વાવ) , 16 3 રીબડી (તા. માંડલ) , 17 3 કારતક સુદ ૨ , 18 3 સુખદેવ , 19 3 મોરબી , 20 3 નથુરામ ગોડસે , 21 3 જુનાગઢ , 22 3 અમદાવાદ , 23 2 આઇ.આઇ.એમ. અમદાવાદ , 24 2 તલાશ (ચલચિત્ર) , 25 2 ઇસ પ્યાર કો ક્યા નામ દું?

dez 2012: 1 8 ૨૦૧૨ દિલ્હી બળાત્કાર ઘટના , 2 5 ડેન્ગ્યુ , 3 5 લાલભાઈ દલપતભાઈ ઈજનેરી મહાવિદ્યાલય , 4 5 નરેન્દ્ર મોદી , 5 4 ગુજરાતના પાવનકારી શક્તિપીઠો , 6 4 અમદાવાદની ગુફા , 7 4 અશ્વિની ભટ્ટ , 8 4 આલિશા ચિનોઇ , 9 4 મોરારજી દેસાઈ , 10 4 પાટણ , 11 4 વર્ષા અડાલજા , 12 3 કાજલ ઓઝા-વૈદ્ય , 13 3 સિવિલ હોસ્પિટલ, અમદાવાદ , 14 3 કેશુભાઈ પટેલ , 15 3 સલીમ સુલેમાન , 16 3 વર્ચ્યુઅલાઈઝેશન , 17 3 સેપ્ટ યુનિવર્સીટી , 18 3 કમ્પ્યુટર નેટવર્ક , 19 3 માધુરી દીક્ષિત , 20 3 અણ્ણા હઝારે , 21 3 ગુણવંત શાહ , 22 3 પાણશીણા (તા. લીંબડી) , 23 3 સંડેર (તા. પાટણ) , 24 3 ગુજરાત યુનિવર્સિટી , 25 3 સાણોદા (તા. દહેગામ)

jan 2013: 1 6 વલ્લભભાઈ પટેલ , 2 5 સાબરમતી મેરેથોન , 3 4 કોરોકોરો ટાપુ , 4 4 એરન સ્વાર્ટઝ , 5 4 સરદાર પટેલ રાષ્ટ્રીય મ્યુઝીયમ , 6 4 બારડોલી સત્યાગ્રહ , 7 3 OSI મોડેલ , 8 3 કમલેશ્વર બંધ , 9 3 ભારતીય રાષ્ટ્રીય કોંગ્રેસ , 10 3 કોચરબ આશ્રમ , 11 3 બારડોલી સ્વરાજ આશ્રમ , 12 3 ઈન્ટરનેટ પ્રોટોકોલ સ્યુટ , 13 3 ઓએસઆઈ મોડેલ , 14 3 ગોપાલ કૃષ્ણ ગોખલે , 15 3 મકડાલા (તા. દિયોદર) , 16 3 શેત્રુંજી નદી , 17 3 મચ્છુ નદી , 18 3 ગુજરાત , 19 2 જાપાનનો ઇતિહાસ , 20 2 કેદારેશ્વર મંદિર બારડોલી , 21 2 મહેન્દ્ર સિંઘ ધોની , 22 2 ભારતમાં આરોગ્યસંભાળ , 23 2 ચિત્તાગોંગ , 24 2 ઈન્ટરનેટ પ્રોટોકોલ , 25 2 ભારતીય માનક સમય

fev 2013: 1 5 ગુજરાત વિધાનસભા , 2 4 થાણાપીપળી (તા. વંથલી) , 3 4 અમદાવાદ બીઆરટીએસ , 4 3 નેહા શર્મા , 5 3 ચણા , 6 3 ફાઇલ ટ્રાન્સ્ફર પ્રોટોકોલ , 7 3 યાહૂ! , 8 3 નારિયેળ , 9 3 માતાનો મઢ , 10 3 પિસ્તા , 11 3 જાપાનનો ઇતિહાસ , 12 3 વેળવા , 13 3 મગ , 14 3 શેડુભાર (તા. અમરેલી) , 15 3 કડછ (તા. પોરબંદર) , 16 3 દુધીયા (તા. કલ્યાણપુર) , 17 3 ઠાકોર , 18 3 સિન્ડ્રેલા , 19 3 વડગામ , 20 3 મોરબી , 21 2 ચોઘડિયાં , 22 2 કુંવારપાઠું , 23 2 પ્રોફે. મહેબૂબ દેસાઈ , 24 2 મઠ , 25 2 ટ્યુનિશિયા

mar 2013: 1 5 દોડગામ (તા. થરાદ) , 2 4 વાધગઢ (તા. ધ્રાંગધ્રા) , 3 3 રતાળુ , 4 3 રવીન્દ્ર પ્રભાત , 5 3 મગ , 6 3 રાત્રિ સ્ખલન , 7 3 ટાટા ઈન્ડિગો , 8 3 થરાદ , 9 3 ગુજરાત વિદ્યાપીઠ , 10 2 ૨૦૦૨ ગુજરાત હિંસા , 11 2 રૂબિન ડેવિડ , 12 2 મધર ઇન્ડિયા , 13 2 લુશાળા (તા. વંથલી) , 14 2 ભાટીયા (તા. વંથલી) , 15 2 વાડલા (તા. વંથલી) , 16 2 સ્નેહ દેસાઇ , 17 2 મસુર , 18 2 વડાલ (તા.જુનાગઢ) , 19 2 ગુજરાત વિધાનસભા , 20 2 અડદ , 21 2 ચમારડી (તા. બાબરા) , 22 2 મોણપુર (તા. અમરેલી) , 23 2 સૂરણ , 24 2 અમેરિકન એરલાઇન્સ , 25 2 અંબારડી (તા. જસદણ)

