Estatísticas da Wikipédia guzerate

Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Articles per size range / Records per namespace / Most edited articles / Zeitgeist

Most metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.

Some metrics have been collected from the full archive dump which runs on lower frequency than the usual monthly cycle.
These metrics are columns F,I,J,K,M,N,O,P,Q,R from the first table.

See also metrics definitions

Monthly counts & Quarterly rankings: agosto 2014
DataWikipedistasArtigosBase de dadosLigações
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
Aug 20140%   0%      +116%      +1%
Jul 2014+1%   0%      -26%      0%
Jun 20140%   0%      -40%      0%
May 2014+1%   0%      -42%      +1%
Apr 2014+1%   0%      +40%      +1%
Mar 2014+1%   0%      +20%      0%
Aug 201422217326 k 110,6   757      1,7 k
Jul 201422125 26 k  10,5   350      1,7 k
Jun 2014219111 26 k  10,5   476      1,7 k
May 2014218213226 k 210,5   795      1,7 k
Apr 2014216212425 k 310,5   1,4 k      1,6 k
Mar 2014214210225 k  10,5   990      1,6 k
Feb 2014212 7225 k25 k 10,5238188%9%828136 Mb8,3 M473 k7,9 k3,4 k44 k1,6 k
Jan 201421229325 k25 k310,4239888%10%1,8 k137 Mb8,3 M470 k7,9 k3,4 k43 k1,6 k
Dec 2013210110325 k25 k1910,4240188%10%1,9 k137 Mb8,3 M469 k7,9 k3,4 k43 k1,6 k
Nov 2013209211425 k24 k4210,6243488%10%3,5 k135 Mb8,2 M459 k8,0 k3,4 k43 k1,6 k
Oct 2013207215623 k23 k2211246887%9%3,4 k131 Mb8,0 M443 k7,9 k3,4 k41 k1,6 k
Sep 2013205313423 k22 k111,2249686%9%1,5 k129 Mb7,9 M431 k8,8 k3,3 k40 k1,6 k
Aug 2013202213223 k22 k111,1249486%9%822129 Mb7,9 M431 k8,8 k3,3 k40 k1,5 k
Jul 201320019223 k22 k111,1249686%9%5,6 k129 Mb7,9 M430 k10,0 k3,3 k39 k1,5 k
Jun 2013199110323 k22 k410,9249686%9%19 k129 Mb7,9 M430 k10 k3,3 k39 k1,5 k
May 2013198316323 k22 k110,1245184%9%3,4 k126 Mb7,7 M428 k10 k3,3 k39 k1,5 k
Apr 2013195113123 k22 k 9,9239082%9%2,3 k124 Mb7,6 M425 k10 k3,3 k39 k1,5 k
Mar 2013194320223 k22 k19,8234582%9%13 k122 Mb7,5 M424 k11 k3,3 k39 k1,5 k
Feb 2013191421522 k22 k29,3213478%9%6,7 k119 Mb7,1 M417 k177 k3,3 k39 k1,5 k
Jan 2013187522322 k22 k39213078%8%3,2 k118 Mb7,1 M416 k174 k3,2 k39 k1,5 k
Dec 2012182627622 k22 k28,9212978%8%4,3 k117 Mb7,0 M414 k173 k3,1 k39 k1,4 k
Nov 2012176317322 k22 k48,8210778%8%12 k116 Mb7,0 M413 k171 k3,1 k38 k1,4 k
Oct 2012173417322 k22 k18,2201975%8%12 k113 Mb6,8 M411 k170 k3,0 k38 k1,4 k
Sep 2012169714322 k22 k17,7200774%8%2,3 k112 Mb6,7 M410 k169 k2,9 k38 k1,4 k
Aug 2012162614122 k22 k17,6200173%8%1,9 k112 Mb6,7 M410 k168 k3,0 k38 k1,4 k
Jul 2012156216222 k22 k17,6200073%8%3,0 k112 Mb6,7 M410 k167 k3,0 k38 k1,4 k
Jun 2012154518522 k21 k37,4199773%8%3,4 k111 Mb6,7 M408 k166 k3,0 k38 k1,4 k
May 2012149516422 k21 k17,3198773%8%2,7 k111 Mb6,7 M407 k165 k3,1 k38 k1,4 k
Apr 2012144513222 k21 k17,2198273%8%2,2 k110 Mb6,6 M406 k164 k3,3 k37 k1,3 k
Mar 2012139111122 k21 k17,1198373%8%1,9 k110 Mb6,6 M406 k163 k3,3 k37 k1,3 k
Feb 2012138315322 k21 k17198273%8%2,3 k110 Mb6,6 M406 k162 k3,3 k37 k1,3 k
Jan 2012135419322 k21 k36,9198273%8%3,2 k110 Mb6,6 M405 k162 k3,3 k37 k1,3 k
Dec 2011131315522 k21 k46,8198073%8%3,8 k109 Mb6,6 M404 k160 k3,1 k37 k1,3 k
Nov 201112839322 k21 k76,7197573%7%3,1 k108 Mb6,5 M401 k159 k3,0 k37 k1,3 k
Oct 2011125312321 k21 k96,6198273%8%3,0 k108 Mb6,5 M399 k158 k3,0 k37 k1,3 k
Sep 2011122 9321 k20 k116,5199772%8%3,6 k107 Mb6,4 M392 k157 k3,1 k37 k1,3 k
Aug 2011122211221 k20 k76,5201372%8%2,9 k106 Mb6,4 M385 k157 k3,1 k37 k1,2 k
Jul 2011120310221 k20 k136,4201872%8%3,6 k105 Mb6,3 M382 k156 k3,1 k36 k1,2 k
Jun 2011117312320 k20 k126,3203071%7%3,4 k104 Mb6,3 M373 k155 k3,1 k36 k1,2 k
May 2011114314420 k19 k146,3199270%7%5,0 k100 Mb6,0 M365 k153 k3,0 k35 k1,2 k
Apr 201111129319 k19 k136,2196469%7%3,5 k96 Mb5,8 M357 k149 k3,0 k34 k1,2 k
Mar 201110917319 k18 k136,1194867%7%4,1 k94 Mb5,7 M348 k147 k3,1 k33 k1,1 k
Feb 2011108618319 k18 k136193462%7%3,1 k91 Mb5,5 M337 k145 k3,1 k32 k1,1 k
Jan 2011102315518 k17 k136187160%7%4,4 k87 Mb5,2 M328 k142 k2,8 k30 k1,1 k
Dec 201099114518 k17 k135,9184756%7%3,6 k84 Mb5,0 M320 k140 k2,6 k28 k1,1 k
Nov 201098816517 k17 k135,8179755%7%3,8 k80 Mb4,8 M312 k137 k2,3 k27 k1,0 k
Oct 201090412517 k16 k145,7175152%6%4,1 k76 Mb4,5 M304 k134 k2,1 k25 k1,0 k
Sep 201086316617 k16 k155,6167650%6%3,8 k71 Mb4,2 M293 k130 k2,2 k23 k997
Aug 201083115516 k15 k165,5155745%6%8,2 k65 Mb3,8 M280 k126 k1,8 k21 k965
Jul 201082312416 k15 k155,2144441%6%3,5 k59 Mb3,4 M264 k121 k1,8 k18 k875
Jun 201079311315 k14 k145,1134338%5%3,6 k53 Mb3,1 M247 k116 k1,7 k16 k849
May 201076110415 k14 k155126034%5%4,1 k49 Mb2,8 M231 k113 k1,4 k14 k826
Apr 201075110214 k13 k174,9125427%5%4,3 k47 Mb2,7 M223 k111 k1,4 k14 k813
Mar 201074416214 k13 k274,7122822%5%5,2 k45 Mb2,6 M212 k108 k1,4 k13 k805
Feb 201070415213 k12 k184,6115420%5%4,4 k40 Mb2,3 M190 k102 k1,5 k11 k790
Jan 20106628212 k11 k214,5108619%5%4,2 k36 Mb2,0 M175 k96 k1,4 k9,3 k784
Dec 20096429112 k10 k214,4108418%5%3,8 k34 Mb1,9 M164 k90 k1,4 k8,8 k723
Nov 20096236111 k9,8 k254,3104119%5%3,3 k31 Mb1,7 M150 k84 k1,4 k7,4 k636
Oct 200959112310 k8,9 k294,3105020%5%3,4 k29 Mb1,6 M135 k79 k1,4 k6,9 k555
Sep 200958 949,5 k7,8 k374,395820%5%3,3 k24 Mb1,4 M115 k70 k1,2 k5,4 k520
Aug 20095861538,4 k6,7 k334,594321%5%3,5 k21 Mb1,2 M96 k60 k9834,7 k359
Jul 2009522827,3 k5,7 k254,698022%5%2,2 k19 Mb1,1 M82 k52 k1,0 k4,4 k320
Jun 2009501726,6 k4,9 k214,9100624%5%2,0 k17 Mb996 k70 k46 k8904,2 k309
May 200949 645,9 k4,3 k27575823%5%5,4 k12 Mb686 k53 k38 k7222,1 k278
Apr 2009492925,1 k3,4 k604,878519%6%2,8 k11 Mb612 k43 k34 k7722,0 k249
Mar 200947 823,3 k1,7 k196,689123%7%1,6 k7,6 Mb448 k25 k28 k7291,6 k244
Feb 200947 1012,7 k1,1 k37,489225%8%7706,4 Mb369 k18 k25 k5861,3 k225
Jan 200947 7 2,6 k1,1 k17,386725%8%8075,9 Mb348 k17 k24 k5721,2 k219
Dec 20084726 2,6 k1,0 k17,177824%8%6185,5 Mb310 k16 k22 k534970211
Nov 200845 712,6 k1,0 k26,974923%7%8865,2 Mb296 k16 k21 k514858207
Oct 2008451712,5 k96026,771422%7%7764,9 Mb277 k15 k20 k478784197
Sep 200844311 2,5 k88536,565220%6%8334,5 Mb246 k14 k19 k366635192
Aug 20084131012,4 k851216,564220%6%1,9 k4,2 Mb233 k13 k19 k333595183
Jul 200838 711,7 k638147,874524%7%1,9 k3,6 Mb194 k10 k17 k306540178
Jun 2008382811,3 k5938989329%8%1,1 k3,2 Mb170 k8,2 k16 k289496156
May 2008364921,0 k5631610,2106435%10%1,2 k3,0 Mb160 k7,4 k14 k283458144
Apr 20083225 545391217148043%14%5132,1 Mb118 k5,4 k14 k264421123
Mar 200830151498346117,5149139%13%5622,0 Mb108 k5,0 k13 k261412117
Feb 20082947 459303117,8154036%14%4861,8 Mb100 k4,7 k13 k251371112
Jan 20082535 427280 18161637%14%4551,7 Mb96 k4,7 k13 k246373111
Dec 20072235 416273117,4155137%13%4601,6 Mb90 k4,6 k12 k238332109
Nov 20071921 400266 16,9152536%13%4051,6 Mb87 k4,4 k12 k235310108
Oct 200717 2 387265216,4152037%13%4901,6 Mb86 k4,4 k12 k235302108
Sep 20071712 338265 17,4171242%14%3411,5 Mb86 k4,4 k11 k234299106
Aug 20071611 325261 17170742%15%2281,5 Mb85 k4,4 k11 k231285104
Jul 200715   322261 16,5170042%15%731,5 Mb84 k4,4 k11 k232283103
Jun 20071514 321260 16,3168442%15%2331,5 Mb84 k4,4 k11 k233278103
May 20071413 317255115,8169741%15%4001,5 Mb83 k4,4 k11 k231276102
Apr 200713141301242115,3142640%13%3851,2 Mb66 k3,7 k10,0 k220236101
Mar 200712131269210115,6121638%12%503953 kb47 k3,3 k8,2 k19622483
Feb 20071112 250196114,8126439%12%276867 kb45 k3,3 k7,7 k18223073
Jan 200710   233180 14,7119936%10%261774 kb39 k3,0 k7,4 k16322472
Dec 200610 1 230174 13,8121235%10%329760 kb39 k3,0 k7,0 k16321972
Nov 200610   226171 12,6123235%10%44730 kb38 k3,0 k6,1 k16221271
Oct 20061011 225172 12,4123535%10%70730 kb38 k3,0 k6,0 k16321271
Sep 20069   220166 12,4122834%10%47709 kb37 k2,9 k6,0 k16321271
Aug 20069   216165 12,4122334%11%77691 kb37 k2,9 k5,8 k16321271
Jul 20069   213166 12,2122335%11%130689 kb37 k2,9 k5,7 k16321071
Jun 20069   211165 11,7122235%11%130681 kb37 k2,9 k5,5 k16221071
May 20069 1 209164 11,2121735%11%124668 kb36 k2,9 k5,3 k15920871
Apr 20069   208164 10,7119635%10%150658 kb36 k2,9 k5,2 k16020870
Mar 20069   206164 10119535%10%128651 kb36 k2,9 k4,9 k16020870
Feb 20069 1 203163 9,6119636%10%25633 kb36 k2,9 k4,4 k16020869
Jan 20069 21202162 9,5119836%9%217630 kb35 k2,9 k4,4 k16020869
Dec 20059 1118814719135434%10%190611 kb37 k2,9 k3,7 k15721055
Nov 20059 1 147117 10,3162641%12%24555 kb35 k2,7 k2,8 k12520346
Oct 20059   144117 10,3164541%12%15553 kb35 k2,7 k2,8 k12420346
Sep 20059 1 143117 10,3165541%13%29551 kb35 k2,7 k2,8 k12420346
Aug 20059 1 142117 10,1165842%13%20549 kb35 k2,7 k2,7 k12420345
Jul 20059 1 142117 10171442%13%42545 kb37 k2,7 k2,6 k12421845
Jun 20059 3214211729,7170042%13%456516 kb36 k2,6 k2,5 k12422245
May 2005923 9172110,1168348%14%383315 kb24 k1,7 k9845414918
Apr 20057 1 6649 8,2120939%6%84153 kb12 k676540155611
Mar 20057 1 593917,772032%5%9895 kb6,1 k574242104011
Feb 2005711 4217 8,585326%7%2468 kb4,0 k389179895
Jan 2005612 3816 8,874626%5%4861 kb3,4 k334147784
Dec 20045 4 3315 8,677830%6%5453 kb3,3 k317146783
Nov 2004513 2510 9,285624%8%6740 kb2,5 k237102462
Oct 2004413 164 10,247425%6%5818 kb6967522342
Sep 20043 2 133 8,225515% 6611 kb2991420 32
Aug 2004311 93 4,453733%11%1116 kb4654133 91
Jul 2004211 63 4,891750%17%1415 kb4534127 91
Jun 20041   2  7,5   111 kb     1
May 20041   1  14   17,5 kb     1
Apr 20041   1  13   37,5 kb     1
Mar 20041   1  10   57,3 kb     1
Feb 20041   1  5   27,3 kb     1
Jan 20041   1  3   27,3 kb     1
Dec 200311  1  1   12,7 kb      
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternas

> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
The following table ranks this project in relation to projects in other languages with 1000+ articles
Jul 20148787111 96  202   134      251
Apr 201486100897796 100199   94      251
Jan 2014861061028993821032004333142976677746212173251
Oct 2013869977659485481964038146736878756311975251
Jul 201386111959193841251973940146636677746411873251
Apr 2013861188212093831622034252145986676747411872251
Jan 2013867367859181108206536314712768757214911768251
Oct 201287787281877912620758701487266746915011764251
Jul 20128993801028678133204577314711664716614511563251
Apr 2012917083968375132203577014512664716614510361251
Jan 2012917976858074102203566414211061706514310359251
Oct 201192848686797175204576214212559676414210459251
Jul 201193829199787172200536014011159646513810258251
Apr 201195929784777062197576614410060666213810458251
Jan 201197838066777165194599614510861666413710262251
Oct 201099748269777364189641071429464696613711563251
Jul 2010101808275807256184851241389870796813711769251
Apr 20109812090908174621829314714010771837113812372251
Jan 20101029398938578511781091601399178857914211981251
Oct 2009103107808290854117510915713710181898014711786251
Jul 2009106109949294944816710814713314193999416113298251
Apr 200910594879410410428164124150128116107112109169142112251
Jan 2009104131100132122140130151113136112163126126133176149125251
Oct 200810211296107122137107148124137114155128130133175151131250
Jul 20081061539911313514457137111126108120137140143180171141249
Apr 200811093114131165152111148148147145159147153157174170143249
Jan 200811983119134162155155143143142141155146154155168162142246
Oct 2007131142144132156149118141141139139161146152152164156144244
Jul 2007133142195125153146138134134133131178140149148155149141240
Apr 2007131111114105151143123130130129127140141148149148140138235
Jan 2007139124184125153145138123123123121150146154147147146131232
Oct 2006132110148118143134138116116116115164130140135138132124229
Jul 2006122130167109134124122106106106105135120131123122122115218
Apr 200610712316810712411812093939392123110117112113107103213
Jan 20069510510681110106106868686851011011041001039491195
Oct 200589991278410610098818181801379998941008986194
Jul 200581871078098929070707070105898685928481185
Apr 200581849775969585606060608796909210295106178
Jan 200576707562989876545454548598989310791135174
Oct 2004796564559710070515151517410210910212488145173
Jul 200482647451908759434343438289991158384115152
Apr 2004100   100      9187     136
Jan 200492   89      9472     123
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
 WikipedistasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikipedistas (usuários registrados)
A = Wikipedistas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikipedistas que editaram pelo menos dez vezes desde que chegaram
C = Wikipedistas que contribuíram cinco vezes ou mais este mês
D = Wikipedistas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Artigos que contêm pelo menos uma ligação interna e 200 caracteres de texto legível, não contando códigos wiki e html,
      ligações ocultas, etc.; títulos também não contam (outras colunas são baseadas no método oficial de contagem)
G = Novos artigos por dia no mês passado
H = Número médio de revisões por artigo
I = Tamanho médio dos artigos em bytes
J = Porcentagem de artigos com pelo menos 0,5 kb de texto legível (veja F)
K = Porcentagem de artigos com pelo menos 2 kb de texto legível (veja F)

