Estatísticas da Wikipédia guzerate

Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Articles per size range / Records per namespace / Most edited articles / Zeitgeist

Most metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.

Some metrics have been collected from the full archive dump which runs on lower frequency than the usual monthly cycle.
These metrics are columns F,I,J,K,M,N,O,P,Q,R from the first table.

See also metrics definitions

Monthly counts & Quarterly rankings: julho 2014
DataWikipedistasArtigosBase de dadosLigações
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
jul 2014+1%   0%      -26%      0%
jun 20140%   0%      -40%      0%
mai 2014+1%   0%      -42%      +1%
abr 2014+1%   0%      +40%      +1%
mar 2014+1%   0%      +20%      0%
fev 20140%   0%0%     -53%-1%-0%+1%0%0%+1%+1%
jul 201422125 26 k  10,5   350      1,7 k
jun 2014219111 26 k  10,5   476      1,7 k
mai 2014218213226 k 210,5   795      1,7 k
abr 2014216212425 k 310,5   1,4 k      1,6 k
mar 2014214210225 k  10,5   990      1,6 k
fev 2014212 7225 k25 k 10,5238188%9%828136 Mb8,3 M473 k7,9 k3,4 k44 k1,6 k
jan 201421229325 k25 k310,4239888%10%1,8 k137 Mb8,3 M470 k7,9 k3,4 k43 k1,6 k
dez 2013210110325 k25 k1910,4240188%10%1,9 k137 Mb8,3 M469 k7,9 k3,4 k43 k1,6 k
nov 2013209211425 k24 k4210,6243488%10%3,5 k135 Mb8,2 M459 k8,0 k3,4 k43 k1,6 k
out 2013207215623 k23 k2211246887%9%3,4 k131 Mb8,0 M443 k7,9 k3,4 k41 k1,6 k
set 2013205313423 k22 k111,2249686%9%1,5 k129 Mb7,9 M431 k8,8 k3,3 k40 k1,6 k
ago 2013202213223 k22 k111,1249486%9%822129 Mb7,9 M431 k8,8 k3,3 k40 k1,5 k
jul 201320019223 k22 k111,1249686%9%5,6 k129 Mb7,9 M430 k10,0 k3,3 k39 k1,5 k
jun 2013199110323 k22 k410,9249686%9%19 k129 Mb7,9 M430 k10 k3,3 k39 k1,5 k
mai 2013198316323 k22 k110,1245184%9%3,4 k126 Mb7,7 M428 k10 k3,3 k39 k1,5 k
abr 2013195113123 k22 k 9,9239082%9%2,3 k124 Mb7,6 M425 k10 k3,3 k39 k1,5 k
mar 2013194320223 k22 k19,8234582%9%13 k122 Mb7,5 M424 k11 k3,3 k39 k1,5 k
fev 2013191421522 k22 k29,3213478%9%6,7 k119 Mb7,1 M417 k177 k3,3 k39 k1,5 k
jan 2013187522322 k22 k39213078%8%3,2 k118 Mb7,1 M416 k174 k3,2 k39 k1,5 k
dez 2012182627622 k22 k28,9212978%8%4,3 k117 Mb7,0 M414 k173 k3,1 k39 k1,4 k
nov 2012176317322 k22 k48,8210778%8%12 k116 Mb7,0 M413 k171 k3,1 k38 k1,4 k
out 2012173417322 k22 k18,2201975%8%12 k113 Mb6,8 M411 k170 k3,0 k38 k1,4 k
set 2012169714322 k22 k17,7200774%8%2,3 k112 Mb6,7 M410 k169 k2,9 k38 k1,4 k
ago 2012162614122 k22 k17,6200173%8%1,9 k112 Mb6,7 M410 k168 k3,0 k38 k1,4 k
jul 2012156216222 k22 k17,6200073%8%3,0 k112 Mb6,7 M410 k167 k3,0 k38 k1,4 k
jun 2012154518522 k21 k37,4199773%8%3,4 k111 Mb6,7 M408 k166 k3,0 k38 k1,4 k
mai 2012149416422 k21 k17,3198773%8%2,7 k111 Mb6,7 M407 k165 k3,1 k38 k1,4 k
abr 2012145613222 k21 k17,2198273%8%2,2 k110 Mb6,6 M406 k164 k3,3 k37 k1,3 k
mar 2012139111122 k21 k17,1198373%8%1,9 k110 Mb6,6 M406 k163 k3,3 k37 k1,3 k
fev 2012138315322 k21 k17198273%8%2,3 k110 Mb6,6 M406 k162 k3,3 k37 k1,3 k
jan 2012135419322 k21 k36,9198273%8%3,2 k110 Mb6,6 M405 k162 k3,3 k37 k1,3 k
dez 2011131315522 k21 k46,8198073%8%3,8 k109 Mb6,6 M404 k160 k3,1 k37 k1,3 k