abr 2013: 1 3 મેરી કોમ , 2 3 રવીન્દ્ર પ્રભાત , 3 3 શ્રવણબેલગોડા , 4 3 રામ પ્રસાદ બિસ્મિલ , 5 3 હાંડવો , 6 3 ગીર રાષ્ટ્રીય ઉદ્યાન અને અભયારણ્ય , 7 3 ગુજરાતનો નાથ , 8 2 ફિબોનાકિ , 9 2 ફેસબુક , 10 2 રાયણ , 11 2 નગડીયા (તા. વંથલી) , 12 2 માખીયાળા (તા.જુનાગઢ) , 13 2 મોટા (તા. પાલનપુર) , 14 2 હાડફોડી (તા. ઉપલેટા) , 15 2 વાંગધ્રા (તા. જસદણ) , 16 2 બાબા રામદેવ , 17 2 કરોલ (તા. પ્રાંતિજ) , 18 2 રવિન્દ્ર જાડેજા , 19 2 શેરડી , 20 2 ઋત્વિક રોશન , 21 2 કેવડીયા (તા. કપડવંજ) , 22 2 ત્રાજ (તા. માતર) , 23 2 ગોલીડા ‍(તા. રાજકોટ) , 24 2 પ્લેટો , 25 2 દેવાયત પંડિત

mai 2013: 1 4 પૂજ્ય શ્રી મોટા , 2 3 નેપોલિયન હિલ , 3 3 મૂળદાસ , 4 3 નસ્લી વાડિયા , 5 3 નામસ્મરણ , 6 3 ટ્રાન્સપોર્ટ ફોર લંડન , 7 3 દ્રાક્ષ , 8 3 અમૂલ , 9 3 મેડી (તા. અમરેલી) , 10 3 બાબાપુર (તા. અમરેલી) , 11 3 માવજીંજવા (તા. બગસરા) , 12 3 હેબતપુર (તા. દસાડા) , 13 3 મહમદ અલી ઝીણા , 14 3 મકતુપુર (તા. ઉંઝા) , 15 3 ખંભાત , 16 3 દિનકર જોષી , 17 3 મોહરમ , 18 3 વડનગર , 19 3 લંડન , 20 3 હિંદી ભાષા , 21 2 કરીના કપૂર , 22 2 જબ તક હૈ જાન , 23 2 શાહ અબ્દુલ લતીફ ભીતાઈ , 24 2 પ્રિયામણિ , 25 2 મરિઉપોલ

jun 2013: 1 3 હડકવા , 2 3 ઢોલિવુડ , 3 3 મરકી , 4 3 યુનિટ ૭૩૧ , 5 3 દેરાળા (તા.ગઢડા) , 6 3 ગુજરાત વિધાનસભા ચૂંટણી, ૨૦૧૨ , 7 3 મહમદ અલી ઝીણા , 8 3 અડાલજની વાવ , 9 3 સુરેન્દ્રનગર જિલ્લો , 10 3 જામનગર , 11 3 નરેન્દ્ર મોદી , 12 3 નરસિંહ મહેતા , 13 2 ભડલા , 14 2 લખાણકા (તા.ગઢડા) , 15 2 લીંબડીયા (તા.ગઢડા) , 16 2 લીંબાળા (તા.ગઢડા) , 17 2 લીંબાળી (તા.ગઢડા) , 18 2 હામાપર (તા.ગઢડા) , 19 2 હરીપર (તા.ગઢડા) , 20 2 હોળાયા (તા.ગઢડા) , 21 2 ઇંગોરાળા (તા.ગઢડા) , 22 2 ઇંગોરાળા (ખાલસા) (તા.ગઢડા) , 23 2 ઇશ્વરીયા (તા.ગઢડા) , 24 2 ઇતરીયા (તા.ગઢડા) , 25 2 જલાલપુર (તા.ગઢડા)

jul 2013: 1 4 ગુજરાતી દૈનિકપત્રોની યાદી , 2 3 થાના ગલોલ (તા. જેતપુર) , 3 3 જસરા (તા. ડીસા) , 4 3 સુરેન્દ્રનગર જિલ્લો , 5 2 સામાન્ય જ્ઞાન , 6 2 પંચામૃત , 7 2 રાયડો , 8 2 અશેળિયો , 9 2 જગતસિંઘજી મહારાજ , 10 2 ભાગ મિલ્ખા ભાગ , 11 2 હીરાકુડ બંધ , 12 2 કળથી , 13 2 મહાવીર જયંતી , 14 2 ખેરખટ્ટો , 15 2 હંસાબેન મહેતા , 16 2 કરીના કપૂર , 17 2 બોર , 18 2 દૈયડ , 19 2 દોડવીર મિલખા સિંઘ , 20 2 સોમાસર (તા. મુળી) , 21 2 અમૃતા રાવ , 22 2 રજકો , 23 2 કૅટરિના કૈફ , 24 2 આગથળા (તા. ડીસા) , 25 2 બાજરી