Base de dados
L = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
M = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
N = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

O = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
P = Total de ligações para outras wikipédias
Q = Total de imagens apresentadas
R = Total de ligações para outros sítios
S = Total de páginas de redirecionamento

Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  2500  5  10  100  1000  10000  1  3  5  10  25  100  250  5  10  100  1  3  5  10  25  100  250  5  10  100 
Monthly counts for recent history of wiki
Aug 201437157663   1    14443211   235422     
Jul 20142913533   11   9422111   164321     
Jun 201431151173   11   11332111   13322      
May 2014471613862   11   1355521    229652     
Apr 20143715128541  22   1676531    29108441    
Mar 20143412107521  11   1375541    267443     
Feb 20142797532   221  1188711    217632     
Jan 2014331198632  331  9664411   2110763     
Dec 20133815107432  1    14976211   31107642    
Nov 201333131198431 111  1586641    4398742    
Oct 2013482215107631 1    17998721   3514107532   
Sep 201346191311641  11   14987411   3814752  21 
Aug 2013401613932   32   18973111   317521  221
Jul 201334129742   4211 18874211   358532  22 
Jun 20133617107631  322211997651    3511951  5  
May 20134619161063   4321 18988611   4312965  22 
Apr 2013491813941   5411 1955421 1  388542  43 
Mar 20135625201572   11832 208641111  612312822 841
Feb 2013532521181251  201741 23995311   6623149411531
Jan 201360272215931  24175  211296411   581612961 761
Dec 2012673527191163  29205  21119731111 8730201152294 
Nov 201252231712731  2520311208654  111821711622143 
Oct 20126129178431  271752 226553  11110830177311842
Sep 20125323148431  20134  228653  111842718731 21 
Aug 20126122147311  20142  1510663  111992917831 331
Jul 2012462516952   25158  2176432111195351693  741
Jun 201255241810851  20154  2411875311  106321996221031
May 201245221613942  23165  20108863    112311384211251
Apr 20124722131072   22173  24118551    903220883175 
Mar 20124318111061   23172  1910732     11537191031 32 
Feb 201251201511531  27162  2210663     91331893  62 
Jan 201261231913933  26215  1898541    1052619106  52 
Quarterly counts for entire history of wiki
Jul 20142913533   11   9422111   164321     
Apr 20143715128541  22   1676531    29108441    
Jan 2014331198632  331  9664411   2110763     
Oct 2013482215107631 1    17998721   3514107532   
Jul 201334129742   4211 18874211   358532  22 
Apr 2013491813941   5411 1955421 1  388542  43 
Jan 201360272215931  24175  211296411   581612961 761
Oct 20126129178431  271752 226553  11110830177311842
Jul 2012462516952   25158  2176432111195351693  741
Apr 20124722131072   22173  24118551    903220883175 
Jan 201261231913933  26215  1898541    1052619106  52 
Oct 20113417127332  28215  116642     86201131  97 
Jul 201143171083221 28194  1022111    8723134   41 
Apr 20113415964321 22164  74211     72221341  84 
Jan 2011511915119511 26194  1665411    10027181321 108 
Oct 201046201286521 19124  86322     8720151031 73 
Jul 2010552212119411 25183  137532     1032916102  63 
Apr 201031191096211 18144  92222     76271131  82 
Jan 20102912875211117122  136442     76211283  21 
Oct 200925131275321 20145  1065421    87231672  21 
Jul 2009231187421  17132  128663     1102921101     
Apr 20091910985211 1815   168651     1113120127  4  
Jan 20092311764   2115   96541     110361851  32 
Oct 200817107641   107   156321     97301571  3  
Jul 200814875311  991  148421     1383924831 2  
Apr 200887543   87   63321     1072514105  51 
Jan 2008128542   85   83332     118261572  1  
Oct 2007742     951  711       14641251372 21 
Jul 200752     4              1574024931 2  
Apr 2007854331   42   63111     15250251252 2  
Jan 20073      321  2         14741241341131 
Oct 200642111   1    2         147301672  11 
Jul 20063      21   1         141502171     
Apr 20063      111  1         101371791     
Jan 2006632111   11   521       12839241031 1  
Oct 20051           1         751772      
Jul 20054111    11   3         69231521     
Apr 200532111        32        57146311    
Jan 20053221         1         311021      
Oct 20044432         321       159741     
Jul 20042111         1         621       
Apr 20041                     2         
Jan 2004                      1      1  


Distribuição de edições de artigos por wikipedistas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...

Edições >=WikipedistasEdições total


36 wikipedistas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias

 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
30 dias
30 dias
30 dias
30 dias
Sushant savlaUC2 09,57822,0376Nov 05, 200821241,380---
DsvyasUC4 07,341736,66945Dec 13, 2007245295---
KartikMistryUC10 01,64817379576Jan 01, 2012972243--
Vyom25UC15 01,07924233Nov 17, 2011101710---
Akash96UC21 05293325-Jul 20, 2012771121--
RotlinkUC25+4413138--Nov 27, 2012641----
HaritoshUC28+833312214-Jan 28, 20135792---
Nizil ShahUC65+174359-Jun 30, 2008225261--
અમિતાભUC76+155311-Nov 04, 20132991---
संतोष दहिवळUC86+218423531Jan 24, 2013583----
Bhatt NandiniUC225+1691052-Jul 01, 20146063--
StrynUC270+32812-Jan 08, 2013599----
KatyareUC302+499751-Aug 21, 2012739----
Mehta GoutamUC348+276632-Jul 02, 20145963--
VimeshpandyaUC363+696542-Sep 19, 20101441----
JmikesmithUC495...44--Aug 30, 2014 ----
Vidyadhar YagnikUC625+24831--May 03, 2014119----
Pratik.narolaUC626+24931--May 12, 2014110----
Divyesh ChavadaUC631...33--Aug 04, 201426----
CoderzombieUC632...33--Aug 05, 20142511--
Jayesh kalsariyaUC633...33--Aug 19, 201411----
Jayambe77UC886...22--Aug 05, 201425----
VipuljnpatelUC887...22--Aug 07, 201423----
Husen Sipai PanchasiyaUC888...22--Aug 19, 201411----
Dhaval143UC889...22--Aug 28, 20142----
DrbhavinvasavaUC1557...11--Aug 04, 20142611--
JadukeyurUC1558...11--Aug 05, 201425----
BigBearLovesPandaUC1559...11--Aug 08, 201422----
WhatamIdoingUC1560...1171Aug 10, 201420----
Mustanseer SakerwalaUC1561...11--Aug 20, 201410----
SiddharthagajaUC1562...11--Aug 22, 20148----
Niraj030UC1563...11--Aug 24, 20146----
રામ માલદેUC1564...11--Aug 26, 20144----
YogendraUC1565...11--Aug 26, 20144----
SowaqoUC1566...11--Aug 30, 2014 ----
CharlikUC1567...11--Aug 30, 2014 ----


20 wikipedistas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

  Primeira ediçãoúltima edição
સતિષચંદ્રUC150,302Feb 15, 20082388Jun 01, 201490
Ashok modhvadiaUC37,790Aug 27, 20082194Jul 25, 201436
PSPatelUC53,836Apr 29, 20091949Dec 26, 2011978
Maharshi675UC62,664Sep 29, 20072527Sep 24, 2013340
વિહંગUC72,022Jun 30, 2012791Mar 03, 2014180
Harsh4101991UC81,750Jan 22, 2012951Dec 01, 2013272
Sam.lditeUC91,654Sep 15, 2012714Jun 07, 2013449
SpundunUC111,259Jul 21, 20043692May 01, 20072678
જીતેન્દ્રસિંહUC121,216Sep 14, 20082176Mar 10, 2014173
SunilUC131,129Mar 05, 20101639Aug 09, 2013386
TekinaUC141,081Jun 08, 20111179Jun 30, 2012791
મહાથીUC16986Sep 22, 2013342Feb 15, 2014196
DBhavsar709UC17735Nov 08, 2012660Aug 09, 2013386
Sanjay BalotiyaUC18597Apr 13, 20111235Apr 23, 2014129
JaishreeUC19568Feb 07, 20101665Jul 18, 20101504
Rangilo GujaratiUC20560Oct 17, 20111048Oct 03, 2013331
V dasUC22458Feb 20, 20101652Oct 29, 20101401
યોગેશ કવીશ્વરUC23446May 17, 2013470May 31, 201491
PranayUC24425May 15, 20111203Mar 13, 2012900
KsderasariUC26383Sep 02, 20101458Dec 25, 2013248


Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 16.228 edições foram feitas por usuários anônimos, de um total de 270.370 edições ( 6e %)

50 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
GubotUC137,993May 17, 20091931Apr 05, 2014147--
HarshBotUC215,947Sep 27, 2012702Nov 16, 2012652--
SamkbotUC312,482Nov 23, 2012645Jun 04, 2013452--
EmausBotUC48,767Jul 09, 20101513Jan 12, 2014230--
XqbotUC57,218Jan 19, 20092049May 06, 2014116--
Luckas-botUC65,872Nov 30, 20082099May 20, 2012832--
SieBotUC74,148Aug 18, 20072569Jan 25, 20111313--
AddbotUC84,064Mar 06, 2013542Aug 27, 2013368--
MerlIwBotUC93,335Apr 24, 20111224Aug 08, 2013387--
TXiKiBoTUC103,282Dec 12, 20062818Dec 20, 2012618--
WikitanvirBotUC112,324Oct 20, 20101410May 15, 2012837--
VolkovBotUC122,281Apr 20, 20072689Mar 04, 2013544--
ZéroBotUC132,274Oct 16, 20101414Mar 06, 2013542--
MelancholieBotUC142,226Apr 03, 20082340Nov 28, 20091736--
EscarbotUC152,070Jul 01, 20062982Feb 07, 2013569--
ArthurBotUC161,603Jan 07, 20092061Oct 07, 2012692--
ChuispastonBotUC171,377Dec 14, 20101355Apr 28, 2012854--
FoxBotUC181,337Oct 01, 20091794Feb 04, 2012938--
JAnDbotUC191,199Nov 08, 20062852Jul 03, 2013423--
Thijs!botUC201,092Dec 12, 20062818Jul 30, 2012761--
KamikazeBotUC211,055Jul 04, 20101518Jan 26, 2013581--
RedBotUC22948Sep 01, 20101459Aug 21, 2012739--
TjBotUC23792Jun 01, 20101551Mar 06, 2013542--
LegobotUC24651Mar 11, 2013537Apr 02, 2013515--
JotterbotUC25630Jul 27, 20091860Jan 22, 2013585--
AlexbotUC26623Jan 30, 20082404Aug 23, 20111103--
CommonsDelinkerUC27603May 31, 20072648Aug 17, 201413--
HRoestBotUC28589Jun 19, 20101533Mar 05, 2013543--
Idioma-botUC29586Sep 05, 20082185Mar 03, 2013545--
LaaknorBotUC30555Jul 27, 20082225Mar 07, 2013541--
JackieBotUC31542Oct 21, 20101409Jun 25, 201466--
YurikBotUC32534Jan 07, 20063157Aug 25, 20062927--
Ripchip BotUC33534Mar 10, 20111269Feb 17, 2012925--
PtbotgourouUC34521Sep 29, 20082161Mar 05, 2013543--
SynthebotUC35519Jun 07, 20082275Jan 31, 2013576--
AlleborgoBotUC36515Oct 28, 20072498Dec 03, 20082096--
Dinamik-botUC37494Feb 07, 20101665Dec 23, 2012615--
Movses-botUC38460Dec 21, 20101348Mar 18, 2012895--
RubinbotUC39452Apr 06, 20091972Mar 04, 2013544--
AvicBotUC40410Jun 20, 20111167Dec 09, 2012629--
YFdyh-botUC41379Jun 20, 2012801Feb 24, 2013552--
AvocatoBotUC42374Oct 21, 20111044Feb 27, 2013549--
DragonBotUC43348Oct 19, 20072507Feb 04, 2013572--
ZorrobotUC44343Sep 07, 20082183Sep 06, 2012723--
VagobotUC45341Sep 20, 20111075Sep 06, 2012723--
MastiBotUC46335Nov 29, 20091735Feb 28, 2013548--
MystBotUC47334May 16, 20101567Mar 03, 2012910--
CarsracBotUC48333Nov 17, 20082112Mar 01, 2013547--
PipepBotUC49326Aug 20, 20072567Jun 09, 20082273--
RobbotUC50325Jul 08, 20053340Jan 03, 2013604--


Artigos que contêm pelo menos uma ligação interna e .. caracteres de texto legível, não contando códigos wiki e html,
ligações ocultas, etc.; títulos também não contam  (excluindo páginas de redirecionamento)

 < 32 ch< 64 ch< 128 ch< 256 ch< 512 ch< 1 k ch< 2 k ch< 4 k ch< 8 k ch< 16 k ch< 32 k ch< 64 k ch
Oct 20100.1%0.3%1.1%9.8%48.6%89.6%93.5%95.9%97.0%97.8%98.6%99.6%
Sep 20100.1%0.3%1.2%10.2%50.9%89.8%93.8%96.2%97.2%97.9%98.7%99.6%
Aug 20100.1%0.3%1.2%10.4%55.5%90.1%94.0%96.3%97.3%98.0%98.7%99.5%
Jul 20100.2%0.4%1.3%11.2%59.1%90.6%94.4%96.7%97.7%98.3%98.9%99.6%
Jun 20100.2%0.4%1.3%11.6%62.4%90.9%94.7%96.9%97.9%98.5%99.0%99.7%
May 20100.2%0.4%1.4%12.2%66.6%91.3%95.0%97.2%98.2%98.8%99.2%99.8%
Apr 20100.2%0.4%1.4%12.5%73.2%91.4%95.0%97.2%98.2%98.8%99.2%99.8%
Mar 20100.2%0.4%1.4%13.0%78.6%91.3%94.9%97.1%98.1%98.6%99.0%99.6%
Feb 20100.2%0.4%1.5%14.2%80.0%91.3%95.0%97.3%98.3%98.8%99.2%99.7%
Jan 20100.2%0.4%1.6%14.8%80.5%91.4%95.0%97.3%98.3%98.8%99.2%99.6%
Dec 20090.2%0.5%2.4%15.9%81.4%91.5%95.1%97.4%98.5%99.0%99.4%99.8%
Nov 20090.2%0.5%3.4%16.4%81.0%91.3%95.1%97.5%98.6%99.1%99.5%99.9%
Oct 20090.2%0.5%3.6%17.7%80.3%90.9%94.8%97.2%98.4%98.9%99.3%99.7%
Sep 20090.3%0.7%5.2%21.3%80.0%91.1%95.1%97.4%98.6%99.1%99.5%99.8%
Aug 20090.3%0.7%5.7%23.9%78.9%90.9%95.1%97.4%98.6%99.1%99.5%99.8%
Jul 20090.4%0.9%6.3%26.8%77.4%90.5%95.0%97.4%98.7%99.2%99.6%99.9%
Jun 20090.4%0.9%6.7%30.2%76.0%90.0%94.7%97.3%98.5%99.0%99.4%99.8%
May 20090.5%1.1%7.4%33.5%76.5%90.3%95.0%97.8%99.1%99.7%100.0%100.0%
Apr 20090.5%1.2%8.2%38.8%81.0%89.4%94.3%97.3%98.7%99.3%99.6%99.8%
Mar 20090.8%1.9%12.3%57.4%76.8%85.8%92.7%96.7%98.8%99.5%99.9%100.0%
Feb 20091.0%2.3%14.7%62.7%74.4%84.2%91.7%96.2%98.6%99.4%99.7%99.9%
Jan 20091.0%2.4%15.2%62.9%74.8%84.3%91.7%96.2%98.7%99.5%99.8%100.0%
Dec 20081.1%2.5%15.5%64.1%75.8%85.2%92.3%96.6%99.0%99.7%100.0%100.0%
Nov 20081.1%2.5%15.6%64.8%76.4%85.6%92.6%96.6%98.8%99.5%99.9%100.0%
Oct 20081.1%2.6%16.0%66.6%77.9%86.6%92.9%96.8%98.9%99.7%100.0%100.0%
Sep 20081.2%2.7%16.4%68.4%79.7%88.0%93.9%97.2%98.9%99.6%99.9%100.0%
Aug 20081.2%2.8%17.0%68.6%79.8%88.1%94.1%97.5%99.1%99.8%100.0%100.0%
Jul 20081.8%4.1%22.2%65.1%75.6%85.5%93.1%96.9%98.8%99.6%100.0%100.0%
Jun 20082.4%5.4%30.5%55.7%69.3%81.6%91.3%96.0%98.6%99.4%100.0%100.0%
May 20083.1%6.6%20.6%47.0%63.1%78.1%89.2%95.0%98.1%99.0%99.7%99.8%
Apr 20086.2%12.9%17.4%31.6%54.7%72.4%85.8%92.9%97.0%98.7%99.8%100.0%
Mar 20086.8%14.3%19.7%34.6%58.7%73.4%86.1%92.7%96.6%98.3%99.8%100.0%
Feb 20089.0%17.6%21.1%36.8%60.2%73.2%85.7%92.4%96.6%98.2%99.8%100.0%
Jan 20088.7%17.1%19.9%34.7%58.1%71.8%84.5%91.9%96.2%98.2%99.7%100.0%
Dec 20078.8%17.6%20.2%35.5%59.9%72.9%85.9%92.6%96.5%98.3%99.9%100.0%
Nov 20079.3%17.8%20.7%36.6%61.2%73.9%86.6%92.7%96.4%98.3%99.9%100.0%
Oct 20079.3%17.8%20.7%36.9%61.3%74.0%86.7%92.5%96.2%98.1%99.7%100.0%
Sep 20070.3%2.8%6.0%25.2%54.5%69.3%84.4%91.0%95.4%97.6%99.5%99.8%
Aug 20070.3%2.5%6.0%25.2%55.2%69.9%84.3%91.3%95.5%97.7%99.6%99.9%
Jul 20070.3%2.5%6.0%25.2%55.9%70.3%84.4%91.4%95.6%97.8%99.7%100.0%
Jun 20070.6%2.8%6.3%26.0%56.3%70.6%84.3%91.3%95.4%97.6%99.5%99.8%
May 20070.6%3.2%6.7%26.7%56.7%70.2%84.1%91.2%95.4%97.7%99.6%99.9%
Apr 20070.7%3.4%6.8%27.5%58.0%72.2%86.4%93.2%96.6%98.3%100.0%100.0%
Mar 20070.4%3.5%9.2%31.0%59.7%73.9%88.1%95.4%98.1%98.5%100.0%100.0%
Feb 20071.3%2.6%7.2%29.0%58.0%73.1%87.4%95.4%97.9%98.3%100.0%100.0%
Jan 20072.2%3.5%8.4%30.8%61.7%76.0%89.0%95.7%97.5%97.9%99.7%99.7%
Dec 20062.3%3.7%8.7%31.2%62.4%75.7%89.0%95.9%97.7%98.2%100.0%100.0%
Nov 20061.9%2.4%6.7%29.7%61.8%76.2%89.1%95.8%97.7%98.2%100.0%100.0%
Oct 20061.4%1.9%6.2%29.2%61.7%76.1%89.0%95.7%97.6%98.1%100.0%100.0%
Sep 20061.0%1.5%6.4%31.8%63.0%78.1%88.8%95.6%97.6%98.1%100.0%100.0%
Aug 20061.0%1.5%5.9%31.9%62.8%78.5%88.8%95.7%97.7%98.2%100.0%100.0%
Jul 20061.0%1.5%5.9%31.9%62.8%78.5%88.8%95.7%97.7%98.2%100.0%100.0%
Jun 20061.0%1.5%6.9%32.4%62.8%78.5%88.8%95.7%97.7%98.2%100.0%100.0%
May 20060.5%1.0%6.4%32.1%62.8%78.6%89.0%95.4%97.4%97.9%99.9%99.9%
Apr 20060.5%1.0%6.4%32.1%63.3%79.1%90.0%95.4%97.4%97.9%99.9%99.9%
Mar 20060.5%1.0%6.0%32.2%63.4%79.2%90.1%95.5%97.5%98.0%100.0%100.0%
Feb 20060.5%1.0%6.0%32.2%62.9%79.2%90.1%95.5%97.5%98.0%100.0%100.0%
Jan 20060.5%1.0%6.0%32.4%62.7%79.1%90.5%95.5%97.5%98.0%100.0%100.0%
Dec 20050.5%1.6%6.5%33.3%64.4%79.2%89.6%94.5%96.7%97.2%99.9%99.9%
Nov 20050.7%2.1%8.3%27.5%58.3%74.1%87.8%93.3%96.0%96.7%100.0%100.0%
Oct 20050.7%2.8%7.0%26.4%58.3%73.6%87.5%93.1%95.9%96.6%100.0%100.0%
Sep 20050.7%2.1%6.3%25.9%58.1%73.5%87.5%93.1%95.9%96.6%100.0%100.0%
Aug 20050.7%2.1%6.3%25.9%58.1%73.5%87.5%93.1%95.9%96.6%100.0%100.0%
Jul 20050.7%2.1%6.3%25.9%58.1%73.5%87.5%93.1%95.9%96.6%100.0%100.0%
Jun 20050.7%2.1%6.3%25.9%58.1%73.5%87.5%93.1%95.9%96.6%100.0%100.0%
May 20051.1%4.3%11.7%26.6%52.1%68.1%86.2%93.6%95.7%97.8%99.9%99.9%
Apr 20050.0%4.6%9.2%27.7%58.5%75.4%93.9%97.0%98.5%98.5%100.0%100.0%
Mar 20053.6%9.0%14.4%35.8%66.2%80.5%94.8%98.4%100.0%100.0%100.0%100.0%
Feb 20053.2%9.7%22.6%45.2%64.6%80.7%90.4%96.9%100.0%100.0%100.0%100.0%
Jan 20053.3%10.0%23.3%46.6%66.6%83.3%93.3%96.6%99.9%99.9%99.9%99.9%
Dec 20043.6%10.7%25.0%46.4%64.3%82.2%92.9%96.5%100.0%100.0%100.0%100.0%
Nov 20045.0%15.0%30.0%45.0%70.0%85.0%90.0%95.0%100.0%100.0%100.0%100.0%
Oct 200418.2%45.5%45.5%54.6%63.7%91.0%91.0%100.0%100.0%100.0%100.0%100.0%
Sep 200425.0%37.5%37.5%50.0%75.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
Aug 200437.5%37.5%37.5%50.0%62.5%87.5%87.5%100.0%100.0%100.0%100.0%100.0%
Jul 20040.0%0.0%0.0%20.0%40.0%80.0%80.0%100.0%100.0%100.0%100.0%100.0%


Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.

See also Category Overview Complete

categorizados 1
Aug 201427 k1,6 k8332941014,2 k111,1 k       1525342191
Jul 201427 k1,6 k7952941014,2 k111,1 k       1525342191
Jun 201427 k1,6 k7602941014,2 k111,1 k       1525342191
May 201427 k1,6 k7392941004,2 k111,1 k       1525342191
Apr 201427 k1,6 k708294994,2 k111,1 k       1525342191
Mar 201427 k1,6 k673293994,2 k101,1 k       1525342181
Feb 201427 k1,6 k616293994,2 k91,1 k      5011525342181
Jan 201427 k1,6 k595293994,1 k91,1 k      12121525342181
Dec 201327 k1,5 k572293994,1 k91,1 k      17931525342181
Nov 201326 k1,5 k557293984,1 k91,1 k      29461525342181
Oct 201325 k1,5 k545292984,1 k91,0 k      29981525342171
Sep 201324 k1,5 k518292984,0 k91,0 k      10401525342171
Aug 201324 k1,5 k497292984,0 k91,0 k      5241525342171
Jul 201324 k1,5 k476292984,0 k91,0 k      5091525342171
Jun 201324 k1,4 k442292984,0 k91,0 k      8231525342171
May 201324 k1,4 k416292984,0 k9992      7771525342171
Apr 201324 k1,4 k380292984,0 k9978      4061525342171
Mar 201324 k1,4 k332292974,0 k9977      8671525342171
Feb 201324 k1,4 k303292973,9 k9968      15191525342171
Jan 201324 k1,3 k279292973,9 k9955      11431525342171
Dec 201224 k1,3 k242292953,9 k9950      22601525342171
Nov 201224 k1,3 k212291893,7 k8899      11491525242171
Oct 201224 k1,2 k200291873,6 k8865      8251525242171
Sep 201223 k1,2 k189291843,5 k8854      8361525242171
Aug 201223 k1,2 k156290843,5 k8846      5231525242161
Jul 201223 k1,2 k141290843,4 k8845      6931525242161
Jun 201223 k1,1 k138290833,3 k8836      13781525242161
May 201223 k1,1 k136290773,0 k8829      13261525242161
Apr 201223 k1,1 k133290772,7 k6819      6971525242161
Mar 201223 k1,1 k131286772,5 k6811      48515252 2161
Feb 201223 k1,0 k128278772,5 k6807      87115250 2101
Jan 201223 k1,0 k124278772,4 k6803      158215250 2101
Dec 201123 k965122275772,4 k6770      168015247 2101
Nov 201123 k946122272772,2 k6728      122815244 2101
Oct 201123 k911121272772,2 k6718      149415244 2101
Sep 201122 k894118268772,2 k6709      152215241 291
Aug 201122 k874115268772,2 k6698      107915241 291
Jul 201122 k858115267772,2 k6695      171315241 281
Jun 201121 k836115267772,1 k5691      173715241 281
May 201121 k820113262772,1 k5687      203315236 281
Apr 201121 k803111257772,1 k5681      204715231 281
Mar 201120 k786111255772,1 k5671      223915229 281
Feb 201120 k772111250772,1 k5664      153815224 281
Jan 201119 k754111244772,1 k5660      246115218 281
Dec 201019 k735109237772,0 k5625      199615211 281
Nov 201018 k723109235772,0 k5618      228715209 281
Oct 201018 k710109235772,0 k5608      225215209 281
Sep 201018 k697105235771,9 k5593      261215209 281
Aug 201017 k683105235771,9 k5584      291515209 281
Jul 201016 k649103231771,9 k5566      199115206 28 
Jun 201016 k635102223771,8 k5548      240015198 28 
May 201016 k602102220771,8 k5534      292315196 18 
Apr 201015 k589102217771,8 k5506      253015193 18 
Mar 201015 k577102215771,8 k5491      368314192 18 
Feb 201014 k551101191771,8 k5473      302314168 18 
Jan 201013 k537101184771,8 k5414      306514161 18 
Dec 200912 k515100182771,7 k5396      267414159 18 
Nov 200912 k505100178771,7 k5377      214614155 18 
Oct 200911 k489100177771,7 k5366      215414154 18 
Sep 200910,0 k485100177771,7 k5349      240014154 18 
Aug 20098,7 k470100177771,6 k5304      187614154 18 
Jul 20097,7 k44699173771,6 k5268      128414150 18 
Jun 20096,9 k42898153771,6 k5246      127214130 18 
May 20096,2 k41898142771,6 k5227      140914119 18 
Apr 20095,4 k41096139771,5 k5202      221914116 18 
Mar 20093,5 k39496120771,5 k5152      10891497 18 
Feb 20092,9 k38593115771,5 k5120      3251492 18 
Jan 20092,8 k37192115771,5 k5119      3261492 18 
Dec 20082,8 k35889112771,5 k5115      2331489 18 
Nov 20082,8 k34889112771,5 k5114      3341489 18 
Oct 20082,7 k3258894771,4 k5108      3971473 16 
Sep 20082,7 k3028682771,4 k599      4291462 15 
Aug 20082,6 k2898666771,4 k482      937357 15 
Jul 20081,9 k2748663771,4 k478      708354 15 
Jun 20081,4 k2558561771,4 k477      614352 15 
May 20081,2 k2318561771,4 k372      845352 15 
Apr 20086682198454771,3 k372      221345 15 
Mar 20086152128454771,3 k370      301345 15 
Feb 20085711988444761,3 k357      192335 15 
Jan 20085381938343741,3 k357      174235 15 
Dec 20075251848137741,3 k357      147230 14 
Nov 20075081787932741,2 k357      37225 14 
Oct 20074951737829741,2 k357      25222 14 
Sep 20074441617126741,1 k351      28219 14 
Aug 20074291576820741,1 k351      11114 14 
Jul 20074251496520741,1 k251      14114 14 
Jun 20074241456420741,1 k251      51114 14 
May 20074191406415741,1 k249      9119 14 
Apr 20074021356315731,0 k248      20819 14 
Mar 2007352124551219986137      23916 14 
Feb 2007323114511018922136      9514 14 
Jan 200730510450618912136      41  14 
Dec 200630210250518596136      151   4 
Nov 20062979550418588136      2    4 
Oct 20062969450418574136      33    4 
Sep 20062919150418573136      3    4 
Aug 20062878849418572136      3    4 
Jul 20062848149418568136      4    4 
Jun 20062827849418566135      7    4 
May 20062807749418553135      13    4 
Apr 20062787349418552135      4    4 
Mar 20062767249418544135      2    4 
Feb 20062727049418536135      8    4 
Jan 20062716849418459135      179    4 
Dec 20052434545418371 30      123    4 
Nov 20051934445417317 29      13    4 
Oct 20051904045417315 28      2    4 
Sep 20051893845417310 28      7    4 
Aug 20051873645417309 28      7    4 
Jul 20051873443417303 28      17    4 
Jun 20051873042417299 28      445    4 
May 20051092931317244 23      285    3 
Apr 2005772629217148 20      62    2 
Mar 200570222621757 13      94    2 
Feb 200547212521743 2      16    2 
Jan 200542172521733 2      27    2 
Dec 200436162421732 2      45    2 
Nov 200427142221628 2      52    2 
Oct 200418132021621 2      38    2 
Sep 200415915 1613 1      35      
Aug 200410611 155               
Jul 2004749 155               
Jun 2004348 153               
May 2004228 103               
Apr 2004224 63               
Mar 20042 3 62               
Feb 20042 1 62               
Jan 20042   62               
Dec 20031    1               


Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons



For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

Jan 2004: 1 1 HomePage

Mar 2004: 1 1 મુખપૃષ્ઠ

Apr 2004: 1 1 મુખપૃષ્ઠ

May 2004: 1 1 મુખપૃષ્ઠ

Jul 2004: 1 2 મુખપૃષ્ઠ , 2 1 પ્રતિજ્ઞા પત્ર

Aug 2004: 1 1 મહાત્મા ગાંધી

Sep 2004: 1 2 ગુજરાત , 2 1 Main Page

Oct 2004: 1 3 જાળસ્થળો ની યાદી , 2 2 ભારત , 3 2 મીરાંબાઈ

Nov 2004: 1 3 જાળસ્થળો ની યાદી , 2 3 મુખપૃષ્ઠ , 3 2 પાકિસ્તાન , 4 2 ૧૯૯૩ , 5 1 દયારામ

Dec 2004: 1 3 જાળસ્થળો ની યાદી , 2 2 બિહાર , 3 2 વર્જિન એટલાંટિક , 4 1 વેલિંગ્ટન

Jan 2005: 1 2 આસામ

Feb 2005: 1 2 ગૉડફ્રે હારૉલ્ડ હાર્ડિ , 2 2 અમદાવાદ

Mar 2005: 1 2 ઐશ્વર્યા રાય , 2 2 જગદીશચંદ્ર બોઝ , 3 2 આશિત દેસાઈ , 4 2 નરેન્દ્ર મોદી , 5 2 મીરાંબાઈ , 6 1 અબૅલ

Apr 2005: 1 2 મહાત્મા ગાંધી , 2 2 મુખપૃષ્ઠ , 3 1 ભારત

May 2005: 1 3 ભુજ , 2 3 વડોદરા , 3 2 ચંદ્ર , 4 2 કાર્બન , 5 2 મોહનદાસ કરમચંદ ગાંધી , 6 2 સૂર્યમંડળ , 7 2 ભારતના વડાપ્રધાન , 8 2 ભારતના રાષ્ટ્રપતિ , 9 1 ભારત

Jun 2005: 1 3 નક્ષત્ર , 2 3 અમદાવાદ , 3 2 ભારત , 4 2 છત્તીસગઢ , 5 2 મધ્ય પ્રદેશ , 6 2 મહારાષ્ટ્ર , 7 2 બળ , 8 2 દળ , 9 2 તરંગલંબાઇ , 10 2 વિદ્યુત-ચુંબકીય તરંગો , 11 2 ગંગા નદી , 12 2 ક્ષ-કિરણો , 13 2 ધૂમકેતુ , 14 2 ઉષ્મા

Jul 2005: 1 1 ધૂમકેતુ

Aug 2005: 1 1 ભૂમિતિ

Sep 2005: 1 1 ખગોળ શાસ્ત્ર

Oct 2005: 1 1 જન ગણ મન

Nov 2005: 1 1 ઇમરાન ખાન

Dec 2005: 1 2 ચલાલા (તા. ધારી) , 2 2 લોકશાહી , 3 1 ભારત

Jan 2006: 1 3 કેટલાક જાણીતા ગુજરાતીઓ , 2 2 ગાંધીનગર , 3 2 સાબરકાંઠા જિલ્લો , 4 2 ચલાલા (તા. ધારી) , 5 2 ઇમરાન ખાન , 6 2 હિન્દુ-અરેબીક અંકો , 7 2 અમિતાભ બચ્ચન , 8 2 ગુજરાત , 9 1 ભારત

Feb 2006: 1 2 સુરત , 2 1 રોટલી

Mar 2006: 1 1 ઇસ્‍લામ

Apr 2006: 1 1 ભારત

May 2006: 1 2 કનૈયાલાલ મુનશી , 2 1 હીન્દી

Jun 2006: 1 1 રમેશ પારેખ

Jul 2006: 1 1 પાલનપુર

Aug 2006: 1 1 ગાંધી આશ્રમ

Sep 2006: 1 1 સત્ય ઇસુ દેવળ

Oct 2006: 1 2 રાની મુખર્જી , 2 1 યાક

Nov 2006: 1 1 ચીન

Dec 2006: 1 1 નેપાલ સ્કાઉટ

Jan 2007: 1 1 મુખપૃષ્ઠ/જુનું-૧

Feb 2007: 1 2 ભારતના ભાગલા , 2 2 ચાણક્ય , 3 2 રામાયણ , 4 1 શ્રીમદ્ ભગવદ્ ગીતા

Mar 2007: 1 3 મુખપૃષ્ઠ/જુનું-૧ , 2 2 વાદળ , 3 2 સંસ્કૃત ભાષા , 4 2 કુરોવ , 5 2 વેગમાન સંરક્ષણનો નિયમ , 6 2 કાઠમંડુ , 7 2 મૌર્ય વંશ , 8 2 રામાયણ , 9 2 વંદે માતરમ્ , 10 1 ભારત

Apr 2007: 1 3 સરદાર પટેલ , 2 3 સુભાષચંદ્ર બોઝ , 3 3 સ્વામી વિવેકાનંદ , 4 3 અકબર , 5 3 અશોક , 6 3 આર્યભટ્ટ , 7 3 કાલિદાસ , 8 2 ભારત , 9 2 કરમસદ , 10 2 રાજા રવિ વર્મા

May 2007: 1 2 સરદાર પટેલ , 2 2 મહાભારત , 3 2 સુરત , 4 2 અમદાવાદ , 5 1 યજ્ઞ

Jun 2007: 1 2 ભારત , 2 2 સંયુક્ત રાજ્ય અમેરિકા , 3 2 જામનગર , 4 2 ગુજરાત

Jul 2007: 1 1 ભરૂચ

Aug 2007: 1 1 સંસ્કૃત

Sep 2007: 1 1 રવિશંકર રાવળ

Oct 2007: 1 1 લોયાધામ

Nov 2007: 1 1 ઝૂલતા મિનારા

Dec 2007: 1 4 ગુજરાત , 2 2 વડનગર , 3 1 ચૈતન્ય મહાપ્રભુ

Jan 2008: 1 5 ગુજરાત , 2 3 સત્ય ઇસુ દેવળ , 3 2 બાઇબલ , 4 2 ઇસ્કોન , 5 2 દાળ , 6 2 અમેરિકન ગૅંગ્સ્ટર , 7 1 ભારત