nov 201112839322 k21 k76,7197573%7%3,1 k108 Mb6,5 M401 k159 k3,0 k37 k1,3 k
out 2011125312321 k21 k96,6198273%8%3,0 k108 Mb6,5 M399 k158 k3,0 k37 k1,3 k
set 2011122 9321 k20 k116,5199772%8%3,6 k107 Mb6,4 M392 k157 k3,1 k37 k1,3 k
ago 2011122211221 k20 k76,5201372%8%2,9 k106 Mb6,4 M385 k157 k3,1 k37 k1,2 k
jul 2011120310221 k20 k136,4201872%8%3,6 k105 Mb6,3 M382 k156 k3,1 k36 k1,2 k
jun 2011117312320 k20 k126,3203071%7%3,4 k104 Mb6,3 M373 k155 k3,1 k36 k1,2 k
mai 2011114314420 k19 k146,3199270%7%5,0 k100 Mb6,0 M365 k153 k3,0 k35 k1,2 k
abr 201111129319 k19 k136,2196469%7%3,5 k96 Mb5,8 M357 k149 k3,0 k34 k1,2 k
mar 201110917319 k18 k136,1194867%7%4,1 k94 Mb5,7 M348 k147 k3,1 k33 k1,1 k
fev 2011108618319 k18 k136193462%7%3,1 k91 Mb5,5 M337 k145 k3,1 k32 k1,1 k
jan 2011102315518 k17 k136187160%7%4,4 k87 Mb5,2 M328 k142 k2,8 k30 k1,1 k
dez 201099114518 k17 k135,9184756%7%3,6 k84 Mb5,0 M320 k140 k2,6 k28 k1,1 k
nov 201098816517 k17 k135,8179755%7%3,8 k80 Mb4,8 M312 k137 k2,3 k27 k1,0 k
out 201090412517 k16 k145,7175152%6%4,1 k76 Mb4,5 M304 k134 k2,1 k25 k1,0 k
set 201086316617 k16 k155,6167650%6%3,8 k71 Mb4,2 M293 k130 k2,2 k23 k997
ago 201083115516 k15 k165,5155745%6%8,2 k65 Mb3,8 M280 k126 k1,8 k21 k965
jul 201082312416 k15 k155,2144441%6%3,5 k59 Mb3,4 M264 k121 k1,8 k18 k875
jun 201079311315 k14 k145,1134338%5%3,6 k53 Mb3,1 M247 k116 k1,7 k16 k849
mai 201076110415 k14 k155126034%5%4,1 k49 Mb2,8 M231 k113 k1,4 k14 k826
abr 201075110214 k13 k174,9125427%5%4,3 k47 Mb2,7 M223 k111 k1,4 k14 k813
mar 201074416214 k13 k274,7122822%5%5,2 k45 Mb2,6 M212 k108 k1,4 k13 k805
fev 201070415213 k12 k184,6115420%5%4,4 k40 Mb2,3 M190 k102 k1,5 k11 k790
jan 20106628212 k11 k214,5108619%5%4,2 k36 Mb2,0 M175 k96 k1,4 k9,3 k784
dez 20096429112 k10 k214,4108418%5%3,8 k34 Mb1,9 M164 k90 k1,4 k8,8 k723
nov 20096236111 k9,8 k254,3104119%5%3,3 k31 Mb1,7 M150 k84 k1,4 k7,4 k636
out 200959112310 k8,9 k294,3105020%5%3,4 k29 Mb1,6 M135 k79 k1,4 k6,9 k555
set 200958 949,5 k7,8 k374,395820%5%3,3 k24 Mb1,4 M115 k70 k1,2 k5,4 k520
ago 20095861538,4 k6,7 k334,594321%5%3,5 k21 Mb1,2 M96 k60 k9834,7 k359
jul 2009522827,3 k5,7 k254,698022%5%2,2 k19 Mb1,1 M82 k52 k1,0 k4,4 k320
jun 2009501726,6 k4,9 k214,9100624%5%2,0 k17 Mb996 k70 k46 k8904,2 k309
mai 200949 645,9 k4,3 k27575823%5%5,4 k12 Mb686 k53 k38 k7222,1 k278
abr 2009492925,1 k3,4 k604,878519%6%2,8 k11 Mb612 k43 k34 k7722,0 k249
mar 200947 823,3 k1,7 k196,689123%7%1,6 k7,6 Mb448 k25 k28 k7291,6 k244
fev 200947 1012,7 k1,1 k37,489225%8%7706,4 Mb369 k18 k25 k5861,3 k225
jan 200947 7 2,6 k1,1 k17,386725%8%8075,9 Mb348 k17 k24 k5721,2 k219
dez 20084726 2,6 k1,0 k17,177824%8%6185,5 Mb310 k16 k22 k534970211
nov 200845 712,6 k1,0 k26,974923%7%8865,2 Mb296 k16 k21 k514858207
out 2008451712,5 k96026,771422%7%7764,9 Mb277 k15 k20 k478784197
set 200844311 2,5 k88536,565220%6%8334,5 Mb246 k14 k19 k366635192
ago 20084131012,4 k851216,564220%6%1,9 k4,2 Mb233 k13 k19 k333595183
jul 200838 711,7 k638147,874524%7%1,9 k3,6 Mb194 k10 k17 k306540178
jun 2008382811,3 k5938989329%8%1,1 k3,2 Mb170 k8,2 k16 k289496156
mai 2008364921,0 k5631610,2106435%10%1,2 k3,0 Mb160 k7,4 k14 k283458144