ago 2013: 1 4 જુનાગઢ , 2 3 કોદરા , 3 3 પન્ના ધાઈ , 4 3 કોડીનાર , 5 3 નરેન્દ્ર મોદી , 6 2 ચોળાફળી , 7 2 બ્રેમ્પ્ટન, ઓન્ટારીયો , 8 2 ફાફડા , 9 2 લાકડશી , 10 2 તારા માછલી , 11 2 સામો , 12 2 રેડિયો સ્ટુડિયો 54 નેટવર્કના , 13 2 ખીરભવાની મંદિર , 14 2 થાણાપીપળી (તા. વંથલી) , 15 2 ઋગ્વેદ , 16 2 સુર્યપરા (તા. જામનગર) , 17 2 ધ્રોલીયા (તા. ટંકારા) , 18 2 જીવાપર (તા. જસદણ) , 19 2 કારાકાસ , 20 2 એર બસ , 21 2 જેતલવાસણા (તા. વિસનગર) , 22 2 પેંડા , 23 2 જનાલી (તા. ભિલોડા) , 24 2 સંદેશ (અખબાર) , 25 2 શરીર વજન અનુક્રમ

set 2013: 1 6 અમદાવાદ , 2 5 ભાવનગર , 3 4 બખરલા (તા. પોરબંદર) , 4 3 રાયણ , 5 3 શિક્ષક દિન , 6 3 ખીજડો , 7 3 ખાટી આમલી , 8 3 વડ , 9 3 દ્રોણ , 10 3 ડીસા , 11 3 સ્વામી વિવેકાનંદ , 12 3 લીંબુ , 13 3 જામનગર , 14 2 ઇલાયચી , 15 2 ગુજરાતની હસ્તકળાઓ , 16 2 મોટા હરીપુરા (તા. વિરમગામ) , 17 2 બાજ (પક્ષી) , 18 2 આંધળીચાકળ (સર્પ) , 19 2 કપોત કુળ , 20 2 લવિંગ , 21 2 સિંધવ , 22 2 શમીમ દેવ આઝાદ , 23 2 સાંભળો, શરીર શું કહે છે ! (પુસ્તક) , 24 2 જૂનાગઢ સિંચાઇ વિભાગના જળબંધો , 25 2 જીમ કોર્બેટ

out 2013: 1 7 અમદાવાદ , 2 4 દરિયાઈ રાષ્ટ્રીય ઉદ્યાન અને અભયારણ્ય , 3 4 આસારામ બાપુ , 4 4 ઝૂલેલાલ , 5 3 પાલક (ભાજી) , 6 3 પાલખ (ભાજી) , 7 3 ચિત્રા (તા. ભાવનગર) , 8 3 ઉંચા કોટડા , 9 3 નારાયણ સરોવર અભયારણ્ય , 10 3 ઢાંક (તા. ઉપલેટા) , 11 3 પાનેસડા (તા. વાવ) , 12 3 ઉતેળીયા (તા. ધોળકા) , 13 3 હેબતપુર (તા. બરવાળા) , 14 3 સાંગાસર (તા. બરવાળા) , 15 3 વેળાવદર કાળિયાર રાષ્ટ્રીય ઉદ્યાન , 16 3 ઇસનપુર મોટા (તા. ગાંધીનગર) , 17 3 મદીના , 18 3 દાહોદ , 19 3 રોજીદ , 20 3 ચેટીચંડ , 21 3 ભાવનગર , 22 2 વસતી ગણતરી ૨૦૧૧ (અમદાવાદ) , 23 2 કુલધારા, રાજસ્થાન , 24 2 જીંજાવદર (તા.ગઢડા) , 25 2 ઉગામેડી (તા.ગઢડા)

nov 2013: 1 4 ઠાકોર , 2 3 સાંપડ (તા. પ્રાંતિજ) , 3 3 કુદરતી આફતો , 4 3 મહુવા , 5 3 શ્રીમદ્ ભગવદ્ ગીતા , 6 3 પાલીતાણા , 7 2 ગુજરાતના ધોરીમાર્ગોની યાદી , 8 2 બુદ્ધ અને તેમનો ધમ્મ , 9 2 પાલક (ભાજી) , 10 2 સતાણા નેસ (તા. પાલીતાણા) , 11 2 વિજાણા નેસ (તા. પાલીતાણા) , 12 2 બોદાણા નેસ (તા. પાલીતાણા) , 13 2 અગિયાળી (તા. સિહોર) , 14 2 વાઘનગર (તા.મહુવા) , 15 2 સમઢીયાળા (પાનબાઇ) (તા. ઉમરાળા) , 16 2 ઇંગોરાળા (તા. ઉમરાળા) , 17 2 બોચડવા (તા. ઉમરાળા) , 18 2 આંબલા (તા. સિહોર) , 19 2 ઘેલડા (તા. જામજોધપુર) , 20 2 દુકાળ , 21 2 ગરીયા (તા. વાંકાનેર) , 22 2 કોલંબો , 23 2 ફલુ (તા. વિજાપુર) , 24 2 વાવ (તા. ઘોઘંબા) , 25 2 સિમાલીયા (તા. ઘોઘંબા)