Feb 2008: 1 2 ભારત , 2 2 સંગણક , 3 2 વડોદરા જિલ્લો , 4 2 રાજકોટ જિલ્લો , 5 2 રણોત્સવ , 6 2 ડેબિયન , 7 2 મરાઠી લોકો , 8 2 બ્રિટીશ એશિયન , 9 2 અમરેલી , 10 2 વઘઇ

Mar 2008: 1 3 નરસિંહ મહેતા , 2 2 ઉમરગામ , 3 2 વ્યારા , 4 2 આદિવાસી , 5 2 ઝઘડીયા , 6 2 તિથલ , 7 2 નારેશ્વર , 8 2 હાલોલ તાલુકો , 9 2 ઉનાઇ , 10 2 પંચમહાલ જિલ્લો , 11 2 બીગરી , 12 2 મઢી , 13 2 ભગવદ્ ગીતા , 14 2 લોયા , 15 2 ઇશ્વર પેટલીકર , 16 2 કલાપી , 17 2 દલપતરામ , 18 2 મનસુખલાલ ઝવેરી , 19 2 કે. કા. શાસ્ત્રી , 20 2 નાનાભાઈ ભટ્ટ , 21 2 બકુલ ત્રિપાઠી , 22 2 ભગવતીકુમાર શર્મા , 23 2 તારક મહેતા , 24 2 નિર્મિશ ઠાકર , 25 2 ધીરુબેન પટેલ

Apr 2008: 1 3 હિંદુ ધર્મ , 2 2 વીર નર્મદ દક્ષિણ ગુજરાત યુનિવર્સિટી, સુરત , 3 2 રામનવમી , 4 2 હનુમાન ચાલીસા , 5 2 ત્રિકમ સાહેબ , 6 2 રંગ અવધૂત , 7 2 દાસી જીવણ , 8 2 ભિક્ષુ અખંડાનંદ , 9 2 શ્રીમદ્ રાજચંદ્ર , 10 2 પૂ. મોટા , 11 2 પુનિત મહારાજ , 12 2 પૃથિવીવલ્લભ , 13 2 સત્યના પ્રયોગો અથવા આત્મકથા , 14 2 જ્યોતીન્દ્ર હ. દવે , 15 2 સાત પગલાં આકાશમાં , 16 1 ખીજડીયા

May 2008: 1 5 બગસરા , 2 3 ગણેશ , 3 3 શિવ , 4 3 ઓખાહરણ , 5 3 સી. વી. રામન , 6 3 વીણા , 7 3 વલ્લભાચાર્ય , 8 3 નેલ્સન મંડેલા , 9 3 સિહોર , 10 3 હિંદુ ધર્મ , 11 3 અમદાવાદ , 12 2 આઇઝેક ન્યુટન , 13 2 માઉન્ટ આબુ , 14 2 મિર્ઝા ગ઼ાલિબ , 15 2 રતન તાતા , 16 2 સોનીપત જિલ્લો , 17 2 રોહતક જિલ્લો , 18 2 સિરસા જિલ્લો , 19 2 કરનાલ જિલ્લો , 20 2 ફરીદાબાદ જિલ્લો , 21 2 યમુનાનગર જિલ્લો , 22 2 પાનીપત જિલ્લો , 23 2 અંબાલા જિલ્લો , 24 2 કરસનભાઇ પટેલ , 25 2 પશ્ચિમી સિંહભૂમ જિલ્લો

Jun 2008: 1 4 આસારામ બાપુ , 2 3 બાલાસિનોર ગોળ ભાવસાર સમાજ , 3 3 અંજા જિલ્લો , 4 3 લખનૌ , 5 3 ઇટાનગર , 6 3 ઓખાહરણ , 7 3 ઝવેરચંદ મેઘાણી , 8 3 સુરત , 9 2 ગાઝિયાબાદ , 10 2 નેધરલેંડ , 11 2 બ્લૉગ , 12 2 હંસ , 13 2 અત્રિ , 14 2 ભારદ્વાજ , 15 2 અગસ્ત્ય , 16 2 કુર્નૂલ જિલ્લો , 17 2 પશ્ચિમ ગોદાવરી જિલ્લો , 18 2 પૂર્વ ગોદાવરી જિલ્લો , 19 2 નાલગોંડા જિલ્લો , 20 2 નેલ્લોર જિલ્લો , 21 2 પ્રકાસમ જિલ્લો , 22 2 રંગારેડ્ડી જિલ્લો , 23 2 ચિત્તૂર જિલ્લો , 24 1 બસ્તી

Jul 2008: 1 3 ઉલૂપી , 2 3 ભીષ્મ , 3 3 શાંતનુ , 4 3 પુરી જિલ્લો , 5 3 નવોદય વિદ્યાલય , 6 3 ગુજરાત , 7 2 ઉત્તરા , 8 2 અંબાલિકા , 9 2 અંબિકા , 10 2 વિચિત્રવિર્ય , 11 2 નાગેશ્વર , 12 2 અર્જુન , 13 2 ચિત્રાંગદા , 14 2 ચિત્રાંગદ , 15 2 ત્ર્યંબકેશ્વર , 16 2 તમિલ ભાષા , 17 2 કારેલું , 18 2 દૂધી , 19 2 સફરજન , 20 2 રીંગણ , 21 2 જાન્યુઆરી ૩૦ , 22 2 સિરોહી , 23 2 સવાઇ માધોપુર , 24 2 સિકર , 25 1 સિમન્ટેક વૅબ ક્રૉલીંગ

Aug 2008: 1 4 જુનાગઢ , 2 3 પાલનપુર , 3 2 આસો , 4 2 અષાઢ , 5 2 ડિસેમ્બર , 6 2 નવેમ્બર , 7 2 ઓક્ટોબર , 8 2 સપ્ટેમ્બર , 9 2 ઓગસ્ટ , 10 2 જુલાઇ , 11 2 જૂન , 12 2 મે , 13 2 એપ્રિલ , 14 2 માર્ચ , 15 2 ફેબ્રુઆરી , 16 2 જાન્યુઆરી , 17 2 મૈથિલી ભાષા , 18 2 કસ્તુરબા , 19 2 સંજય , 20 2 ભવભૂતિ , 21 2 ગયા , 22 2 ભોજપુરી ભાષા , 23 1 ભેંસાણ, જૂનાગઢ જિલ્લો

Sep 2008: 1 3 મિથુન રાશી , 2 3 વૃષભ રાશી , 3 3 મેષ રાશી , 4 3 રાશી , 5 3 શ્રી નાથજીદાદાની જગ્યા - દાણીધાર , 6 3 જામનગર જિલ્લો , 7 2 મહાબળેશ્વર , 8 2 કલિંગનુ યુધ્ધ , 9 2 કૃષ્ણા નદી , 10 2 ભક્ત કવિઓ , 11 2 કાળું કાણું , 12 2 મીન રાશી , 13 2 કુંભ રાશી , 14 2 વૃશ્ચિક રાશી , 15 2 કન્યા રાશી , 16 2 સિંહ રાશી , 17 2 કર્ક રાશી , 18 2 ગજહ મદ , 19 2 વેદવ્યાસ , 20 2 ખેડા , 21 2 વિક્રમ સંવત , 22 2 સાતારા જિલ્લો , 23 2 ડૉ. ભીમરાવ રામજી આંબેડકર , 24 2 ઉપનિષદ , 25 1 પાટણ, મહારાષ્ટ્ર

Oct 2008: 1 3 ગુજરાત , 2 2 ધન તેરસ , 3 2 પ્રાથમિક સારવાર , 4 2 દીપ , 5 2 પંચાંગ , 6 2 વાઘ બારસ , 7 2 નોબેલ પારિતોષિક વડે સન્માનીત મહિલાઓ , 8 2 ભારતનાં વિશ્વ ધરોહર સ્થળો , 9 2 દશેરા , 10 2 રામચકલી-પીળી ચોટલી , 11 2 દિવાળી , 12 2 ભીષ્મ , 13 2 શનિદેવ , 14 2 ધોરાજી , 15 2 ગુજરાતના મુખ્યમંત્રીઓ , 16 2 પોરબંદર જિલ્લો , 17 2 મહેસાણા , 18 2 અશોક , 19 2 ગિરનાર , 20 2 બનાસકાંઠા જિલ્લો , 21 2 રાજકોટ , 22 1 નોબેલ પારિતોષિક વડે સન્માનીત મહાનુભાવો

Nov 2008: 1 3 આદિલ મન્સુરી , 2 3 ભરૂચ , 3 2 સર પ્રભાશંકર પટ્ટણી , 4 2 કાર્બ્યુરેટર , 5 2 અચલેશ્વર , 6 2 ચિત્રવિચિત્રનો મેળો , 7 2 ઉપગ્રહ પ્રક્ષેપણ યાન , 8 2 ગીતા પ્રેસ , 9 2 પ્રમબનન , 10 2 વિસાવાડા , 11 2 ભગત સિંહ , 12 2 અભિમન્યુ , 13 2 શ્રી નાથજીદાદાની જગ્યા - દાણીધાર , 14 2 અબુલ ફઝલ

Dec 2008: 1 3 દેવાયત પંડિત , 2 3 મદીના , 3 3 મક્કા , 4 3 નવા સુદાસણા , 5 3 રાવણ , 6 3 નરસિંહ મહેતા , 7 2 લીરબાઈ , 8 2 હમીરજી ગોહિલ , 9 2 ઝીંઝરી , 10 2 કેરી , 11 2 કમળ , 12 2 વડ , 13 2 માણાવદર , 14 2 અંશુમાન ગાયકવાડ , 15 2 દ્વારકા , 16 2 ભીષ્મ , 17 2 ગાયત્રી , 18 2 શિવ , 19 2 કુતિયાણા , 20 2 અંજીર , 21 2 દાસી જીવણ , 22 2 ભારત , 23 2 હેમચંદ્રાચાર્ય , 24 2 ઇસ્લામ , 25 1 ખરોિલ

Jan 2009: 1 4 કનકાઈ-ગીર , 2 3 પ્રબોધિની એકાદશી , 3 3 જુનાગઢ , 4 2 અડાલજની વાવ , 5 2 કાળાપાણ , 6 2 મકર સંક્રાંતિ , 7 2 કામદા એકાદશી , 8 2 પાપમોચિની એકાદશી , 9 2 આમલકી એકાદશી , 10 2 જયા એકાદશી , 11 2 ષટતિલા એકાદશી , 12 2 પુત્રદા એકાદશી , 13 2 સફલા એકાદશી , 14 2 મોક્ષદા એકાદશી , 15 2 ઉત્પતિ એકાદશી , 16 2 બહાદુર શાહ ઝફર , 17 2 એકાદશી વ્રત , 18 2 આગ્રાનો કિલ્લો , 19 2 ગુરુત્વાકર્ષણ , 20 1 કે.લાલ

Feb 2009: 1 3 અવાજની ઝડપ , 2 3 તારાપુર , 3 3 વડ , 4 3 નોબેલ પારિતોષિક વડે સન્માનીત મહિલાઓ , 5 3 સ્વામી વિવેકાનંદ , 6 2 અપ્પુઘર , 7 2 વિશ્વની સાત મોટી ભૂલો , 8 2 અંબિકા નદી , 9 2 નવનીત મદ્રાસી , 10 2 વલંદી, વલસાડ તાલુકો , 11 2 વાંકલ, વલસાડ તાલુકો , 12 2 વેજલપોર, વલસાડ તાલુકો , 13 2 અબ્રામા, વલસાડ તાલુકો , 14 2 સારંગપુર, વલસાડ તાલુકો , 15 2 કુબેર , 16 2 ભગવદ્ગોમંડલ , 17 2 ઝાઝરકા , 18 2 બાગેફિરદોશ કમ્યુનિટિ હોલ,સી.ટી.એમ. , 19 2 કે.લાલ , 20 2 એરિસ્ટોટલ , 21 1 વાંઝણા

Mar 2009: 1 4 ક્ષત્રિય , 2 3 બોપલ , 3 3 જાન્યુઆરી ૧ , 4 3 માર્ચ ૨૪ , 5 3 વિશ્વ જળ દિન , 6 3 સારાવાક ગુફા , 7 3 નાસિક , 8 3 નથુરામ ગોડસે , 9 2 માર્ચ ૨૩ , 10 2 સિદ્ધગિરિ ગ્રામજીવન સંગ્રહાલય , 11 2 માર્ચ ૨૧ , 12 2 ઓગસ્ટ ૧૫ , 13 2 વિશ્વ ક્ષય દિન , 14 2 આંતરરાષ્ટ્રીય મહિલા દિન , 15 2 માર્ચ ૧૨ , 16 2 માર્ચ ૮ , 17 2 માર્ચ ૨૦ , 18 2 માર્ચ ૨૨ , 19 2 ઔદિચ્ય બ્રાહ્મણ , 20 2 પ્રહલાદ , 21 2 શનિવાર , 22 2 શુક્રવાર , 23 1 સાદડવેરા

Apr 2009: 1 4 રાજકોટ , 2 3 ગીઝાનો મહાન પિરામિડ , 3 3 પિરામિડ , 4 2 વૈશાખ સુદ ૬ , 5 2 એપ્રિલ ૨૭ , 6 2 ચૈત્ર વદ ૦)) , 7 2 પ્રમુખ સ્વામી , 8 2 એપ્રિલ ૨૨ , 9 2 એપ્રિલ ૨૦ , 10 2 એપ્રિલ ૨૧ , 11 2 કુતુબ મિનાર , 12 2 એપ્રિલ ૧૪ , 13 2 ખારાઘોડા , 14 2 પીઝાનો ઢળતો મિનારો , 15 2 સરદાર પટેલ યુનિવર્સિટી , 16 2 એપ્રિલ ૧૦ , 17 2 એપ્રિલ ૯ , 18 2 એપ્રિલ ૮ , 19 2 આજી નદી , 20 2 ચૈત્ર સુદ ૧૧ , 21 2 ચૈત્ર સુદ ૯ , 22 2 એપ્રિલ ૨ , 23 2 એપ્રિલ ફૂલ્સ ડે , 24 2 ભીચરી , 25 2 મંગળના ચંદ્રો

May 2009: 1 4 ગુજરાત , 2 3 બોલપેન , 3 2 ઉપાસની મહારાજ , 4 2 ૧૦ (અંક) , 5 2 ૧૦૨ (અંક) , 6 2 આંબેડકર નેશનલ કોંગ્રેસ , 7 2 કાચબો , 8 2 સંચળ , 9 2 મે ૧૧ , 10 2 મે ૯ , 11 2 ગુજરાતના અભયારણ્યો તથા રાષ્ટ્રીય ઉદ્યાનો , 12 2 મે ૬ , 13 2 આંતરરાષ્ટ્રીય પરીચારિકા દિવસ , 14 2 આંતરરાષ્ટ્રીય દાયણ દિવસ , 15 2 મે ૫ , 16 2 મે ૪ , 17 2 મે ૨ , 18 2 મે ૧ , 19 2 શક્તિ દર્શનમ્ , 20 2 વિરસા મુંડા , 21 2 કઠોર (કામરેજ) , 22 2 રાજપૂત , 23 2 કોલોસીયમ , 24 2 ભગવદ્ગોમંડલ , 25 2 હઠ યોગ

Jun 2009: 1 3 ઇજનેરી , 2 3 ટેક્લોબેન , 3 3 બાહુબલી , 4 3 માઉન્ટ એવરેસ્ટ , 5 3 કંથારીયા (તા.ભરૂચ) , 6 3 કેરી , 7 3 શ્રી નાથજીદાદાની જગ્યા - દાણીધાર , 8 3 વેરાવળ , 9 3 ખોડિયાર , 10 3 નવકાર મંત્ર , 11 2 અષાઢ સુદ ૬ , 12 2 વાર , 13 2 માઇકલ જેકસન , 14 2 વૈશ્વિક સ્થળનિર્ધારણ પ્રણાલી , 15 2 અષાઢ સુદ ૨ , 16 2 બેસતુ વર્ષ , 17 2 પાંડુરંગ શાસ્ત્રી આઠવલે , 18 2 જૂન ૧૩ , 19 2 શુકલતીર્થ , 20 2 બિલ ગેટ્સ , 21 2 છાણીયું ખાતર , 22 2 જેઠ વદ ૪ , 23 2 જેઠ સુદ ૧૫ , 24 2 નગોદ (કામરેજ) , 25 2 નેત્રંગ

Jul 2009: 1 5 ગાંઠીયા , 2 4 બાહુબલી , 3 4 શ્રી નિષ્કલંક મહાદેવ કોળિયાક , 4 3 ઉરુગ્વે , 5 3 અષાઢ સુદ ૧૧ , 6 3 હાલોલ તાલુકો , 7 3 ગુજરાતી સાહિત્યકારો , 8 2 અમરસિંહ ચૌધરી , 9 2 શ્રાવણ સુદ ૭ , 10 2 શ્રાવણ સુદ ૬ , 11 2 શ્રાવણ સુદ ૫ , 12 2 સુરીનામ , 13 2 ભીખુદાન ગઢવી , 14 2 સાબરમતી આશ્રમ , 15 2 જુલાઇ ૨૧ , 16 2 મહાત્મા ગાંધી સેતુ (બિહાર) , 17 2 ગુજરાતી ભોજન , 18 2 અષાઢ વદ ૯ , 19 2 બાજરો , 20 2 અષાઢ સુદ ૧૫ , 21 2 અષાઢ સુદ ૧૩ , 22 2 બાર્ટન પુસ્તકાલય , 23 2 બાંદ્રા-વરલી સમુદ્રસેતુ , 24 2 એપ્રિલ ફૂલ્સ ડે , 25 2 ખરોલિ