abr 20083225 545391217148043%14%5132,1 Mb118 k5,4 k14 k264421123
mar 200830151498346117,5149139%13%5622,0 Mb108 k5,0 k13 k261412117
fev 20082947 459303117,8154036%14%4861,8 Mb100 k4,7 k13 k251371112
jan 20082535 427280 18161637%14%4551,7 Mb96 k4,7 k13 k246373111
dez 20072235 416273117,4155137%13%4601,6 Mb90 k4,6 k12 k238332109
nov 20071921 400266 16,9152536%13%4051,6 Mb87 k4,4 k12 k235310108
out 200717 2 387265216,4152037%13%4901,6 Mb86 k4,4 k12 k235302108
set 20071712 338265 17,4171242%14%3411,5 Mb86 k4,4 k11 k234299106
ago 20071611 325261 17170742%15%2281,5 Mb85 k4,4 k11 k231285104
jul 200715   322261 16,5170042%15%731,5 Mb84 k4,4 k11 k232283103
jun 20071514 321260 16,3168442%15%2331,5 Mb84 k4,4 k11 k233278103
mai 20071413 317255115,8169741%15%4001,5 Mb83 k4,4 k11 k231276102
abr 200713141301242115,3142640%13%3851,2 Mb66 k3,7 k10,0 k220236101
mar 200712131269210115,6121638%12%503953 kb47 k3,3 k8,2 k19622483
fev 20071112 250196114,8126439%12%276867 kb45 k3,3 k7,7 k18223073
jan 200710   233180 14,7119936%10%261774 kb39 k3,0 k7,4 k16322472
dez 200610 1 230174 13,8121235%10%329760 kb39 k3,0 k7,0 k16321972
nov 200610   226171 12,6123235%10%44730 kb38 k3,0 k6,1 k16221271
out 20061011 225172 12,4123535%10%70730 kb38 k3,0 k6,0 k16321271
set 20069   220166 12,4122834%10%47709 kb37 k2,9 k6,0 k16321271
ago 20069   216165 12,4122334%11%77691 kb37 k2,9 k5,8 k16321271
jul 20069   213166 12,2122335%11%130689 kb37 k2,9 k5,7 k16321071
jun 20069   211165 11,7122235%11%130681 kb37 k2,9 k5,5 k16221071
mai 20069 1 209164 11,2121735%11%124668 kb36 k2,9 k5,3 k15920871
abr 20069   208164 10,7119635%10%150658 kb36 k2,9 k5,2 k16020870
mar 20069   206164 10119535%10%128651 kb36 k2,9 k4,9 k16020870
fev 20069 1 203163 9,6119636%10%25633 kb36 k2,9 k4,4 k16020869
jan 20069 21202162 9,5119836%9%217630 kb35 k2,9 k4,4 k16020869
dez 20059 1118814719135434%10%190611 kb37 k2,9 k3,7 k15721055
nov 20059 1 147117 10,3162641%12%24555 kb35 k2,7 k2,8 k12520346
out 20059   144117 10,3164541%12%15553 kb35 k2,7 k2,8 k12420346
set 20059 1 143117 10,3165541%13%29551 kb35 k2,7 k2,8 k12420346
ago 20059 1 142117 10,1165842%13%20549 kb35 k2,7 k2,7 k12420345
jul 20059 1 142117 10171442%13%42545 kb37 k2,7 k2,6 k12421845
jun 20059 3214211729,7170042%13%456516 kb36 k2,6 k2,5 k12422245
mai 2005923 9172110,1168348%14%383315 kb24 k1,7 k9845414918
abr 20057 1 6649 8,2120939%6%84153 kb12 k676540155611
mar 20057 1 593917,772032%5%9895 kb6,1 k574242104011
fev 2005711 4217 8,585326%7%2468 kb4,0 k389179895
jan 2005612 3816 8,874626%5%4861 kb3,4 k334147784
dez 20045 4 3315 8,677830%6%5453 kb3,3 k317146783
nov 2004513 2510 9,285624%8%6740 kb2,5 k237102462
out 2004413 164 10,247425%6%5818 kb6967522342
set 20043 2 133 8,225515% 6611 kb2991420 32
ago 2004311 93 4,453733%11%1116 kb4654133 91
jul 2004211 63 4,891750%17%1415 kb4534127 91
jun 20041   2  7,5   111 kb     1
mai 20041   1  14   17,5 kb     1
abr 20041   1  13   37,5 kb     1
mar 20041   1  10   57,3 kb     1
fev 20041   1  5   27,3 kb     1
jan 20041   1  3   27,3 kb     1
dez 200311  1  1   12,7 kb      
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternas

> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
The following table ranks this project in relation to projects in other languages with 1000+ articles
abr 20148693887596 99195   94      250
jan 201486100998693821011964333140976677746212273250
out 2013869576659485481924037146736878756312075250
jul 201386102948693841191933940146636677746411973250
abr 2013861098211393831611994252145986676747411972250
jan 2013867367819181105202536214512868757215011868250
out 201287757275877912120358701467266746915011864250
jul 2012899080968678122201577314411764716614511663250
abr 2012916582938375127200577014312664716614510461250
jan 2012917676858074101200566413911061706514310459250
out 201192828681797173199576113912559676414210559250
jul 201192799189797172195536013711259646513810358250
abr 201195889680777064193576614310160666213810558250
jan 201197808065777165191599414410961666413610262250
out 201099748269777364187641061429464696613611563250
jul 2010101768174807256182851231379870796813611769250
abr 20109810988898174621809314613810771837113712372250
jan 20101028895898578511761091571389178857914111981250
out 2009103102797990854117310915513610181898014611786250
jul 2009106101928994944816510814613214093999416013298250
abr 200910586858710410428162124148127116107112109168141112250
jan 200910413499132122139125150113135109162126126133175147125250
out 200810210894102122136107146123136111154128130133174149131248
jul 20081061519811013414257136111125106120136140142178167139247
abr 200810988110130162149103146146145143159146150152173166140247
jan 200811882117133160153154141141140139154145151151167158139244
out 2007130140139131154147111139139137137160145150148163152141242
jul 2007133140193122152144137132132131129173139147145154146139240
abr 2007130103113100150141118128128127125138140146146147137137235
jan 2007138125181124151143137122122122120148145151145145143130232
out 2006130102144117142132137115115115114162129138133136130123229
jul 2006120129163107132123120105105105104132119129121120120114218
abr 200610612316510612211812093939392121110117112112105103213
jan 20069410610476109106105868686851011011041001039491197
out 200588100126841051009881818180136999894998986196
jul 200581861048098929070707070105898685928481185
abr 200579869375959484606060608796909210194105178
jan 200574677262979776545454548598979210691133174
out 200479636155969770515151517410210810112488143173
jul 200480607351898659434343438288981128284112148
abr 200488   94      8885     133
jan 200479   83      8771     121
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
 WikipedistasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikipedistas (usuários registrados)
A = Wikipedistas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikipedistas que editaram pelo menos dez vezes desde que chegaram
C = Wikipedistas que contribuíram cinco vezes ou mais este mês
D = Wikipedistas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Artigos que contêm pelo menos uma ligação interna e 200 caracteres de texto legível, não contando códigos wiki e html,
      ligações ocultas, etc.; títulos também não contam (outras colunas são baseadas no método oficial de contagem)
G = Novos artigos por dia no mês passado
H = Número médio de revisões por artigo
I = Tamanho médio dos artigos em bytes
J = Porcentagem de artigos com pelo menos 0,5 kb de texto legível (veja F)
K = Porcentagem de artigos com pelo menos 2 kb de texto legível (veja F)