dez 2013: 1 3 હલદરવા નેસ (તા. વિસાવદર) , 2 3 બારવાનીયા નેસ (તા. વિસાવદર) , 3 3 સામાપોર , 4 3 દાંડી (જલાલપોર) , 5 3 વાછાવડ , 6 2 જાંબુડી નેશ (તા. મેંદરડા) , 7 2 કિલોરીયા નેશ (તા. મેંદરડા) , 8 2 કંથાળા નેશ (તા. મેંદરડા) , 9 2 વિસણવેલ(તા. માળીયા હાટીના) , 10 2 લાંગોદ્રા(તા. માળીયા હાટીના) , 11 2 ઘુમલી(તા. માળીયા હાટીના) , 12 2 દંડેરી(તા. માળીયા હાટીના) , 13 2 ઝડકા(તા. માળીયા હાટીના) , 14 2 આછીદ્રા(તા. માળીયા હાટીના) , 15 2 ઝરીયાવાડા (તા.માંગરોળ) , 16 2 વિરપુર (તા.માંગરોળ) , 17 2 વિરોલ (તા.માંગરોળ) , 18 2 વાડલા (તા.માંગરોળ) , 19 2 થલી (તા.માંગરોળ) , 20 2 તલોદ્રા (તા.માંગરોળ) , 21 2 સુલ્તાનપુર (તા.માંગરોળ) , 22 2 શીલ (તા.માંગરોળ) , 23 2 શેરિયાખાણ (તા.માંગરોળ) , 24 2 શેરિયાજ (તા.માંગરોળ) , 25 2 શેપા (તા.માંગરોળ)

jan 2014: 1 3 ચાણસ્મા , 2 2 લચિત બોરફૂકન , 3 2 પ્રાણલાલ પટેલ , 4 2 લોપકચિહ્ન , 5 2 અવતરણ ચિહ્ન , 6 2 મહારેખા , 7 2 વિગ્રહરેખા , 8 2 મહાવિરામ , 9 2 અર્ધ વિરામ , 10 2 ચોરવાડ(તા. માળીયા હાટીના) , 11 2 જાપાનનો ઇતિહાસ , 12 2 ગારીયાધાર , 13 2 પાણીયા ડુંગરી (તા. ધારી) , 14 2 માણાવાવ (તા. ધારી) , 15 2 કરમદડી (તા. ધારી) , 16 2 ખંભાળીયા (તા. ધારી) , 17 2 ખીસરી (તા. ધારી) , 18 2 જળજીવડી (તા. ધારી) , 19 2 કરેણ (તા. ધારી) , 20 2 દલખાણીયા (તા. ધારી) , 21 2 દિતલા (તા. ધારી) , 22 2 ધારગણી (તા. ધારી) , 23 2 રાજસ્થળી (તા. ધારી) , 24 2 સુખપુર (તા. ધારી) , 25 2 દેવળા (તા. ધારી)

fev 2014: 1 3 કલાલી , 2 2 ધરતી , 3 2 લોકનૃત્ય , 4 2 અબુડી (તા. ઉના) , 5 2 સાબરમતી મેરેથોન , 6 2 વેલી ઓફ ફ્લાવર્સ રાષ્ટ્રીય ઉદ્યાન , 7 2 સ્વામિનારાયણ સંપ્રદાય , 8 2 વચનામૃત , 9 2 વણછરા , 10 2 મુળી , 11 2 ડૉ. ભીમરાવ રામજી આંબેડકર , 12 2 તિથલ , 13 1 ધનપુર (તા. લીમખેડા)

mar 2014: 1 6 સરસવણી (તા. મહેમદાવાદ) , 2 4 રવિશંકર મહારાજ , 3 4 ચિખલી, મહારાષ્ટ્ર , 4 4 રવિશંકર વ્યાસ , 5 3 જેસલ જાડેજા , 6 3 છાંયા (તા. પોરબંદર) , 7 2 વિવેકાનંદ , 8 2 હિબ્રુ યુનિવર્સિટી ઑફ જેરુસલેમ , 9 2 શંકર મહાદેવન , 10 2 સુરેશ વાડકર , 11 2 કુંવારપાઠું , 12 2 ઇશ્વરનગર (તા. હળવદ) , 13 2 બૌદ્ધ ગુફાઓ, ખંભાલીડા , 14 2 ગોમતા (તા. ગોંડલ) , 15 2 કરણાસર (તા. થરાદ) , 16 2 રામ પ્રસાદ બિસ્મિલ , 17 2 મોરા (તા. મોડાસા) , 18 2 ગુરુના ચંદ્રો , 19 2 પટવાણ (તા. લીમખેડા) , 20 2 જુલાઇ ૧ , 21 2 ખોખડદળ , 22 2 દાહોદ , 23 2 પોપટ , 24 2 સંત કબીર , 25 1 પૂજ્ય રવિશંકર મહારાજ