Aug 2009: 1 7 રોઝવા (તા. છોટાઉદેપુર) , 2 6 રોઝકુવા (તા. છોટાઉદેપુર) , 3 6 વલ્લભભાઈ પટેલ , 4 6 તુલસીદાસ , 5 5 રાણીખેડા , 6 5 ઓળી આંબા (તા. છોટાઉદેપુર) , 7 5 નાના રામપુરા (તા. છોટાઉદેપુર) , 8 5 સીમળ ફળીયા (તા. છોટાઉદેપુર) , 9 5 રૂનવાડ (તા. છોટાઉદેપુર) , 10 5 બ્લેકપૂલનો ટાવર , 11 5 કચ્છ જિલ્લો , 12 4 સીંગળાજા , 13 4 રીંછવેલ (તા. છોટાઉદેપુર) , 14 4 રાયસીંગપુરા (હરવાંટ) , 15 4 પુનીયાવાંટ , 16 4 પોટીયા (તા. છોટાઉદેપુર) , 17 4 પીપલેજ (તા. છોટાઉદેપુર) , 18 4 ઓઢી (તા. છોટાઉદેપુર) , 19 4 ઓડી (તા. છોટાઉદેપુર) , 20 4 નવાગામ (તા. છોટાઉદેપુર) , 21 4 નાની સાધલી , 22 4 સનાડા (તા. છોટાઉદેપુર) , 23 4 સીલોદ (તા. છોટાઉદેપુર) , 24 4 પંડિત રામ નારાયણ , 25 4 વિશ્વ કાચબા દિવસ

Sep 2009: 1 3 એલિફન્ટાની ગુફાઓ , 2 3 તૌરાત , 3 3 સિંગાપુર , 4 3 નબીપુર , 5 3 વામકુક્ષિ , 6 3 ઈમાન , 7 3 માઉન્ટ એવરેસ્ટ , 8 3 નમાજ઼ , 9 3 અરવિંદ આશ્રમ , 10 3 ઇસ્લામ , 11 2 હઠીસિંહનાં દેરા , 12 2 વિદ્યા બાલન , 13 2 આસો સુદ ૮ , 14 2 અર્ધનારીશ્વર , 15 2 આકાશગંગા , 16 2 કચ્છનો અખાત , 17 2 વચનામૃત , 18 2 દુર્વાસા ઋષિ , 19 2 મનોવિજ્ઞાન , 20 2 એસોટેરિક (અમુક વ્યક્તિઓ જ સમજી શકે તેવું) , 21 2 પ્રારંભિક જાહેર ભરણું (આઈપીઓ) , 22 2 બાળગીતો , 23 2 કવ્વાલી , 24 2 અઝેરબીજાન , 25 2 આર્મેનિયા

Oct 2009: 1 4 રોટલી , 2 3 ધારી , 3 3 ગીગાસણ , 4 3 મનુષ્ય ગૌરવદિન , 5 3 સ્વામિનારાયણ સંપ્રદાય , 6 3 ભારતનાં વિશ્વ ધરોહર સ્થળો , 7 3 ભારત , 8 2 લોદરા , 9 2 મહાબલીપુરમ , 10 2 હમ્પી , 11 2 કારતક સુદ ૧૦ , 12 2 છત્રપતિ શિવાજી ટર્મિનસ , 13 2 લોહલંગરી આશ્રમ (ગોંડલ) , 14 2 છપિયા , 15 2 ફૉકલેન્ડ ટાપુઓ , 16 2 બોલીવિયા , 17 2 સ્વિત્ઝરલેન્ડ , 18 2 નિત્યાનંદ સ્વામી , 19 2 ઓક્ટોબર ૧૨ , 20 2 ઓક્ટોબર ૧૧ , 21 2 મોલ્દોવા , 22 2 વાસદ (તા. આણંદ) , 23 2 શરદ પૂર્ણિમા , 24 2 આસો સુદ ૧૫ , 25 2 લક્ઝેમ્બર્ગ

Nov 2009: 1 3 મહાબોધિ મંદિર , 2 3 વાયુ , 3 3 મીરાંબાઈ , 4 2 ગળધરા , 5 2 ચંદ્ર યાન , 6 2 કારતક વદ ૦)) , 7 2 જિહાદ , 8 2 કારતક વદ ૭ , 9 2 દશરથ , 10 2 ઇલોરાની ગુફાઓ , 11 2 ભારતની પર્વતીય રેલ્વે , 12 2 પત્તાદકલ , 13 2 ભીમ બેટકાની ગુફાઓ , 14 2 મહાબલીપુરમ , 15 2 ખજુરાહો , 16 2 નદીસર (તા. ગોધરા) , 17 2 જૈન ધર્મ , 18 2 વેડચ (તા.જંબુસર) , 19 2 દીવા (તા.અંકલેશ્વર) , 20 2 મોહણી(તા.ચોર્યાસી) , 21 2 મૈથિલીશરણ ગુપ્ત , 22 2 ધામણ , 23 2 ચામુંડા , 24 2 ભારતનાં વિશ્વ ધરોહર સ્થળો , 25 2 મહેમદાવાદ

Dec 2009: 1 3 ઉસ્તીયા (તા. અબડાસા) , 2 3 ગીગાસણ , 3 3 નારગોલ , 4 3 અબ્દુલ કલામ , 5 3 જંબુસર , 6 2 પક્ષી , 7 2 ક્રિકેટનું મેદાન , 8 2 ડિસેમ્બર ૨૫ , 9 2 મનોવિષ્લેષણ , 10 2 ડિસેમ્બર ૧૯ , 11 2 કૃષિ , 12 2 તોરણીયા , 13 2 જળ , 14 2 ઓપન શોર્ટેસ્ટ પાથ ફર્સ્ટ , 15 2 અનિદ્રા , 16 2 ડિસેમ્બર ૧૭ , 17 2 સ્લમડોગ મિલિયોનેર , 18 2 ફિઝિયોથેરાપી , 19 2 પીપળો , 20 2 રૂપિયાપુરા , 21 2 નંદાદેવી રાષ્ટ્રીય ઉદ્યાન , 22 2 માનસ રાષ્ટ્રીય ઉદ્યાન , 23 2 કેવલાદેવ રાષ્ટ્રીય ઉદ્યાન , 24 2 કાઝીરંગા રાષ્ટ્રીય ઉદ્યાન , 25 2 અજંતાની ગુફાઓ

Jan 2010: 1 3 આમેરનો કિલ્લો , 2 3 ઇએમઇ મંદિર , 3 3 લહેરીપુરા દરવાજા , 4 3 સયાજી બાગ (કમાટી બાગ) , 5 3 હવા મહેલ , 6 3 વાંસદા રાષ્ટ્રીય ઉદ્યાન , 7 3 દરિયાઈ રાષ્ટ્રીય ઉદ્યાન અને અભયારણ્ય , 8 3 ક્રિસમસ દ્વીપ , 9 3 સુએઝ નહેર , 10 3 જય વસાવડા , 11 2 કુંભ મેળો , 12 2 મહારાજા ફતેહસિંહ મ્યુજીયમ , 13 2 અશોક કુરજીભાઇ પટેલ , 14 2 ચેતેશ્વર પુજારા , 15 2 જલ મહેલ , 16 2 વિશ્વામિત્રી નદી , 17 2 નજર બાગ મહેલ , 18 2 કિર્તિ મંદિર, વડોદરા , 19 2 સરદાર પટેલ પ્લેનેટેરીયમ , 20 2 ઈંડિયા ગેટ , 21 2 રણછોડરાય , 22 2 પ્રાણી , 23 2 રોક ગાર્ડન , 24 2 સુવર્ણ મંદિર, અમૃતસર , 25 2 જાન્યુઆરી ૧૫

Feb 2010: 1 4 તુલસી , 2 4 ગુજરાત , 3 3 ગળતેશ્વર , 4 3 સંપ્રદાય , 5 3 પાનકી , 6 3 રણછોડરાય , 7 3 ભારત , 8 3 ડાકોર , 9 3 મહાભારત , 10 2 આતંકવાદ , 11 2 અસોસિએશન ફુટબોલ , 12 2 પ્રાગજી ભગત , 13 2 સેવપુરી , 14 2 સયાજી સરોવર , 15 2 કોથમીર-મરચાંની ચટણી , 16 2 ઈદડાં , 17 2 જે. બી. વોટસન , 18 2 પંડોળી , 19 2 મકબરા (હજીરા) , 20 2 ઝકાત , 21 2 ખંડેરાવ માર્કેટ , 22 2 માંડવી દરવાજા , 23 2 લાલબાગ , 24 2 શેર (તા. માંડલ) , 25 2 વડાપાવ

Mar 2010: 1 3 બટાકાં , 2 3 મોગલબારા , 3 3 શેર (તા. માંડલ) , 4 2 એના નિકોલ સ્મિથ , 5 2 મહાકાળેશ્વર જ્યોતિર્લિંગ , 6 2 અરનાથજી દેવ , 7 2 ચૈત્ર સુદ ૫ , 8 2 થુમ્બા , 9 2 ફાગણ વદ ૧૪ , 10 2 ટૅડગાફળિયુ(ઉમરપાડા) , 11 2 બ્રાહ્મણી નદી , 12 2 બળદ ગાડું , 13 2 જીરું , 14 2 કણભા (તા.કરજણ) , 15 2 શક્કરીયાં , 16 2 ડાંગર , 17 2 કામલી , 18 2 ખારા રૂપાલ , 19 2 ધાંધુસણ , 20 2 દેદીયાસણ , 21 2 આખજ , 22 2 દીવાનપુરા-અલીયાસ-અપાપુરા , 23 2 મેમદપુરા , 24 2 વીરસોડા , 25 2 હાડવી

Apr 2010: 1 3 લીંભોઈ , 2 3 ખારવા , 3 3 વલ્લભ વિદ્યાનગર , 4 3 સ્વામિનારાયણ સંપ્રદાય , 5 3 ઉચ્છલ , 6 3 સુરત , 7 2 બેગુની , 8 2 વિક્રમાદિત્ય , 9 2 ખીચડી , 10 2 કફોત્પાદક ગ્રંથિ , 11 2 રવાનો શીરો , 12 2 દૂધપાક , 13 2 સંદેશ , 14 2 દિવ્ય ભાસ્કર , 15 2 બરડીયા (તા. વિસાવદર) , 16 2 ભાગળ , 17 2 સુરતી બોલી , 18 2 ગામીત બોલી , 19 2 બોલી , 20 2 ભક્તિવેદાંત બુક ટ્રસ્ટ , 21 2 એ.સી. ભક્તિવેદાંત સ્વામી પ્રભુપાદ , 22 2 માર્કની લખેલી સુવાર્તા , 23 2 કડવા પાટીદારોની પેટા જ્ઞાતિ , 24 2 હરિલાલ ઉપાધ્યાય , 25 2 નરસિંહ

May 2010: 1 3 સમરસ ગ્રામ પંચાયત , 2 3 ચેવડો , 3 3 ગૂગલ અનુવાદ , 4 3 કચ્છ જિલ્લો , 5 3 સુરત , 6 2 પરોઠા , 7 2 મિસળ , 8 2 એચએએલ તેજસ , 9 2 રોહિણી , 10 2 કૃષ્ણદાસ કવિરાજ , 11 2 ચૈતન્ય ચરિતામૃત , 12 2 જયપતાકા સ્વામી , 13 2 સંન્યાસ , 14 2 ભક્તિબલ્લભ તીર્થ ગોસ્વામી મહારાજ , 15 2 શુભા મુદ્ગલ , 16 2 તમાકુની ખળી , 17 2 થાળી , 18 2 જપમાળા , 19 2 બ્લેક સબાથ , 20 2 લોકનાથ સ્વામી મહારાજ , 21 2 ગોપાલ કૃષ્ણ ગોસ્વામી , 22 2 રાધાનાથ સ્વામી , 23 2 ડો. જીવરાજ નારાયણ મહેતા , 24 2 ગોપીપુરા , 25 2 લિંભોઇ

Jun 2010: 1 3 મગની દાળનો શીરો , 2 3 ટાવર ઓફ લંડન , 3 3 કુલેર , 4 3 પેંડા , 5 3 દુધીનો હલવો , 6 3 વાવ , 7 3 ઇએમઇ મંદિર , 8 3 રતનપુર (કાંટડી) , 9 3 ગુજરાતી ભોજન , 10 2 અગ્રસેન , 11 2 પાલિ ભાષા , 12 2 ફૂલવડી , 13 2 પૌંઆ , 14 2 સમોસા , 15 2 શરીર વૃદ્ધી અંતઃસ્ત્રાવ , 16 2 કચોરી , 17 2 પંડિત દીનદયાળ પેટ્રોલિયમ યુનિવર્સિટી , 18 2 ગોળ , 19 2 ગુર્જીય્ફ , 20 2 ભગવદ્ દર્શન , 21 2 લેધરબેક કાચબો , 22 2 મેઘ , 23 2 સૈફ અલી ખાન , 24 2 સેવ , 25 2 બરફી

Jul 2010: 1 3 રંગાવલી નદી , 2 3 દેવ-ચાંદની નદી , 3 3 આંકડો (વનસ્પતિ) , 4 3 ઝુલાસણ (તા. કડી) , 5 3 હરેલા ઉત્સવ , 6 3 અશોક ચક્ર , 7 3 આદમ અને હવા , 8 3 અમૃતા શેરગિલ , 9 3 રૂપાયતન આશ્રમશાળા , 10 3 યતી (હિમ માનવ) , 11 3 અગસ્ત્ય , 12 3 ગુજરાતી સાહિત્યકારો , 13 2 રુથ , 14 2 મીંઢોળા નદી , 15 2 ઇબ્રાહિમ , 16 2 કનોડા (તા. બહુચરાજી) , 17 2 ઇંગ્લેન્ડના એલિઝાબેથ પ્રથમ , 18 2 રવિ શંકર , 19 2 ધૌમ્ય , 20 2 શૃંગ , 21 2 ફ્રેન્ક લેમ્પાર્ડ , 22 2 રાપ્તી પ્રાંત (નેપાળ) , 23 2 ધવલાગિરી પ્રાંત (નેપાળ) , 24 2 લુમ્બિની પ્રાંત (નેપાળ) , 25 2 ગંડકી પ્રાંત (નેપાળ)

Aug 2010: 1 4 શીખ , 2 4 દાલ બાટી , 3 4 મનમોહન સિંહ , 4 3 દૂરદર્શન , 5 3 ક્રોપ સર્કલ , 6 3 માછલીઘર , 7 3 શિક્ષક , 8 3 ઊંડ નદી , 9 3 દઢવાવ (તા. વિજયનગર) , 10 3 ભડીયાદ (તા. ધંધુકા) , 11 3 પૂ. મોટા , 12 3 કૃષ્ણ , 13 2 પિયાસણ (બતક) , 14 2 આન્દ્રે અગાસી , 15 2 મેનહટન , 16 2 ઑક્સફર્ડ વિશ્વવિદ્યાલય , 17 2 મહુડો , 18 2 જામીનગીરીઓ , 19 2 ભારતીય વાનગીઓ , 20 2 હ્યુસ્ટન , 21 2 ઇન્ડિયાના , 22 2 એમિથિસ્ટ , 23 2 ન્યાયશાસ્ત્ર , 24 2 ફોર્બ્સ , 25 2 બ્રુસ સ્પ્રિન્ગસ્ટીન

Sep 2010: 1 6 જાપાન , 2 4 ટિમ્બક્ટુ , 3 4 એ. આર. રહેમાન , 4 3 સોનલવા , 5 3 સ્ટેનફોર્ડ યુનિવર્સિટી , 6 3 વાળ ખરવા , 7 3 જયોર્જ સોરોસ , 8 3 નર્ક , 9 3 ચેસ્ટર કાર્લસન , 10 3 સોલોમન , 11 3 પાણી , 12 3 સરઢવ (તા. ગાંધીનગર) , 13 3 યુ.કે. પોસ્ટકોડ્સ , 14 3 ઓક્લાહોમા , 15 3 ૧૯૬૨નું ભારત-ચીન યુદ્ધ , 16 3 ચેરાપુંજી , 17 3 પાટણ , 18 3 ગુજરાતી , 19 2 કાંડુ (શરીર) , 20 2 એબીએન એમ્રો , 21 2 રાહુલ બજાજ , 22 2 સ્થાનકવાસી , 23 2 અન્ના કુર્નિકોવા , 24 2 વિરમપુર (તા. અમીરગઢ) , 25 2 ધ પ્રોડિજિ

Oct 2010: 1 3 એર ઈન્ડિયા ફ્લાઇટ ૧૮૨ , 2 3 કોર્ન , 3 3 ગ્રીક મૂળાક્ષરો , 4 3 ધનતેરશ , 5 3 પીરોજી માખીમાર , 6 3 દિવાળી , 7 3 માળીયા હાટીના , 8 3 મહાત્મા ગાંધી , 9 2 લાઓત્સે , 10 2 સિમા ગુઆંગ , 11 2 શાલીગ્રામ , 12 2 સીમા સુરક્ષા દળ , 13 2 પહાડિયા જનજાતિ , 14 2 શૈલી , 15 2 પીડોફિલિયા (બાળ યૌનશોષણ) , 16 2 હુઆંગ ઝીયાન-ફાન , 17 2 હરિવંશ , 18 2 સિમા કીઆન , 19 2 ડોનાલ્ડ ડક , 20 2 મિનેપોલિસ , 21 2 એલિસ ઇન ચેઇન્સ , 22 2 કેન્સાસ , 23 2 એલન શીયરર , 24 2 બજરંગ દળ , 25 2 સંચય

Nov 2010: 1 3 પર્યાયોક્તિ , 2 3 કેસ્પિયન સમુદ્ર , 3 3 ઘડિયાલ , 4 3 આહિર , 5 2 કાતરા (ઈયળ) , 6 2 પોર્ટલેન્ડ, ઑરેગોન , 7 2 ચિત્રકૂટ ધામ , 8 2 પરસ્પરોપગ્રહો જીવાનામ્ , 9 2 સંસ્કૃતિ , 10 2 થોર , 11 2 ચિત્તભ્રમણા , 12 2 બ્લૂઝ , 13 2 સત્રીયા નૃત્ય , 14 2 પેટન્ટ , 15 2 સિટીગ્રુપ , 16 2 કપડાં , 17 2 નિવસન તંત્ર , 18 2 મદ્યાર્ક યુક્ત પીણું , 19 2 એશિયાઈ રમતોત્સવ , 20 2 એશિયન રમતોત્સવ ૨૦૧૦ , 21 2 કાળા મરી , 22 2 સિસ્કો , 23 2 કુપોષણ , 24 2 અનુકૂલન , 25 2 કાળો સમુદ્ર