Base de dados
L = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
M = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
N = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

O = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
P = Total de ligações para outras wikipédias
Q = Total de imagens apresentadas
R = Total de ligações para outros sítios
S = Total de páginas de redirecionamento

Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  2500  5  10  100  1000  10000  1  3  5  10  25  100  250  5  10  100  1  3  5  10  25  100  250  5  10  100 
Monthly counts for recent history of wiki
jul 20142913533   11   9422111   164321     
jun 201431151173   11   11332111   13322      
mai 2014471613862   11   1355521    229652     
abr 20143715128541  22   1676531    29108441    
mar 20143412107521  11   1375541    278443     
fev 20142797532   221  1188711    217732     
jan 2014331198632  331  9664411   2110763     
dez 20133815107432  1    14976211   32107642    
nov 201333131198431 111  1586641    4498742    
out 2013482215107631 1    17998721   3514107532   
set 201346191311641  11   14987411   3914753  21 
ago 2013401613932   32   18973111   317521  221
jul 201334129742   4211 18874211   358532  22 
jun 20133617107631  322211997651    3611951  5  
mai 20134619161063   4321 18988611   4312965  22 
abr 2013491813941   5411 1955421 1  388542  43 
mar 20135625201572   11832 208641111  612312822 841
fev 2013532521181251  201741 23995311   6623149411531
jan 201360272215931  24175  211296411   601712961 761
dez 2012673527191163  29205  21119731111 8731201152294 
nov 201252231712731  2520311208654  111831711622143 
out 20126129178431  271752 226553  11110830177311842
set 20125323148431  20134  228653  111842718731 21 
ago 20126122147311  20142  1510663  1111002917931 331
jul 2012462516952   25158  2176432111195351693  741
jun 201255241810851  20154  2411875311  106321996221031
mai 201245221613942  23165  20108863    113311384211251
abr 20124722131172   22173  24118551    913220883175 
mar 20124318111061   23172  1910732     11537191031 32 
fev 201251201511531  27162  2210663     913318103  62 
jan 201261231913933  26215  1898541    1052719106  52 
Quarterly counts for entire history of wiki
jul 20142913533   11   9422111   164321     
abr 20143715128541  22   1676531    29108441    
jan 2014331198632  331  9664411   2110763     
out 2013482215107631 1    17998721   3514107532   
jul 201334129742   4211 18874211   358532  22 
abr 2013491813941   5411 1955421 1  388542  43 
jan 201360272215931  24175  211296411   601712961 761
out 20126129178431  271752 226553  11110830177311842
jul 2012462516952   25158  2176432111195351693  741
abr 20124722131172   22173  24118551    913220883175 
jan 201261231913933  26215  1898541    1052719106  52 
out 20113417127332  28215  116642     86211131  97 
jul 201143171083221 28194  1022111    8723134   41 
abr 20113415964321 22164  74211     72221341  84 
jan 2011511915119511 26194  1665411    10027181321 108 
out 201046201286521 19124  86322     8720151031 73 
jul 2010552212119411 25183  137532     1032916102  63 
abr 201031191096211 18144  92222     76281231  82 
jan 20102912875211117122  136442     76211283  21 
out 200925131275321 20145  1065421    87231672  21 
jul 2009231187421  17132  128663     1102921101     
abr 20091910985211 1815   168651     1113120127  4  
jan 20092311764   2115   96541     110361851  32 
out 200817107641   107   156321     97301571  3  
jul 200814875311  991  148421     1383924831 2  
abr 200887543   87   63321     1072514105  51 
jan 2008128542   85   83332     118261572  1  
out 2007742     951  711       14641251372 21 
jul 200752     4              1574024931 2  
abr 2007854331   42   63111     15250251252 2  
jan 20073      321  2         14741241341131 
out 200642111   1    2         147301672  11 
jul 20063      21   1         141502171     
abr 20063      111  1         101371791     
jan 2006632111   11   521       12839241031 1  
out 20051           1         751772      
jul 20054111    11   3         69231521     
abr 200532111        32        57146311    
jan 20053221         1         311021      
out 20044432         321       159741     
jul 20042111         1         621       
abr 20041                     2         
jan 2004                      1      1  