abr 2014: 1 4 ભારતીય સામાન્ય ચૂંટણી, ૨૦૧૪ , 2 4 ઉના , 3 3 અવાક , 4 3 ઇજનેરી મહાવિદ્યાલય, પુણે , 5 3 વિનોદ ભટ્ટ , 6 3 રૂવા (તા. ભાવનગર) , 7 3 બહુચર માતા , 8 3 મોરારજી દેસાઈ , 9 3 સરસવણી (તા. મહેમદાવાદ) , 10 3 રાપર , 11 3 આહવા , 12 2 નવી મુંબઈ , 13 2 સુલોચના (રામાયણ) , 14 2 વિલાયતી પટ્ટાઇ , 15 2 પટ્ટી પટ્ટાઇ , 16 2 પાન પટ્ટાઇ , 17 2 કાચબરંગી , 18 2 અબલખ , 19 2 કરકરો , 20 2 ચલ , 21 2 વન લલેડુ , 22 2 દસાડી , 23 2 ભારતીય ઉપખંડના પક્ષીઓની યાદી , 24 2 સ્તેનેશ્વર મહાદેવ, તેના , 25 2 શબરી

mai 2014: 1 7 નરેન્દ્ર મોદી , 2 4 માતૃભાષા અભિયાન , 3 3 મનમોહન સિંહ , 4 3 ઉપલેટા , 5 3 રાજકોટ , 6 2 ગૂજરાત વિદ્યાપીઠ , 7 2 સાર્ક , 8 2 હિંદ મહાસાગર , 9 2 સન્ધિ (વ્યાકરણ) , 10 2 વિવેકાનંદ રોક મેમોરિયલ , 11 2 ઈગ્નસ તિર્કિ , 12 2 મમતા સોઢા , 13 2 ડૉ. શરદ ઠાકર , 14 2 ગમડાઉ (તા. ભચાઉ ) , 15 2 કબરાઉ (તા. ભચાઉ) , 16 2 ભારતીય સામાન્ય ચૂંટણી, ૨૦૧૪ , 17 2 પ્રાણલાલ પટેલ , 18 2 કણખોઇ (તા. ભચાઉ ) , 19 2 અળવી , 20 2 પાટણા (તા.ગઢડા) , 21 2 લુવારવાવ (તા. પાલીતાણા) , 22 2 ગોરડકા (તા.ગઢડા) , 23 2 ઑડિશાના મુખ્યમંત્રીઓ , 24 2 રામવાવ , 25 2 ઑડિશાના જિલ્લા અને શહેરો

jun 2014: 1 3 દર્શન જરીવાલા , 2 3 અભિષેક જૈન , 3 3 હેબતપુર (તા. દસાડા) , 4 3 ઉમરેઠ , 5 3 નર્મદા નદી , 6 2 માખણ , 7 2 સોપારી , 8 2 કાકડી , 9 2 રેકી , 10 2 સાબલવાડ કંપા (જનકપુર) (તા. ઇડર) , 11 2 જાપાનનો ઇતિહાસ , 12 2 કેવી રીતે જઈશ (ચલચિત્ર‌‌) , 13 2 ગુજરાત યુનિવર્સિટી , 14 2 ચોરીવાડ (તા. વડાલી) , 15 2 બેસિલિકા ઑફ બોમ જીસસ

jul 2014: 1 2 મહી નદી , 2 2 હોટલ તાજ મહેલ પેલેસ , 3 2 ઇન્દ્રાયણી એક્સપ્રેસ , 4 2 આઈ ટી સી ગ્રાંડ ચોલા હોટલ , 5 2 એર ઇન્ડિયા એક્સપ્રેસ , 6 2 વોલ્ટર બેન્ડેર , 7 2 પુસ્તક પરબ , 8 2 એર એશિયા ઇન્ડિયા , 9 2 માખણ , 10 2 માતૃભાષા અભિયાન , 11 2 શોભાવડ (તા. તળાજા) , 12 2 કાજલ ઓઝા-વૈદ્ય , 13 2 ખીચા (તા. ધારી) , 14 2 ક્રોપ સર્કલ , 15 1 ચોલા સામ્રાજ્ય

ago 2014: 1 4 બે યાર , 2 4 આનંદીબેન પટેલ , 3 4 તબલા , 4 3 સચિન-જીગર , 5 3 ભૂસ્ખલન , 6 3 અભિષેક જૈન , 7 3 ગુજરાત , 8 2 ધ પારડી હોટેલ્સ ચેન્નઈ , 9 2 ધ પાર્ક ચેન્નાઇ , 10 2 ઓબેરોય ટ્રાયડેંટ , 11 2 દિલીપ કુમાર , 12 2 જિનવિજયજી , 13 2 સોડવદરા , 14 2 નવા નદિસર , 15 2 હોવાર્ડ ગોબિઓફ , 16 2 મધરબોર્ડ , 17 2 કાન , 18 2 સરતાનપર (તા. તળાજા) , 19 2 કેવી રીતે જઈશ (ચલચિત્ર‌‌) , 20 2 વીર્ય સ્ખલન , 21 2 પંચાશીયા (તા. વાંકાનેર) , 22 2 મહેન્દ્રગઢ (તા.માળિયા-મિયાણા) , 23 2 ટાઇગર વુડ્સ , 24 2 ક્રોપ સર્કલ , 25 2 મલેરિયા