Dec 2010: 1 3 પેન્શન , 2 3 મડાણા ડાંગીયા (તા. પાલનપુર) , 3 3 વિલવણીકરણ , 4 3 સુવર્ણ માનક , 5 3 ફેડએક્સ , 6 3 વિંધ્યાચલ , 7 3 સૂર્યમંદિર, મોઢેરા , 8 3 વચનામૃત , 9 3 કૃષ્ણ વિવર , 10 3 પાલનપુર , 11 3 ચીન , 12 2 ઊન , 13 2 વિષ્ણુ સહસ્રનામ , 14 2 વાયરલેસ સુરક્ષા , 15 2 જળ શુદ્ધિકરણ , 16 2 સ્વચ્છતા , 17 2 હથિયારો , 18 2 વિટામિન બી૬ , 19 2 મેરેથોન , 20 2 ટ્યૂલિપ , 21 2 ઓર્લાન્ડો, ફ્લોરિડા , 22 2 કૅટરિના કૈફ , 23 2 કનિષ્ક , 24 2 યુનિલિવર , 25 2 કોલંબિયા, દક્ષિણ કેરોલિના

Jan 2011: 1 5 પ્રાથમિક શાળા , 2 4 ડી. ડી. કૌશામ્બી , 3 3 એસ. એમ. કૃષ્ણ , 4 3 મકડાલા (તા. દિયોદર) , 5 3 જુલિયન અસાંજે , 6 3 ગોળવી (તા. દિયોદર) , 7 3 ખારાખોડા (તા. થરાદ) , 8 3 ઉમરેઠ , 9 3 દસ્ક્રોઇ , 10 3 હિંદુ ધર્મ , 11 3 સ્વામિનારાયણ , 12 3 ભારત , 13 3 સુરત , 14 2 અર્થીંગ , 15 2 વિદ્યુતજનીન , 16 2 ચુંબકીયક્ષેત્ર , 17 2 મડકરી નાયક , 18 2 કિરણ મઝુમદાર-શો , 19 2 ગિનિ પિગ , 20 2 યુનાઇટેડ સ્ટેટ્સ આર્મી , 21 2 સંજીવ કુમાર , 22 2 તમિલનાડુનો ઈતિહાસ , 23 2 સર્વમિત્ર સિકરી , 24 2 એમપીથ્રી , 25 2 ચીરોડા (રાજપરા)

Feb 2011: 1 4 સાલ્ઝબર્ગ , 2 4 મેઘપુર , 3 4 નરેન્દ્ર મોદી , 4 3 પ્રણવ મુખર્જી , 5 3 મૃણાલ સેન , 6 3 સામાજિક સાહસિકતા , 7 3 મોહમ્મદ રફી , 8 3 યુનિક આઇડેન્ટિફિકેશન નંબર , 9 3 ૩જી , 10 3 સ્વયં-સહાયક જૂથ (નાણાં વ્યવસ્થા) , 11 3 નિરદ સી. ચૌધુરી , 12 3 બિરજુ મહારાજ , 13 3 અપર્ણા સેન , 14 3 ૨-જી સ્પેક્ટ્રમ કૌભાંડ , 15 3 મેજર ડિપ્રેસિવ ડિસઓર્ડર , 16 3 દ્વિસંગી તારો , 17 3 ઈન્ટરનેટ એક્ટીવિઝમ (ચળવળ) , 18 3 મુનસર તલાવ, વિરમગામ , 19 3 નોર્ધન આયર્લેન્ડ , 20 3 રજકો , 21 3 માઇક્રોસોફ્ટ ઓફિસ ૨૦૦૭ , 22 3 ઈન્સીડ , 23 3 મકડાલા (તા. દિયોદર) , 24 3 કોદરામ (તા. વડગામ) , 25 3 રક્ત

Mar 2011: 1 4 ઍલન ટ્યુરિંગ , 2 3 યશવંત સિન્હા , 3 3 જાણદી (તા. થરાદ) , 4 3 ધારોલી (તા.ઝઘડીયા) , 5 3 કકવાડીદાંતી , 6 3 બાલાસિનોર , 7 3 પદમડુંગરી , 8 3 રાજકોટ , 9 2 એસ્સાર ગ્રુપ , 10 2 લૅરી પેજ , 11 2 ભારતીય ઇસ્પાત પ્રાધિકરણ લિમિટેડ , 12 2 બ્રાયન લારા , 13 2 ગૅરી કિર્સ્ટન , 14 2 જામા મસ્જિદ, દિલ્હી , 15 2 ભારતનું સર્વોચ્ચ ન્યાયાલય , 16 2 એન્ડ્રુ કાર્નેગી , 17 2 રૅનબૅક્સી લેબોરેટરીઝ લિમિટેડ , 18 2 આર. કે. નારાયણ , 19 2 હિન્દુસ્તાન પેટ્રોલિયમ , 20 2 ટેક મહિન્દ્રા , 21 2 લાલા લાજપતરાય , 22 2 ટાટા ટી , 23 2 વિરપુર (તા. જેતપુર) , 24 2 ભારતીય સંસદ , 25 2 બૌદ્ધ ગુફાઓ, ખંભાલીડા

Apr 2011: 1 3 હિલેરી ક્લિન્ટન , 2 3 શ્રીમદ્ રાજચંદ્રજી , 3 3 કાનજી સ્વામી , 4 3 તારંગા હિલ , 5 3 બાષ્પોત્સર્જન , 6 3 સાકરિયા (તા. મોડાસા) , 7 3 સાંકલી (તા. ગોધરા) , 8 3 રફાળા,તા.રાજકોટ , 9 3 ઇસરો , 10 3 ઈન્દ્રા નૂયી , 11 3 સુરેન્દ્રનગર જિલ્લો , 12 3 વડોદરા , 13 2 સેર્ગેઈ બ્રિન , 14 2 અળવી (વનસ્પતિ) , 15 2 રાઈતું , 16 2 પાલમપુર , 17 2 ઓનલાઈન વિજ્ઞાપન , 18 2 સેમસંગ , 19 2 એસ.ડી. બર્મન , 20 2 ખાંડવપ્રસ્થ , 21 2 બાલોતા (તા.હાંસોટ) , 22 2 અણ્ણા હઝારે , 23 2 મસૂરી , 24 2 તરબૂચ , 25 2 પ્રભાતદેવજી

May 2011: 1 3 હર્ષદ , 2 3 ગાંધવી (તા. કલ્યાણપુર) , 3 3 ગોરાણા (તા. કલ્યાણપુર) , 4 3 આશિયાવદર (તા. કલ્યાણપુર) , 5 3 હોલો , 6 3 કતાર (અરબસ્તાન) , 7 3 શ્વેતા નંદા , 8 3 દાસી જીવણ , 9 3 નરસિંહ મહેતા , 10 2 જેપુર (તા. કલ્યાણપુર) , 11 2 પટેલકા (તા. કલ્યાણપુર) , 12 2 લાંબા (તા. કલ્યાણપુર) , 13 2 રાણ (તા. કલ્યાણપુર) , 14 2 રાણપરડા (તા. કલ્યાણપુર) , 15 2 નગડિયા (તા. કલ્યાણપુર) , 16 2 હનુમાનધાર , 17 2 બારિયાધાર (તા. કલ્યાણપુર) , 18 2 જામ રાવલ (તા. કલ્યાણપુર) , 19 2 સુર્યાવદર (તા. કલ્યાણપુર) , 20 2 ટંકારિયા (તા. કલ્યાણપુર) , 21 2 ભાટિયા (તા. કલ્યાણપુર) , 22 2 ડાંગરવડ (તા. કલ્યાણપુર) , 23 2 નાણાકીય વર્ષ , 24 2 ચાઇનીઝ ભાષા , 25 2 સ્વાઝીલેન્ડ

Jun 2011: 1 3 પડાણા (તા. લાલપુર) , 2 3 ફિંગર ઇલેવન , 3 3 પ્રભાશંકર માસ્તર , 4 3 સ્પેન , 5 3 ઝવેરચંદ મેઘાણી , 6 2 નરગીસ , 7 2 ઇન્ટેલ કોર્પોરેશન , 8 2 નાઈટ્સ ટેમ્પ્લર , 9 2 હાથીના પગ તળે દેહાંતદંડ , 10 2 વિકેટ કીપર , 11 2 મહાશ્વેતા દેવી , 12 2 હલવો , 13 2 ભારતમાં પરીવહન , 14 2 રફેલ નડાલ , 15 2 એલર્જી , 16 2 દિગીશ મહેતા , 17 2 હીમોફીલિયા , 18 2 હૃદયસ્તંભતા , 19 2 હૃદયરોગનો હુમલો , 20 2 બાંયધરી (વોરંટી) , 21 2 પ્રિફર્ડ સ્ટોક , 22 2 હર્ષદ (તા. કલ્યાણપુર) , 23 2 ચાર્લ્સ લુસિઅન બોનાપાર્ટ , 24 2 ભારતીય ઓલિમ્પિક સંઘ , 25 2 ઝડપી ગોલંદાજી

Jul 2011: 1 2 પલસદરી (જિ. રાયગઢ) , 2 2 પદ્મનાભસ્વામી મંદિર , 3 2 બલરાજ સહાની , 4 2 દેરડી (તા. ગોંડલ) , 5 2 લાભશંકર ઠાકર , 6 2 અડપોદરા , 7 2 સાયરા (તા. મોડાસા) , 8 2 કંબોયા (તા. ઇડર) , 9 2 થુવાવી , 10 2 બ્રાઝિલ , 11 2 ઉદય મર્ચંટ , 12 2 હળવદ , 13 2 કાલાવડ , 14 2 ભીસ્યા , 15 2 વડનગર , 16 2 નર્મદ , 17 2 ભાવનગર , 18 1 રામફળ

Aug 2011: 1 4 જગદ્ગુરુ રામભદ્રાચાર્ય , 2 2 શરબત , 3 2 માથક (તા. હળવદ) , 4 2 ચુરાચાંદપુર , 5 2 આર્ય સમાજ , 6 2 અજાણી ઊડતી વસ્તુ , 7 2 ધર્મજ , 8 2 પ્રિયંકા ચોપરા , 9 2 ઇડર , 10 2 મુખપૃષ્ઠ , 11 1 મહેસૂલી તલાટી

Sep 2011: 1 3 હંગ્રી પેઢીના , 2 3 સુરજપુરા (તા. હિંમતનગર) , 3 2 સોરઠા (તા. કાલાવડ) , 4 2 નાની ભગેડી (તા. કાલાવડ) , 5 2 પેટન્ટ , 6 2 માતપુર (તા. પાટણ) , 7 2 કનોડા (તા. બહુચરાજી) , 8 2 ઉપાધ્યાય , 9 2 પાલેજ , 10 2 લોકગીત , 11 2 રાયપુર (છત્તીસગઢ) , 12 2 યુરેનસ (ગ્રહ) , 13 2 સુરત , 14 1 મોભીયાણા નવા (તા. રાજુલા)

Oct 2011: 1 3 ભુટકિયા , 2 3 લોથલ , 3 3 દત્તવાડા , 4 3 તાપી જિલ્લો , 5 2 આરઝી હકૂમત , 6 2 ઉર્વીશ કોઠારી , 7 2 ઈટ્રીયમ , 8 2 બ્રોમિન , 9 2 સેલિનીયમ , 10 2 ક્રોમિયમ , 11 2 વેનેડિયમ , 12 2 ટાઇટેનિયમ , 13 2 એશિયાઇ ચિત્તો , 14 2 ગંધક , 15 2 મેગ્નેશિયમ , 16 2 નિકલ , 17 2 વૈશ્વિક આરોગ્ય , 18 2 ભાણ સાહેબ , 19 2 ખામતા (તા. પડધરી) , 20 2 નોલી (તા. સાયલા) , 21 2 પટોસણ (તા. પાલનપુર) , 22 2 કનોડા (તા. બહુચરાજી) , 23 2 રતુભાઇ અદાણી , 24 2 વ્યવસાય , 25 2 કામલી

Nov 2011: 1 4 બ્લેક સબાથ , 2 3 સુબ્રમણ્યન ચંદ્રશેખર , 3 3 ફીજી હિન્દી , 4 3 પાનસડ (તા. બાબરા) , 5 3 ભુટકિયા , 6 3 ગુજરાતી સાહિત્ય પરિષદ , 7 3 ઘંટીયાળી (તા. થરાદ) , 8 3 જેનપુર (તા. પ્રાંતિજ) , 9 3 દત્તવાડા , 10 3 રાપર , 11 3 ધોળાવીરા , 12 3 ખગોળશાસ્ત્ર , 13 3 મુંબઈ , 14 2 ચારણ , 15 2 નારાયણ સરોવર , 16 2 રીડગુજરાતી.કોમ , 17 2 ભીમડાદ (તા.ગઢડા) , 18 2 પેજ રેન્ક , 19 2 અર્બિયમ , 20 2 યોગસૂત્ર , 21 2 ગોરખનાથ , 22 2 નેશનલ સ્ટોક એક્સચેન્જ , 23 2 ખારી જળાશય (ભુટકિયા) , 24 2 ટેલુરિયમ , 25 2 ટીન

Dec 2011: 1 4 માતપુર (તા. પાટણ) , 2 3 મહારાજા સયાજીરાવ ગાયકવાડ ત્રીજા , 3 3 ધોળીધજા ડેમ , 4 3 રેશમ , 5 3 સલામત મૈથુન , 6 3 કાર્તિકેય , 7 3 મૌલાના આઝાદ , 8 3 નેસડી (તા. સાવરકુંડલા) , 9 3 સુરખાબ , 10 3 ખોખલા (તા. ચાણસ્મા) , 11 3 વાંચ (તા. દસ્ક્રોઇ) , 12 3 કુરાન , 13 3 દેથલી , 14 3 એરથાણ , 15 3 યમનોત્રી , 16 3 સુત્રાપાડા , 17 3 જસદણ , 18 3 લીંબડી , 19 3 ખગોળશાસ્ત્ર , 20 3 ભાવનગર , 21 3 મહાભારત , 22 3 ગુજરાતી , 23 2 બકાસુર , 24 2 શ્રીહરિકોટા , 25 2 ઘાંચી

Jan 2012: 1 4 મહેશ ભટ્ટ , 2 4 આંકડો (વનસ્પતિ) , 3 4 ગોઝારીયા , 4 4 અમદાવાદ , 5 3 જાંબુઘોડા અભયારણ્ય , 6 3 છૂંદો , 7 3 અમૂલ , 8 3 નેસડી (તા. સાવરકુંડલા) , 9 3 પાણીપૂરી , 10 3 જામા મસ્જિદ, અમદાવાદ , 11 3 ગીર રાષ્ટ્રીય ઉદ્યાન અને અભયારણ્ય , 12 3 ઉદવાડા , 13 3 નિશાના , 14 3 ડેબિયન , 15 3 પીરમબેટ , 16 3 પાલનપુર , 17 3 રાજ્ય સભા , 18 3 કાંકરિયા તળાવ , 19 2 સર પ્રભાશંકર પટ્ટણી , 20 2 કોઠી , 21 2 તલાટી-કમ-મંત્રી , 22 2 ચિત્રા (તા. ભાવનગર) , 23 2 દ્રાક્ષાસવ , 24 2 દીવાદાંડી , 25 2 જામા મસ્જિદ

Feb 2012: 1 5 અમદાવાદ , 2 4 અલકા યાજ્ઞિક , 3 4 લેઉવા પટેલ , 4 3 શકરપુર (તા.ખંભાત) , 5 3 સોનૂ નિગમ , 6 3 સુનિધિ ચૌહાણ , 7 3 આહિર , 8 3 અક્ષરધામ (દિલ્હી) , 9 3 ગુરુત્વાકર્ષણ , 10 3 મહાત્મા ગાંધી , 11 2 વિદ્યુત ક્ષેત્ર , 12 2 આલિશા ચિનોઇ , 13 2 નિરમા યુનિવર્સિટી , 14 2 ડૉ.કમલા બેનિવાલ , 15 2 ભીમપુરા (તા. તલોદ) , 16 2 તેરા , 17 2 અંબાડી , 18 2 પપૈયાં , 19 2 અમૂલ , 20 2 મહેશ ભટ્ટ , 21 2 વાગડીયા (તા. જામનગર) , 22 2 પીપર (તા. કાલાવડ) , 23 2 કાળો કોશી , 24 2 ખીલ (રોગ) , 25 2 દૈયપ (તા. વાવ)

Mar 2012: 1 4 ભીમાશંકર , 2 4 ગુજરાતની નદીઓની યાદી , 3 4 નરેન્દ્ર મોદી , 4 3 વિદ્યુત ક્ષેત્ર , 5 3 સાયના નેહવાલ , 6 3 ખડાણા (તા. પેટલાદ) , 7 3 ક્ષત્રિય , 8 2 તાલુકા વિકાસ અધિકારી , 9 2 ધુંઆધાર ધોધ , 10 2 આરસ ખડકો , 11 2 સ્ટ્રોબેરી , 12 2 પીએચપી , 13 2 બાખલકા (તા. તળાજા) , 14 2 ફ્લોપી ડિસ્ક , 15 2 ઇમેજ સ્કેનર , 16 2 મણિશંકર રત્નજી ભટ્ટ ‘કાન્ત’ , 17 2 નૃસિંહપ્રસાદ ભટ્ટ , 18 2 નંદકુમાર પાઠક , 19 2 શેખ આદમ આબુવાલા , 20 2 અનવર આગેવાન , 21 2 હિંમતલાલ અંજારિયા , 22 2 હાજી અલારખિયા , 23 2 ભૂપેશ અધ્વર્યુ , 24 2 આયેશા ટાકિયા , 25 2 મુકેશ અમૃતલાલ આચાર્ય