Distribuição de edições de artigos por wikipedistas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...

Edições >=WikipedistasEdições total


27 wikipedistas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias

 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
30 dias
30 dias
30 dias
30 dias
Sushant savlaUC2 09,576312,0314nov 05, 200820931,380---
Ashok modhvadiaUC3 07,790573,45716ago 27, 200821631,3691--
DsvyasUC4 07,26946,6241dez 13, 2007242195---
KartikMistryUC10 01,4755371964jan 01, 201294121---
Akash96UC21 0496125-jul 20, 201274011---
RotlinkUC29 02754--nov 27, 2012610----
HaritoshUC36 0211914-jan 28, 20135482---
Nizil ShahUC66+171359-jun 30, 2008222151--
KokilaMistryUC223+83103127ago 21, 2013343----
VarlaamUC254+2581331mai 15, 20101537----
RxyUC287+38716-jul 09, 20111117----
Bhatt NandiniUC394...5522jul 01, 20142933--
MihirismUC491...44--jul 01, 20142911--
NirmalPathakUC622+25131--mai 29, 201462----
Mehta GoutamUC624...3322jul 02, 20142833--
Rathod BharatkumarUC625...33--jul 02, 201428----
Pratik.narolaUC875+64121--mai 12, 201479----
DikenlakhaniUC879...22--jul 09, 201421----
Hedwig in WashingtonUC880...224-jul 30, 2014 ----
Pradip garalaUC1540...11--jul 08, 201422----
Seddy9UC1541...11--jul 18, 201412----
KopiersperreUC1542...11--jul 20, 201410----
GiksmcUC1543...11--jul 21, 20149----
Jerzyjan1UC1544...11--jul 24, 20146----
Manojjoshi72UC1545...11--jul 29, 20141----
JeeteshvaishyaUC1546...11--jul 29, 20141----
Parmar ram punjaUC1547...11--jul 31, 2014 ----