set 2014: 1 3 રત્નમણીરાવ જોટે , 2 3 વિશ્વ ગુજરાત , 3 3 જેટ એરવેઝ , 4 3 ઔરંગાબાદ જન શતાબ્દી એક્સપ્રેસ , 5 3 લુવારવાવ (તા. પાલીતાણા) , 6 3 વલ્લભ વિદ્યાનગર , 7 3 હિમાચલ પ્રદેશ , 8 3 ગણિત , 9 2 કાબરો કલકલીયો , 10 2 મેઇડન્સ હોટલ દિલ્હી , 11 2 ધોલેરા , 12 2 દ્રષ્ટિ ધામી , 13 2 મહીસાગર જિલ્લો , 14 2 ધરો આઠમ , 15 2 સૂર્ય (દેવ) , 16 2 ભોપાલ - બિલાસપુર એક્સપ્રેસ , 17 2 એમપી-થ્રી (MP3) , 18 2 દીપચંદભાઇ ગાર્ડી , 19 2 સરદારગઢ , 20 2 ચીપકો આંદોલન , 21 2 આઇ.આઇ.એમ. અમદાવાદ , 22 2 પ્રાચી (તા. સુત્રાપાડા) , 23 2 કલ્પના ચાવલા , 24 2 ફાચરિયા (તા. જાફરાબાદ) , 25 2 હિંમતલાલ દવે

out 2014: 1 3 ભાયાતી જાંબુડીયા (તા. વાંકાનેર) , 2 3 લીચેસ્ટેઈન , 3 3 કંડલા બંદર , 4 2 સમ્બિત પાત્રા , 5 2 ઇન્દોર દુરંતો એક્સપ્રેસ , 6 2 ધ ઈમ્પીરીયલ, નવી દિલ્હી , 7 2 ઈન્ડીગો , 8 2 હુદહુદ (ચક્રવાત) , 9 2 ઘંટી-ટાંકણો , 10 2 રાજીવ દિક્ષીત , 11 2 કોસંબા (તા. વલસાડ) , 12 2 દિશા વાકાણી , 13 2 રણછોડજી દીવાન , 14 2 કુંભારા (તા. બોટાદ) , 15 2 માલશ્રમ (તા.કોડીનાર) , 16 2 ટીંબડી (તા. સુત્રાપાડા) , 17 2 જીવવિજ્ઞાન , 18 2 વર્ણાતુ , 19 2 કાગદડી (તા. બગસરા) , 20 2 ગુજરાતની ભૂગોળ , 21 2 વરનોડા (તા. ડીસા) , 22 2 રાષ્ટ્રીય યુવા દિન , 23 2 ભારતનાં રાજ્યોના મુખ્ય મંત્રીઓ , 24 2 પક્ષી , 25 2 ઇંદરગોટા

nov 2014: 1 4 મુંબઈ મેટ્રોના સ્ટેશનોની યાદી , 2 4 રામાયણ , 3 3 મુંબઈ મેટ્રો , 4 3 માનવ શરીર , 5 3 મિશ્રધાતુ , 6 3 બોજાદરા , 7 3 વડગામ , 8 3 અંજાર , 9 2 બ્રિટાનિયા સ્ટેડિયમ , 10 2 સ્ટોક સિટી ફૂટબોલ ક્લબ , 11 2 રમેશચંદ્ર મજુમદાર , 12 2 સાઉધમ્પ્ટન ફૂટબોલ ક્લબ , 13 2 માળનાથ (ડુંગરમાળા) , 14 2 માલેશ્રી (નદી) , 15 2 રામલીલા , 16 2 ઉત્ક્રાંતિ , 17 2 લેસ્ટર સિટી ફૂટબૉલ ક્લબ , 18 2 ગિલોટિન (સંસદ) , 19 2 ટોટનમ હોટ્સ્પર ફૂટબોલ ક્લબ , 20 2 ગૂડિસન પાર્ક , 21 2 ભણગોળ(તા. ભાણવડ) , 22 2 સ્નેહા ઠક્કર , 23 2 સ્ટેમ્ફોર્ડ બ્રિજ (સ્ટેડિયમ) , 24 2 ચેલ્સી ફૂટબોલ ક્લબ , 25 2 વિલા પાર્ક

dez 2014: 1 2 રત્નમણીરાવ જોટે , 2 2 સી.એન.આર.રાવ , 3 2 ટ્રાજન , 4 2 ડી. ડબલ્યુ. સ્ટેડિયમ , 5 2 વિગાન એથલેટિક ફૂટબૉલ ક્લબ , 6 2 ઇવૂડ્ પાર્ક , 7 2 બ્લેકબર્ન રોવર્સ ફૂટબૉલ ક્લબ , 8 2 શેફિલ્ડ વેડન્ઝડે ફૂટબૉલ ક્લબ , 9 2 વોલ્વરહેમ્પ્ટન વેન્ડરર્સ ફૂટબૉલ ક્લબ , 10 2 કાર્ડિફ સિટી ફૂટબૉલ ક્લબ , 11 2 વેલ્સ , 12 2 સ્વાનસી સિટી એસોસિયેશન ફૂટબોલ ક્લબ , 13 2 હલ સિટી એસોસિયેશન ફૂટબોલ ક્લબ , 14 2 સ્ટોક સિટી ફૂટબોલ ક્લબ , 15 2 સાઉધમ્પ્ટન ફૂટબોલ ક્લબ , 16 2 સન્ડરલેન્ડ એસોસિયેશન ફૂટબોલ ક્લબ , 17 2 મુંબઈ મેટ્રો , 18 2 મુંબઈ મેટ્રોના સ્ટેશનોની યાદી , 19 2 વ્હાઈટ હાર્ટ લેન , 20 2 સ્નેહા ઠક્કર , 21 2 અમીરાત સ્ટેડિયમ , 22 2 ચુડાસમા , 23 2 અંધવિશ્વાસ