Apr 2012: 1 4 કુરુક્ષેત્ર , 2 4 વસ્ત્રાપુર તળાવ , 3 4 ઍફીલ ટાવર , 4 4 ક્ષેત્રફળ , 5 4 અમદાવાદ , 6 3 ગુજરાતના પુરસ્કારો , 7 3 ભૂરિશ્રવા , 8 3 લાલભાઈ દલપતભાઈ ઈજનેરી મહાવિદ્યાલય , 9 3 ધરણીધર , 10 3 છૂંદો , 11 3 જગદ્ગુરુ રામભદ્રાચાર્ય , 12 3 પંડોળી , 13 3 સત્યના પ્રયોગો અથવા આત્મકથા , 14 3 ઝવેરચંદ મેઘાણી , 15 3 રાજકોટ , 16 3 નરેન્દ્ર મોદી , 17 2 જીસ્વાન , 18 2 ધૃષ્ટકેતુ , 19 2 વૃષકેતુ , 20 2 એકમ , 21 2 ગબ્બર , 22 2 સ્વચ્છ ગામ સ્વસ્થ ગામ યોજના , 23 2 દિકરી યોજના , 24 2 મહાત્મા ગાંધી રાષ્ટ્રીય ગ્રામીણ રોજગાર બાહેધરી યોજના , 25 2 રાષ્ટ્રીય ગ્રામીણ રોજગાર બાહેધરી યોજના

May 2012: 1 5 દીક્ષાભૂમિ , 2 5 તરખંડા , 3 5 અમલનેર , 4 5 ડૉ. ભીમરાવ રામજી આંબેડકર , 5 4 અજમો , 6 4 મહાત્મા જ્યોતિરાવ ફુલે , 7 4 ડૉ.બાબાસાહેબ આંબેડકર , 8 4 અંતરા , 9 4 અમદાવાદ સીટી તાલુકો , 10 4 નાનાભાઈ ભટ્ટ , 11 3 વિશ્વનાથ ભટ્ટ , 12 3 ડો. બાબાસાહેબ આંબેડકર , 13 3 Portal:સબસ્ટબ કાર્યકારિણી , 14 3 પાળેલાં પશુઓ પર થતી શસ્ત્રક્રિયાની યાદી , 15 3 ખડિયા , 16 3 ભીમાશંકર , 17 3 માધુરી દીક્ષિત , 18 3 પટ્ટદકલ , 19 3 સિદસર (તા. ભાવનગર) , 20 3 રબારી , 21 3 ભૂસ્તરશાસ્ત્રી , 22 3 સપ્તપર્ણી , 23 3 આહિર , 24 3 ખાંટિયાવાંટ , 25 3 ઢીંકવા

Jun 2012: 1 6 નરેન્દ્ર મોદી , 2 5 સુહાસી ધામી , 3 4 અમૃતા રાવ , 4 4 મહાભારત , 5 4 ગુજરાત , 6 3 રૂપશંકર ઓઝા , 7 3 શશિન્ ઓઝા , 8 3 કૃષ્ણકાન્ત કડકડિયા , 9 3 રામજીભાઈ કડિયા , 10 3 યશવંત કડીકર , 11 3 ધનવંત ઓઝા , 12 3 દિગન્ત ઓઝા , 13 3 તનસુખરાય ઓઝા , 14 3 મીનું એડનવાળા , 15 3 ઉષા ઉપાધ્યાય , 16 3 ઉમર ઉઘરાતદાર , 17 3 વઝીરુદ્દીન અલવી , 18 3 રમણિક અરાલવાળા , 19 3 સ્વામી સચ્ચિદાનંદ , 20 3 રમણ સોની , 21 3 હિમાંશી શેલત , 22 3 ગુલામમોહમ્મદ શેખ , 23 3 ધનંજય શાહ , 24 3 સતીશ વ્યાસ , 25 3 યોગેન્દ્ર વ્યાસ

Jul 2012: 1 4 અનુષ્કા શેટ્ટી , 2 4 ધાનેરા , 3 4 ગણદેવી , 4 3 વૈદ્યનાથં , 5 3 રોઝાવાડા (તા. કપડવંજ) , 6 3 છોટાઉદેપુર , 7 3 વડગામ , 8 3 ત્રિકમ સાહેબ , 9 3 સોનગઢ , 10 3 વ્યારા , 11 3 કડી , 12 3 ચંદ્રકાંત બક્ષી , 13 3 માંડવી , 14 2 ગરબી , 15 2 તલીયારા , 16 2 બાલુચરી સાડી , 17 2 ખોપાળા (તા.ગઢડા) , 18 2 કાકરાપાર અણુ શક્તિ મથક , 19 2 ગઢડા તાલુકો , 20 2 ધણફુલીયા (તા. વંથલી) , 21 2 ચકરી , 22 2 લીંબુનું અથાણું , 23 2 બાપા સીતારામ , 24 2 તાજ ફાર્માસ્યૂટિકલ્સ ગ્રુપ , 25 2 આમરા (તા. જામનગર)

Aug 2012: 1 3 એકવાર પીયુને મળવા આવજે (ચલચિત્ર) , 2 3 વડગામ (તા. દસાડા) , 3 3 સાયના નેહવાલ , 4 3 મહાત્મા ગાંધી , 5 2 જાળીયાળા (તા. લીંબડી) , 6 2 અબડાસા , 7 2 કલ્પના ચાવલા , 8 2 મીથુન ચક્રવર્તી , 9 2 પાયથાગોરસ , 10 2 સઈ , 11 2 મગ , 12 2 જસત , 13 2 ઝારેરા નેસ (તા. રાણાવાવ) , 14 2 હડમતીયા (તા. જામનગર) , 15 2 ધોળી (તા. લીંબડી) , 16 2 નીરજી , 17 2 ક્ષારાતુ , 18 2 આચાર્ય હજારી પ્રસાદ દ્વિવેદી , 19 2 અરજણસર (તા. રાધનપુર) , 20 2 કોલીવાડા (તા. સાંતલપુર) , 21 2 મિસળ , 22 2 ભારતનાં રાજ્યોના મુખ્ય મંત્રીઓ , 23 2 ભોળાદ (તા. ધોળકા) , 24 2 ડિસેમ્બર ૨૨ , 25 2 આહિર

Sep 2012: 1 4 શ્રી હરિલીલામૃત , 2 4 ઇ-મેઇલ , 3 4 અબ્દુલ કલામ , 4 4 સ્વામિનારાયણ , 5 4 ગુજરાતી દૈનિકપત્રોની યાદી , 6 3 દરબારી દેતાલ , 7 3 શીખ , 8 3 ભૂમિતિ , 9 2 TV9 ગુજરાત , 10 2 શ્રી હરિ દિગ્વિજય , 11 2 શ્રી હરિલીલાકલ્પતરુ , 12 2 આકાશવાણી , 13 2 મુઝફ્ફર વંશ , 14 2 વિશ્વ સાક્ષરતા દિન , 15 2 દિવાન બલ્લુભાઇ શાળા , 16 2 ભૌતિક અનુસંધાન પ્રયોગશાળા , 17 2 નાનીધારી , 18 2 ફરેણી , 19 2 અક્ષરધામ (ગાંધીનગર) , 20 2 નિરુપા રોય , 21 2 વીર્ય દાન , 22 2 રાવલા મંડી , 23 2 શિક્ષાપત્રી , 24 2 દીના પાઠક , 25 2 બાલુચરી સાડી

Oct 2012: 1 3 તારક મેહતા કા ઉલ્ટા ચશ્મા , 2 3 પ્રેમાનંદ , 3 3 નાઈટ્સ ટેમ્પ્લર , 4 3 ભારતીય રૂપિયો , 5 3 અમીયા (તા. બાયડ) , 6 3 ગણોલ (તા. ધોળકા) , 7 3 આનંદપુરા (તા. ધોળકા) , 8 3 બીજું વિશ્વ યુદ્ધ , 9 3 રાજેન્દ્ર શુક્લ , 10 3 બકુલ ત્રિપાઠી , 11 3 મીરાંબાઈ , 12 2 ગુજરાત વિધાનસભા , 13 2 ભારતીય થલસેના , 14 2 ધુમા , 15 2 ગૌરીશંકર ગોવર્ધનરામ જોષી , 16 2 સર પ્રભાશંકર પટ્ટણી , 17 2 મધુસૂદન પારેખ , 18 2 ગજડી , 19 2 ફુલઝર (તા. જસદણ) , 20 2 પ્રણવ મિસ્ત્રી , 21 2 ગુણવંત શાહ , 22 2 તાજપુર કેમ્પ (તા. તલોદ) , 23 2 કૃષ્ણનગર (સાબલી) (તા. ઇડર) , 24 2 રાજાસોરસ , 25 2 ભારતીય ભૂમિસેના

Nov 2012: 1 5 ભાઇ બીજ , 2 4 કમ્પ્યુટર નેટવર્ક , 3 4 PHP (પ્રોગ્રામિંગ ભાષા) , 4 4 જાવા (પ્રોગ્રામિંગ ભાષા) , 5 4 અણ્ણા હઝારે , 6 3 કલ્પના (કંપની) , 7 3 પોન્ટી ચઢ્ઢા , 8 3 પાયથોન(પ્રોગ્રામિંગ ભાષા) , 9 3 ગો (પ્રોગ્રામિંગ ભાષા) , 10 3 કોમ્પ્યુટર નેટવર્ક , 11 3 C++(પ્રોગ્રામિંગ ભાષા) , 12 3 તારક મેહતા કા ઉલ્ટા ચશ્મા , 13 3 લાલભાઈ દલપતભાઈ ઈજનેરી મહાવિદ્યાલય , 14 3 પીએચપી , 15 3 પાનેસડા (તા. વાવ) , 16 3 રીબડી (તા. માંડલ) , 17 3 કારતક સુદ ૨ , 18 3 સુખદેવ , 19 3 મોરબી , 20 3 નથુરામ ગોડસે , 21 3 જુનાગઢ , 22 3 અમદાવાદ , 23 2 આઇ.આઇ.એમ. અમદાવાદ , 24 2 તલાશ (ચલચિત્ર) , 25 2 ઇસ પ્યાર કો ક્યા નામ દું?

Dec 2012: 1 8 ૨૦૧૨ દિલ્હી બળાત્કાર ઘટના , 2 5 ડેન્ગ્યુ , 3 5 લાલભાઈ દલપતભાઈ ઈજનેરી મહાવિદ્યાલય , 4 5 નરેન્દ્ર મોદી , 5 4 ગુજરાતના પાવનકારી શક્તિપીઠો , 6 4 અમદાવાદની ગુફા , 7 4 અશ્વિની ભટ્ટ , 8 4 આલિશા ચિનોઇ , 9 4 મોરારજી દેસાઈ , 10 4 પાટણ , 11 4 વર્ષા અડાલજા , 12 3 કાજલ ઓઝા-વૈદ્ય , 13 3 સિવિલ હોસ્પિટલ, અમદાવાદ , 14 3 કેશુભાઈ પટેલ , 15 3 સલીમ સુલેમાન , 16 3 વર્ચ્યુઅલાઈઝેશન , 17 3 સેપ્ટ યુનિવર્સીટી , 18 3 કમ્પ્યુટર નેટવર્ક , 19 3 માધુરી દીક્ષિત , 20 3 અણ્ણા હઝારે , 21 3 ગુણવંત શાહ , 22 3 પાણશીણા (તા. લીંબડી) , 23 3 સંડેર (તા. પાટણ) , 24 3 ગુજરાત યુનિવર્સિટી , 25 3 સાણોદા (તા. દહેગામ)

Jan 2013: 1 6 વલ્લભભાઈ પટેલ , 2 5 સાબરમતી મેરેથોન , 3 4 કોરોકોરો ટાપુ , 4 4 એરન સ્વાર્ટઝ , 5 4 સરદાર પટેલ રાષ્ટ્રીય મ્યુઝીયમ , 6 4 બારડોલી સત્યાગ્રહ , 7 3 OSI મોડેલ , 8 3 કમલેશ્વર બંધ , 9 3 ભારતીય રાષ્ટ્રીય કોંગ્રેસ , 10 3 કોચરબ આશ્રમ , 11 3 બારડોલી સ્વરાજ આશ્રમ , 12 3 ઈન્ટરનેટ પ્રોટોકોલ સ્યુટ , 13 3 ઓએસઆઈ મોડેલ , 14 3 ગોપાલ કૃષ્ણ ગોખલે , 15 3 મકડાલા (તા. દિયોદર) , 16 3 શેત્રુંજી નદી , 17 3 મચ્છુ નદી , 18 3 ગુજરાત , 19 2 જાપાનનો ઇતિહાસ , 20 2 કેદારેશ્વર મંદિર બારડોલી , 21 2 મહેન્દ્ર સિંઘ ધોની , 22 2 ભારતમાં આરોગ્યસંભાળ , 23 2 ચિત્તાગોંગ , 24 2 ઈન્ટરનેટ પ્રોટોકોલ , 25 2 ભારતીય માનક સમય

Feb 2013: 1 5 ગુજરાત વિધાનસભા , 2 4 થાણાપીપળી (તા. વંથલી) , 3 4 અમદાવાદ બીઆરટીએસ , 4 3 નેહા શર્મા , 5 3 ચણા , 6 3 ફાઇલ ટ્રાન્સ્ફર પ્રોટોકોલ , 7 3 યાહૂ! , 8 3 નારિયેળ , 9 3 માતાનો મઢ , 10 3 પિસ્તા , 11 3 જાપાનનો ઇતિહાસ , 12 3 વેળવા , 13 3 મગ , 14 3 શેઠુભાર (તા. અમરેલી) , 15 3 કડછ (તા. પોરબંદર) , 16 3 દુધીયા (તા. કલ્યાણપુર) , 17 3 ઠાકોર , 18 3 સિન્ડ્રેલા , 19 3 વડગામ , 20 3 મોરબી , 21 2 ચોઘડિયા , 22 2 કુંવારપાઠું , 23 2 પ્રોફે. મહેબૂબ દેસાઈ , 24 2 મઠ , 25 2 ટ્યુનિશિયા

Mar 2013: 1 5 દોડગામ (તા. થરાદ) , 2 4 વાધગઢ (તા. ધ્રાંગધ્રા) , 3 3 રતાળુ , 4 3 રવીન્દ્ર પ્રભાત , 5 3 મગ , 6 3 રાત્રિ સ્ખલન , 7 3 ટાટા ઈન્ડિગો , 8 3 થરાદ , 9 3 ગુજરાત વિદ્યાપીઠ , 10 2 ૨૦૦૨ ગુજરાત હિંસા , 11 2 રૂબિન ડેવિડ , 12 2 મધર ઇન્ડિયા , 13 2 સુષ્મા સ્વરાજ , 14 2 લુશાળા (તા. વંથલી) , 15 2 ભાટીયા (તા. વંથલી) , 16 2 વાડલા (તા. વંથલી) , 17 2 સ્નેહ દેસાઇ , 18 2 મસુર , 19 2 વડાલ (તા.જુનાગઢ) , 20 2 ગુજરાત વિધાનસભા , 21 2 અડદ , 22 2 ચમારડી (તા. બાબરા) , 23 2 મોણપુર (તા. અમરેલી) , 24 2 સૂરણ , 25 2 અમેરિકન એરલાઇન્સ

Apr 2013: 1 3 મેરી કોમ , 2 3 રવીન્દ્ર પ્રભાત , 3 3 શ્રવણબેલગોડા , 4 3 રામ પ્રસાદ બિસ્મિલ , 5 3 હાંડવો , 6 3 ગીર રાષ્ટ્રીય ઉદ્યાન અને અભયારણ્ય , 7 3 ગુજરાતનો નાથ , 8 2 ક્વિક ક્વિઝ , 9 2 ફિબોનાકિ , 10 2 ફેસબુક , 11 2 રાયણ , 12 2 નગડીયા (તા. વંથલી) , 13 2 માખીયાળા (તા.જુનાગઢ) , 14 2 મોટા (તા. પાલનપુર) , 15 2 હાડફોડી (તા. ઉપલેટા) , 16 2 વાંગધ્રા (તા. જસદણ) , 17 2 બાબા રામદેવ , 18 2 કરોલ (તા. પ્રાંતિજ) , 19 2 રવિન્દ્ર જાડેજા , 20 2 શેરડી , 21 2 ઋત્વિક રોશન , 22 2 કેવડીયા (તા. કપડવંજ) , 23 2 ત્રાજ (તા. માતર) , 24 2 ગોલીડા, રાજકોટ , 25 2 પ્લેટો

May 2013: 1 4 પૂજ્ય શ્રી મોટા , 2 3 નેપોલિયન હિલ , 3 3 મૂળદાસ , 4 3 નસ્લી વાડિયા , 5 3 નામસ્મરણ , 6 3 ટ્રાન્સપોર્ટ ફોર લંડન , 7 3 દ્રાક્ષ , 8 3 અમૂલ , 9 3 નૅનો ટેક્નૉલોજિ , 10 3 મેડી (તા. અમરેલી) , 11 3 બાબાપુર (તા. અમરેલી) , 12 3 માવજીંજવા (તા. બગસરા) , 13 3 હેબતપુર (તા. દસાડા) , 14 3 મહમદ અલી ઝીણા , 15 3 મકતુપુર (તા. ઉંઝા) , 16 3 ખંભાત , 17 3 દિનકર જોષી , 18 3 મોહરમ , 19 3 વડનગર , 20 3 લંડન , 21 3 હિંદી ભાષા , 22 2 કે.જી.પરમાર , 23 2 વણાટકામ , 24 2 કરીના કપૂર , 25 2 જબ તક હૈ જાન