20 wikipedistas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

  Primeira ediçãoúltima edição
સતિષચંદ્રUC150,303fev 15, 20082357jun 01, 201459
PSPatelUC53,836abr 29, 20091918dez 26, 2011947
Maharshi675UC62,666set 29, 20072496set 24, 2013309
વિહંગUC72,022jun 30, 2012760mar 03, 2014149
Harsh4101991UC81,750jan 22, 2012920dez 01, 2013241
Sam.lditeUC91,654set 15, 2012683jun 07, 2013418
SpundunUC111,259jul 21, 20043661mai 01, 20072647
જીતેન્દ્રસિંહUC121,216set 14, 20082145mar 10, 2014142
SunilUC131,129mar 05, 20101608ago 09, 2013355
TekinaUC141,081jun 08, 20111148jun 30, 2012760
Vyom25UC151,077nov 17, 2011986dez 10, 2013232
મહાથીUC16986set 22, 2013311fev 15, 2014165
DBhavsar709UC17735nov 08, 2012629ago 09, 2013355
Sanjay BalotiyaUC18597abr 13, 20111204abr 23, 201498
JaishreeUC19568fev 07, 20101634jul 18, 20101473
Rangilo GujaratiUC20560out 17, 20111017out 03, 2013300
V dasUC22458fev 20, 20101621out 29, 20101370
યોગેશ કવીશ્વરUC23446mai 17, 2013439mai 31, 201460
PranayUC24425mai 15, 20111172mar 13, 2012869
KsderasariUC25383set 02, 20101427dez 25, 2013217


Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 16.125 edições foram feitas por usuários anônimos, de um total de 269.631 edições ( 5e %)

50 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
GubotUC137,994mai 17, 20091900abr 05, 2014116--
HarshBotUC215,947set 27, 2012671nov 16, 2012621--
SamkbotUC312,482nov 23, 2012614jun 04, 2013421--
EmausBotUC48,767jul 09, 20101482jan 12, 2014199--
XqbotUC57,213jan 19, 20092018mai 06, 201485--
Luckas-botUC65,872nov 30, 20082068mai 20, 2012801--
SieBotUC74,148ago 18, 20072538jan 25, 20111282--
AddbotUC84,064mar 06, 2013511ago 27, 2013337--
MerlIwBotUC93,336abr 24, 20111193ago 08, 2013356--
TXiKiBoTUC103,282dez 12, 20062787dez 20, 2012587--
WikitanvirBotUC112,324out 20, 20101379mai 15, 2012806--
VolkovBotUC122,281abr 20, 20072658mar 04, 2013513--
ZéroBotUC132,274out 16, 20101383mar 06, 2013511--
MelancholieBotUC142,226abr 03, 20082309nov 28, 20091705--
EscarbotUC152,070jul 01, 20062951fev 07, 2013538--
ArthurBotUC161,603jan 07, 20092030out 07, 2012661--
ChuispastonBotUC171,377dez 14, 20101324abr 28, 2012823--
FoxBotUC181,337out 01, 20091763fev 04, 2012907--
JAnDbotUC191,199nov 08, 20062821jul 03, 2013392--
Thijs!botUC201,092dez 12, 20062787jul 30, 2012730--
KamikazeBotUC211,055jul 04, 20101487jan 26, 2013550--
RedBotUC22948set 01, 20101428ago 21, 2012708--
TjBotUC23792jun 01, 20101520mar 06, 2013511--
LegobotUC24651mar 11, 2013506abr 02, 2013484--
JotterbotUC25630jul 27, 20091829jan 22, 2013554--
AlexbotUC26623jan 30, 20082373ago 23, 20111072--
CommonsDelinkerUC27597mai 31, 20072617jul 31, 2014---
HRoestBotUC28589jun 19, 20101502mar 05, 2013512--
Idioma-botUC29586set 05, 20082154mar 03, 2013514--
LaaknorBotUC30555jul 27, 20082194mar 07, 2013510--
JackieBotUC31542out 21, 20101378jun 25, 201435--
YurikBotUC32534jan 07, 20063126ago 25, 20062896--
Ripchip BotUC33534mar 10, 20111238fev 17, 2012894--
PtbotgourouUC34521set 29, 20082130mar 05, 2013512--
SynthebotUC35519jun 07, 20082244jan 31, 2013545--
AlleborgoBotUC36515out 28, 20072467dez 03, 20082065--
Dinamik-botUC37494fev 07, 20101634dez 23, 2012584--
Movses-botUC38460dez 21, 20101317mar 18, 2012864--
RubinbotUC39452abr 06, 20091941mar 04, 2013513--
AvicBotUC40410jun 20, 20111136dez 09, 2012598--
YFdyh-botUC41379jun 20, 2012770fev 24, 2013521--
AvocatoBotUC42374out 21, 20111013fev 27, 2013518--
DragonBotUC43348out 19, 20072476fev 04, 2013541--
ZorrobotUC44343set 07, 20082152set 06, 2012692--
VagobotUC45341set 20, 20111044set 06, 2012692--
MastiBotUC46335nov 29, 20091704fev 28, 2013517--
MystBotUC47334mai 16, 20101536mar 03, 2012879--
CarsracBotUC48333nov 17, 20082081mar 01, 2013516--
PipepBotUC49326ago 20, 20072536jun 09, 20082242--
RobbotUC50325jul 08, 20053309jan 03, 2013573--