jan 2015: 1 4 રજનીબાળા , 2 4 કણકોટ (તા. વાંકાનેર) , 3 4 ધર્મેન્દ્ર , 4 3 યેઘીશે ચારેન્ત્સ , 5 3 મહેન્દ્ર સિંઘ ધોની , 6 3 ઉપેન્દ્ર ત્રિવેદી , 7 3 ધ અંડરટેકર , 8 3 ખાંભડા (તા. બરવાળા) , 9 3 ભાવનગર , 10 2 ઈક્વેડોરનો રાષ્ટ્રધ્વજ , 11 2 જેસર (તા.મહુવા) , 12 2 કોંગોનું લોકતંત્રીય ગણતંત્રનો રાષ્ટ્રધ્વજ , 13 2 અઝેરબીજાનનો રાષ્ટ્રધ્વજ , 14 2 અફઘાનિસ્તાનનો રાષ્ટ્રધ્વજ , 15 2 સાર્વભૌમ દેશોના રાષ્ટ્રધ્વજોની ચિત્રગેલેરી , 16 2 ઘનશ્યામ નાયક , 17 2 પર્યાવરણ સંરક્ષણ સ્થિતિ , 18 2 પાટણા (તા.ગઢડા) , 19 2 વેજોદરી (તા. તળાજા) , 20 2 અટલ બિહારી વાજપેયી , 21 2 થૉમસ ઍડિસન , 22 2 સ્નેહલતા , 23 2 પંજાબ (પાકિસ્તાન) , 24 1 બ્રિટનની ફૂટબોલ ક્લબો અને સ્ટેડિયમોની યાદી

fev 2015: 1 5 સ્વરચક્ર , 2 2 ભાલચંદ્ર નેમાડે , 3 2 સરિતા જોશી , 4 2 ડોળાસા (તા.કોડીનાર) , 5 2 જ્ઞાનપીઠ એવોર્ડ , 6 2 ફાચરીયા (તા. જામનગર) , 7 2 મનોજ ખંડેરિયા , 8 2 બેટલીયા (તા. થરાદ) , 9 2 દક્ષિણ એશિયા , 10 2 ભાગળ , 11 2 ખંભાત , 12 2 પાવી જેતપુર , 13 2 રેવાડી જિલ્લો , 14 2 ગુડગાંવ જિલ્લો , 15 2 કુરુક્ષેત્ર જિલ્લો , 16 2 પન્નાલાલ પટેલ , 17 2 તારક મહેતા , 18 2 સાપુતારા , 19 2 બનાસકાંઠા જિલ્લો , 20 1 રેવારી જિલ્લો

mar 2015: 1 4 મમુઆરા (તા. ભુજ) , 2 3 હૃદયકુંજ , 3 3 ઈન્દ્રપ્રસ્થ માહિતી ટેકનોલોજી સંસ્થા - દિલ્હી , 4 3 એસ્કેરિયાસિસ , 5 3 મામોરા (તા. ભુજ) , 6 3 ગાંધીનગર , 7 2 મિયાણી બીચ , 8 2 વીરડી (તા.ગઢડા) , 9 2 ભારતીય ચૂંટણી પંચ , 10 2 ચમારડી (તા. બાબરા) , 11 2 દાતરડી (તા. રાજુલા) , 12 2 મિયાણી (તા. પોરબંદર) , 13 2 સુદર્શન ચક્ર , 14 2 ભારતીય રિઝર્વ બેંક , 15 2 વાંસડા (તા. સતલાસણા) , 16 2 મહારાણા પ્રતાપ , 17 2 તજ , 18 2 સેવ ખમણી , 19 2 વેળાવદર કાળિયાર રાષ્ટ્રીય ઉદ્યાન , 20 2 ખડીયારાપુરા , 21 2 મહેલાણ , 22 2 ધારાપુર (તા. શહેરા) , 23 1 લોનાર ઉલ્કા તળાવ