Jun 2013: 1 3 હડકવા , 2 3 ઢોલિવુડ , 3 3 મરકી , 4 3 યુનિટ ૭૩૧ , 5 3 દેરાળા (તા.ગઢડા) , 6 3 ગુજરાત વિધાનસભા ચૂંટણી, ૨૦૧૨ , 7 3 મહમદ અલી ઝીણા , 8 3 અડાલજની વાવ , 9 3 સુરેન્દ્રનગર જિલ્લો , 10 3 જામનગર , 11 3 નરેન્દ્ર મોદી , 12 3 નરસિંહ મહેતા , 13 2 ભડલા , 14 2 લખાણકા (તા.ગઢડા) , 15 2 લીંબડીયા (તા.ગઢડા) , 16 2 લીંબાળા (તા.ગઢડા) , 17 2 લીંબાળી (તા.ગઢડા) , 18 2 હામાપર (તા.ગઢડા) , 19 2 હરીપર (તા.ગઢડા) , 20 2 હોળાયા (તા.ગઢડા) , 21 2 ઇંગોરાળા (તા.ગઢડા) , 22 2 ઇંગોરાળા (ખાલસા) (તા.ગઢડા) , 23 2 ઇશ્વરીયા (તા.ગઢડા) , 24 2 ઇતરીયા (તા.ગઢડા) , 25 2 જલાલપુર (તા.ગઢડા)

Jul 2013: 1 4 ગુજરાતી દૈનિકપત્રોની યાદી , 2 3 થાના ગલોલ (તા. જેતપુર) , 3 3 જસરા (તા. ડીસા) , 4 3 સુરેન્દ્રનગર જિલ્લો , 5 2 સામાન્ય જ્ઞાન , 6 2 પંચામૃત , 7 2 રાયડો , 8 2 અશેળિયો , 9 2 જગતસિંઘજી મહારાજ , 10 2 ભાગ મિલ્ખા ભાગ , 11 2 હીરાકુડ બંધ , 12 2 કળથી , 13 2 મહાવીર જયંતી , 14 2 ખેરખટ્ટો , 15 2 હંસાબેન મહેતા , 16 2 કરીના કપૂર , 17 2 બોર , 18 2 દૈયડ , 19 2 દોડવીર મિલખા સિંઘ , 20 2 સોમાસર (તા. મુળી) , 21 2 અમૃતા રાવ , 22 2 રજકો , 23 2 કૅટરિના કૈફ , 24 2 આગથળા (તા. ડીસા) , 25 2 બાજરી

Aug 2013: 1 4 જુનાગઢ , 2 3 કોદરા , 3 3 પન્ના ધાઈ , 4 3 કોડીનાર , 5 3 નરેન્દ્ર મોદી , 6 2 ચોળાફળી , 7 2 બ્રેમ્પ્ટન, ઓન્ટારીયો , 8 2 ફાફડા , 9 2 લાકડશી , 10 2 તારા માછલી , 11 2 સામો , 12 2 રેડિયો સ્ટુડિયો 54 નેટવર્કના , 13 2 ખીરભવાની મંદિર , 14 2 થાણાપીપળી (તા. વંથલી) , 15 2 ઋગ્વેદ , 16 2 સુર્યપરા (તા. જામનગર) , 17 2 ધ્રોલીયા (તા. ટંકારા) , 18 2 જીવાપર (તા. જસદણ) , 19 2 કારાકાસ , 20 2 એર બસ , 21 2 જેતલવાસણા (તા. વિસનગર) , 22 2 પેંડા , 23 2 જનાલી (તા. ભિલોડા) , 24 2 સંદેશ (અખબાર) , 25 2 શરીર વજન અનુક્રમ

Sep 2013: 1 6 અમદાવાદ , 2 5 ભાવનગર , 3 4 બખરલા (તા. પોરબંદર) , 4 3 રાયણ , 5 3 શિક્ષક દિન , 6 3 ખીજડો , 7 3 ખાટી આમલી , 8 3 વડ , 9 3 દ્રોણ , 10 3 ડીસા , 11 3 સ્વામી વિવેકાનંદ , 12 3 લીંબુ , 13 3 જામનગર , 14 2 ઇલાયચી , 15 2 ગુજરાતની હસ્તકળાઓ , 16 2 મોટા હરીપુરા (તા. વિરમગામ) , 17 2 બાજ (પક્ષી) , 18 2 આંધળીચાકળ (સર્પ) , 19 2 કપોત કુળ , 20 2 લવિંગ , 21 2 સિંધવ , 22 2 શમીમ દેવ આઝાદ , 23 2 સાંભળો, શરીર શું કહે છે ! (પુસ્તક) , 24 2 જૂનાગઢ સિંચાઇ વિભાગના જળબંધો , 25 2 જીમ કોર્બેટ

Oct 2013: 1 7 અમદાવાદ , 2 4 દરિયાઈ રાષ્ટ્રીય ઉદ્યાન અને અભયારણ્ય , 3 4 આસારામ બાપુ , 4 4 ઝૂલેલાલ , 5 3 પાલક (ભાજી) , 6 3 પાલખ (ભાજી) , 7 3 ચિત્રા (તા. ભાવનગર) , 8 3 ઉંચા કોટડા , 9 3 નારાયણ સરોવર , 10 3 ઢાંક (તા. ઉપલેટા) , 11 3 પાનેસડા (તા. વાવ) , 12 3 ઉતેળીયા (તા. ધોળકા) , 13 3 હેબતપુર (તા. બરવાળા) , 14 3 સાંગાસર (તા. બરવાળા) , 15 3 વેળાવદર કાળિયાર રાષ્ટ્રીય ઉદ્યાન , 16 3 ઇસનપુર મોટા (તા. ગાંધીનગર) , 17 3 મદીના , 18 3 દાહોદ , 19 3 રોજીદ , 20 3 ચેટીચંડ , 21 3 ભાવનગર , 22 2 વસતી ગણતરી ૨૦૧૧ (અમદાવાદ) , 23 2 કુલધારા, રાજસ્થાન , 24 2 જીંજાવદર (તા.ગઢડા) , 25 2 ઉગામેડી (તા.ગઢડા)

Nov 2013: 1 4 ઠાકોર , 2 3 સાંપડ (તા. પ્રાંતિજ) , 3 3 કુદરતી આફતો , 4 3 મહુવા , 5 3 શ્રીમદ્ ભગવદ્ ગીતા , 6 3 પાલીતાણા , 7 2 ગુજરાતના ધોરીમાર્ગોની યાદી , 8 2 બુદ્ધ અને તેમનો ધમ્મ , 9 2 કંસારી નેસ (તા. ઉના) , 10 2 પાલક (ભાજી) , 11 2 સતાણા નેસ (તા. પાલીતાણા) , 12 2 વિજાણા નેસ (તા. પાલીતાણા) , 13 2 બોદાણા નેસ (તા. પાલીતાણા) , 14 2 અગિયાળી (તા. સિહોર) , 15 2 વાઘનગર (તા.મહુવા) , 16 2 સમઢીયાળા (પાનબાઇ) (તા. ઉમરાળા) , 17 2 ઇંગોરાળા (તા. ઉમરાળા) , 18 2 બોચડવા (તા. ઉમરાળા) , 19 2 આંબલા (તા. સિહોર) , 20 2 ઘેલડા (તા. જામજોધપુર) , 21 2 દુકાળ , 22 2 ગરીયા (તા. વાંકાનેર) , 23 2 કોલંબો , 24 2 ફલુ (તા. વિજાપુર) , 25 2 વાવ (તા. ઘોઘંબા)

Dec 2013: 1 3 હલદરવા નેસ (તા. વિસાવદર) , 2 3 બારવાનીયા નેસ (તા. વિસાવદર) , 3 3 સામાપોર , 4 3 દાંડી (જલાલપોર) , 5 3 વાછાવડ , 6 2 જાંબુડી નેશ (તા. મેંદરડા) , 7 2 કિલોરીયા નેશ (તા. મેંદરડા) , 8 2 કંથાળા નેશ (તા. મેંદરડા) , 9 2 વિસણવેલ(તા. માળીયા હાટીના) , 10 2 લાંગોદ્રા(તા. માળીયા હાટીના) , 11 2 ઘુમલી(તા. માળીયા હાટીના) , 12 2 દંડેરી(તા. માળીયા હાટીના) , 13 2 ઝડકા(તા. માળીયા હાટીના) , 14 2 આછીદ્રા(તા. માળીયા હાટીના) , 15 2 ઝરીયાવાડા (તા.માંગરોળ) , 16 2 વિરપુર (તા.માંગરોળ) , 17 2 વિરોલ (તા.માંગરોળ) , 18 2 વાડલા (તા.માંગરોળ) , 19 2 થલી (તા.માંગરોળ) , 20 2 તલોદ્રા (તા.માંગરોળ) , 21 2 સુલ્તાનપુર (તા.માંગરોળ) , 22 2 શીલ (તા.માંગરોળ) , 23 2 શેરિયાખાણ (તા.માંગરોળ) , 24 2 શેરિયાજ (તા.માંગરોળ) , 25 2 શેપા (તા.માંગરોળ)

Jan 2014: 1 3 ચાણસ્મા , 2 2 લચિત બોરફૂકન , 3 2 પ્રાણલાલ પટેલ , 4 2 લોપકચિહ્ન , 5 2 અવતરણ ચિહ્ન , 6 2 મહારેખા , 7 2 વિગ્રહરેખા , 8 2 મહાવિરામ , 9 2 અર્ધ વિરામ , 10 2 ચોરવાડ(તા. માળીયા હાટીના) , 11 2 જાપાનનો ઇતિહાસ , 12 2 ગારીયાધાર , 13 2 પાણીયા ડુંગરી (તા. ધારી) , 14 2 માણાવાવ (તા. ધારી) , 15 2 કરમદડી (તા. ધારી) , 16 2 ખંભાળીયા (તા. ધારી) , 17 2 ખીસરી (તા. ધારી) , 18 2 જળજીવડી (તા. ધારી) , 19 2 કરેણ (તા. ધારી) , 20 2 દલખાણીયા (તા. ધારી) , 21 2 દિતલા (તા. ધારી) , 22 2 ધારગણી (તા. ધારી) , 23 2 રાજસ્થળી (તા. ધારી) , 24 2 સુખપુર (તા. ધારી) , 25 2 દેવળા (તા. ધારી)

Feb 2014: 1 3 કલાલી , 2 2 ધરતી , 3 2 લોકનૃત્ય , 4 2 વિજ્ઞાનની દૃષ્ટિએ માનવશરીર , 5 2 અબુડી (તા. ઉના) , 6 2 સાબરમતી મેરેથોન , 7 2 વેલી ઓફ ફ્લાવર્સ રાષ્ટ્રીય ઉદ્યાન , 8 2 સ્વામિનારાયણ સંપ્રદાય , 9 2 વચનામૃત , 10 2 વણછરા , 11 2 મુળી , 12 2 ડૉ. ભીમરાવ રામજી આંબેડકર , 13 1 ધનપુર (તા. લીમખેડા)

Mar 2014: 1 6 સરસવણી (તા. મહેમદાવાદ) , 2 4 રવિશંકર મહારાજ , 3 4 ચિખલી, મહારાષ્ટ્ર , 4 4 રવિશંકર વ્યાસ , 5 3 જેસલ જાડેજા , 6 3 છાંયા (તા. પોરબંદર) , 7 2 વિવેકાનંદ , 8 2 યરૂશાલેમના હિબ્રુ યુનિવર્સિટી , 9 2 શંકર મહાદેવન , 10 2 સુરેશ વાડકર , 11 2 કુંવારપાઠું , 12 2 ઇશ્વરનગર (તા. હળવદ) , 13 2 બૌદ્ધ ગુફાઓ, ખંભાલીડા , 14 2 ગોમતા (તા. ગોંડલ) , 15 2 કરણાસર (તા. થરાદ) , 16 2 રામ પ્રસાદ બિસ્મિલ , 17 2 મોરા (તા. મોડાસા) , 18 2 ગુરુના ચંદ્રો , 19 2 પટવાણ (તા. લીમખેડા) , 20 2 જુલાઇ ૧ , 21 2 ખોખડદળ , 22 2 દાહોદ , 23 2 પોપટ , 24 2 સંત કબીર , 25 1 પૂજ્ય રવિશંકર મહારાજ

Apr 2014: 1 4 ભારતીય સામાન્ય ચૂંટણી, ૨૦૧૪ , 2 4 ઉના , 3 3 અવાક , 4 3 ઇજનેરી મહાવિદ્યાલય, પુણે , 5 3 વિનોદ ભટ્ટ , 6 3 રૂવા (તા. ભાવનગર) , 7 3 બહુચર માતા , 8 3 મોરારજી દેસાઈ , 9 3 સરસવણી (તા. મહેમદાવાદ) , 10 3 રાપર , 11 3 આહવા , 12 2 નવી મુંબઈ , 13 2 સુલોચના (રામાયણ) , 14 2 વિલાયતી પટ્ટાઇ , 15 2 પટ્ટી પટ્ટાઇ , 16 2 પાન પટ્ટાઇ , 17 2 કાચબરંગી , 18 2 અબલખ , 19 2 કરકરો , 20 2 ચલ , 21 2 વન લલેડુ , 22 2 દસાડી , 23 2 ભારતીય ઉપખંડના પક્ષીઓની યાદી , 24 2 સ્તેનેશ્વર મહાદેવ, તેના , 25 2 શબરી

May 2014: 1 7 નરેન્દ્ર મોદી , 2 4 માતૃભાષા અભિયાન , 3 3 મનમોહન સિંહ , 4 3 ઉપલેટા , 5 3 રાજકોટ , 6 2 ગૂજરાત વિદ્યાપીઠ , 7 2 સાર્ક , 8 2 હિંદ મહાસાગર , 9 2 સન્ધિ (વ્યાકરણ) , 10 2 વિવેકાનંદ રોક મેમોરિયલ , 11 2 ઈગ્નસ તિર્કિ , 12 2 મમતા સોઢા , 13 2 ડૉ. શરદ ઠાકર , 14 2 ગમડાઉ (તા. ભચાઉ ) , 15 2 કબરાઉ (તા. ભચાઉ ) , 16 2 ભારતીય સામાન્ય ચૂંટણી, ૨૦૧૪ , 17 2 પ્રાણલાલ પટેલ , 18 2 કણખોઇ (તા. ભચાઉ ) , 19 2 અળવી , 20 2 પાટણા (તા.ગઢડા) , 21 2 લુવારવાવ (તા. પાલીતાણા) , 22 2 ગોરડકા (તા.ગઢડા) , 23 2 ઑડિશાના મુખ્યમંત્રીઓ , 24 2 રામવાવ , 25 2 ઑડિશાના જિલ્લા અને શહેરો

Jun 2014: 1 3 દર્શન જરીવાલા , 2 3 અભિષેક જૈન , 3 3 હેબતપુર (તા. દસાડા) , 4 3 ઉમરેઠ , 5 3 નર્મદા નદી , 6 2 માખણ , 7 2 સોપારી , 8 2 કાકડી , 9 2 રેકી , 10 2 સેઓંગ જેઇ-જીઆઇ , 11 2 સાબલવાડ કંપા (જનકપુર) (તા. ઇડર) , 12 2 જાપાનનો ઇતિહાસ , 13 2 કેવી રીતે જઈશ (ચલચિત્ર‌‌) , 14 2 નૅનો ટેક્નૉલોજિ , 15 2 ગુજરાત યુનિવર્સિટી , 16 2 ચોરીવાડ (તા. વડાલી) , 17 2 બેસિલિકા ઑફ બોમ જીસસ

Jul 2014: 1 2 મહી નદી , 2 2 હોટલ તાજ મહેલ પેલેસ , 3 2 ઇન્દ્રાયણી એક્સપ્રેસ , 4 2 આઈ ટી સી ગ્રાંડ ચોલા હોટલ , 5 2 એર ઇન્ડિયા એક્સપ્રેસ , 6 2 વોલ્ટર બેન્ડેર , 7 2 પુસ્તક પરબ , 8 2 એર એશિયા ઇન્ડિયા , 9 2 માખણ , 10 2 માતૃભાષા અભિયાન , 11 2 શોભાવડ (તા. તળાજા) , 12 2 કાજલ ઓઝા-વૈદ્ય , 13 2 ખીચા (તા. ધારી) , 14 2 ક્રોપ સર્કલ , 15 1 ચોલા સામ્રાજ્ય

Aug 2014: 1 4 બે યાર , 2 4 આનંદીબેન પટેલ , 3 4 તબલા , 4 3 સચિન-જીગર , 5 3 ભૂસ્ખલન , 6 3 અભિષેક જૈન , 7 3 ગુજરાત , 8 2 ધ પારડી હોટેલ્સ ચેન્નઈ , 9 2 ધ પાર્ક ચેન્નાઇ , 10 2 ઓબેરોય ટ્રાયડેંટ , 11 2 દિલીપ કુમાર , 12 2 જિનવિજયજી , 13 2 સોડવદરા , 14 2 નવા નદિસર , 15 2 હોવાર્ડ ગોબિઓફ , 16 2 મધરબોર્ડ , 17 2 કાન , 18 2 સરતાનપર (તા. તળાજા) , 19 2 કેવી રીતે જઈશ (ચલચિત્ર‌‌) , 20 2 વીર્ય સ્ખલન , 21 2 પંચાશીયા (તા. વાંકાનેર) , 22 2 મહેન્દ્રગઢ (તા.માળિયા-મિયાણા) , 23 2 ટાઇગર વુડ્સ , 24 2 ક્રોપ સર્કલ , 25 2 મલેરિયા

No data on this page have been normalized to 30 day months (as WMF does on certain traffic reports).
Wikipedias are initially ordered by number of speakers of the language

Speakers: Number of speakers of a language is the estimated total of primary and secondary speakers, is in many cases a very rough estimation (based on the page on the English Wikipedia about that language)
Regions are parts of the world where the language is spoken in substantial amounts (compared to total number of speakers). Regions where a language gained presence only by a recent diaspora are generally not included.
Region codes: AF:Africa, AS:Asia, EU:Europe, NA:North America, OC:Oceania, SA:South America, W:World Wide, CL:Constructed Language

Estatísticas geradas em Sunday September 28, 2014 20:21

Dump file guwiki-20140909-stub-meta-history.xml.gz (edits only), size 23 Mb as gz -> 174 Mb
Dump processed till Aug 31, 2014, on server stat1002, ready at Tue-09/09/2014-18:03 after 2 min, 26 sec.

Versão do script:2.6
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### =
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.