abr 2015: 1 3 પરેશ રાવલ , 2 3 ગાંઠિયા , 3 3 ભારતના રાષ્ટ્રપતિ , 4 2 રામાસ્વામી પરમેશ્વરન , 5 2 રાજેશ ખન્ના , 6 2 આંધ્રપ્રદેશ એક્સપ્રેસ , 7 2 એર અરેબિયા , 8 2 અમરાવતી એક્સપ્રેસ , 9 2 મોહમ્મદ માંકડ , 10 2 અફઘાની ભાષા , 11 2 સંજય કુમાર , 12 2 ગૃહમંત્રી , 13 2 યોગેન્દ્ર સિંહ યાદવ , 14 2 પ્રભાતસિંહ પ્રતાપસિંહ ચૌહાણ , 15 2 પરાશર સરોવર (હિમાચલ પ્રદેશ) , 16 2 અમિત જેઠવા , 17 2 અરવલ્લી જિલ્લો , 18 2 સરપંચ , 19 2 આદિપુર (કચ્છ) , 20 2 ભારતીય ક્રિકેટ મેદાનોની યાદી , 21 2 પાંગોંગ સરોવર , 22 2 વારલી ચિત્રકળા , 23 2 ભરુચ જંકશન રેલ્વે સ્ટેશન , 24 2 કાંદિવલી , 25 2 ચક્રવાક

mai 2015: 1 4 પ્રભાતસિંહ પ્રતાપસિંહ ચૌહાણ , 2 4 મુસલમાન , 3 4 તોરણિયો ડુંગર , 4 4 હિંદુ , 5 3 ફાલુદા , 6 3 તકમરિયાં , 7 3 ચીયા , 8 3 ઘુટું (તા. મોરબી) , 9 3 મલ્ટિમીટર , 10 3 અમીયા (તા. બાયડ) , 11 3 ખંભાત , 12 3 ગાંઠિયા , 13 3 રમેશ પારેખ , 14 3 અમદાવાદ , 15 2 વિલે પાર્લે , 16 2 પૂજા , 17 2 એસ્સેલવર્લ્ડ , 18 2 સોહિલ , 19 2 લેગો , 20 2 જન શતાબ્દી એક્સપ્રેસ , 21 2 ગુજરાત ક્વીન , 22 2 કાજલ , 23 2 દેશી બોયઝ , 24 2 ગીતકાર , 25 2 પાર્શ્વગાયક

jun 2015: 1 4 જહાજ વૈતરણા (વીજળી) , 2 4 વચનામૃત , 3 3 દાળવડા , 4 3 સોયાબીન , 5 3 ધનાળા (તા. હળવદ) , 6 3 જુનાગઢ , 7 3 ગાંધીધામ , 8 3 ભરૂચ , 9 2 માઇલ , 10 2 ગોરાઇ , 11 2 ભાવનગર મ્યુનિસિપલ કોર્પોરેશન , 12 2 મોરડ , 13 2 પોળોનું જંગલ , 14 2 ગોટી , 15 2 રસોઈ શો , 16 2 અવકુડા , 17 2 અક્સા બીચ , 18 2 શ્યામ પાઠક , 19 2 જોગેશ્વરી ગુફાઓ , 20 2 જોગનો ધોધ , 21 2 ફુરસા , 22 2 મહાદેવપુરા (તા.બહુચરાજી) , 23 2 અનારકલી પોશાકો , 24 2 વન્ડરલા , 25 2 આરે મિલ્ક કોલોની

jul 2015: 1 5 અબ્દુલ કલામ , 2 4 મોહમ્મદ મહાબતખાન બાબી , 3 4 જૂનાગઢ રિયાસત , 4 3 ધોકો (પંચાંગ) , 5 3 કુડોલ (તા. મોડાસા) , 6 3 તણછા (તા.આમોદ) , 7 3 ગીર રાષ્ટ્રીય ઉદ્યાન અને અભયારણ્ય , 8 3 પશુપાલન , 9 3 સોક્રેટિસ , 10 3 પ્લૂટો , 11 2 બુરુલી અલ્સર , 12 2 ધ હિંદુ , 13 2 લીના જુમાની , 14 2 રાબિયા બસરી , 15 2 કેરમ , 16 2 માયામિ , 17 2 નંદિતા દાસ , 18 2 ફાતિમા મીર , 19 2 ફાતિમા ઝીણા , 20 2 દરીયાઈ કાચબો , 21 2 ઠાડિયા , 22 2 અલ્લાહ , 23 2 શિવ નિવાસ પેલેસ , 24 2 ધીરુભાઇ અંબાણી ઇન્સ્ટિટ્યુટ ઓફ ઇન્ફોર્મેશન એન્ડ કમ્યુનિકેશન ટેક્નોલોજી , 25 2 લૉ ગાર્ડન

No data on this page have been normalized to 30 day months (as WMF does on certain traffic reports).
Wikipedias are initially ordered by number of speakers of the language

Speakers: Number of speakers of a language is the estimated total of primary and secondary speakers, is in many cases a very rough estimation (based on the page on the English Wikipedia about that language)
Regions are parts of the world where the language is spoken in substantial amounts (compared to total number of speakers). Regions where a language gained presence only by a recent diaspora are generally not included.
Region codes: AF:Africa, AS:Asia, EU:Europe, NA:North America, OC:Oceania, SA:South America, W:World Wide, CL:Constructed Language

Estatísticas geradas em Segunda-feira, 24 de agosto 2015 11:57

Dump file guwiki-20150805-stub-meta-history.xml.gz (edits only), size 25 Mb as gz -> 188 Mb
Dump processed till Jul 31, 2015, on server stat1002, ready at Sat-22/08/2015-04:08 after 2 min, 26 sec.

Versão do script:2.6
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.