Artigos que contêm pelo menos uma ligação interna e .. caracteres de texto legível, não contando códigos wiki e html,
ligações ocultas, etc.; títulos também não contam  (excluindo páginas de redirecionamento)

 < 32 ch< 64 ch< 128 ch< 256 ch< 512 ch< 1 k ch< 2 k ch< 4 k ch< 8 k ch< 16 k ch< 32 k ch< 64 k ch
out 20100.1%0.3%1.1%9.8%48.6%89.6%93.5%95.9%97.0%97.8%98.6%99.6%
set 20100.1%0.3%1.2%10.2%50.9%89.8%93.8%96.2%97.2%97.9%98.7%99.6%
ago 20100.1%0.3%1.2%10.4%55.5%90.1%94.0%96.3%97.3%98.0%98.7%99.5%
jul 20100.2%0.4%1.3%11.2%59.1%90.6%94.4%96.7%97.7%98.3%98.9%99.6%
jun 20100.2%0.4%1.3%11.6%62.4%90.9%94.7%96.9%97.9%98.5%99.0%99.7%
mai 20100.2%0.4%1.4%12.2%66.6%91.3%95.0%97.2%98.2%98.8%99.2%99.8%
abr 20100.2%0.4%1.4%12.5%73.2%91.4%95.0%97.2%98.2%98.8%99.2%99.8%
mar 20100.2%0.4%1.4%13.0%78.6%91.3%94.9%97.1%98.1%98.6%99.0%99.6%
fev 20100.2%0.4%1.5%14.2%80.0%91.3%95.0%97.3%98.3%98.8%99.2%99.7%
jan 20100.2%0.4%1.6%14.8%80.5%91.4%95.0%97.3%98.3%98.8%99.2%99.6%
dez 20090.2%0.5%2.4%15.9%81.4%91.5%95.1%97.4%98.5%99.0%99.4%99.8%
nov 20090.2%0.5%3.4%16.4%81.0%91.3%95.1%97.5%98.6%99.1%99.5%99.9%
out 20090.2%0.5%3.6%17.7%80.3%90.9%94.8%97.2%98.4%98.9%99.3%99.7%
set 20090.3%0.7%5.2%21.3%80.0%91.1%95.1%97.4%98.6%99.1%99.5%99.8%
ago 20090.3%0.7%5.7%23.9%78.9%90.9%95.1%97.4%98.6%99.1%99.5%99.8%
jul 20090.4%0.9%6.3%26.8%77.4%90.5%95.0%97.4%98.7%99.2%99.6%99.9%
jun 20090.4%0.9%6.7%30.2%76.0%90.0%94.7%97.3%98.5%99.0%99.4%99.8%
mai 20090.5%1.1%7.4%33.5%76.5%90.3%95.0%97.8%99.1%99.7%100.0%100.0%
abr 20090.5%1.2%8.2%38.8%81.0%89.4%94.3%97.3%98.7%99.3%99.6%99.8%
mar 20090.8%1.9%12.3%57.4%76.8%85.8%92.7%96.7%98.8%99.5%99.9%100.0%
fev 20091.0%2.3%14.7%62.7%74.4%84.2%91.7%96.2%98.6%99.4%99.7%99.9%
jan 20091.0%2.4%15.2%62.9%74.8%84.3%91.7%96.2%98.7%99.5%99.8%100.0%
dez 20081.1%2.5%15.5%64.1%75.8%85.2%92.3%96.6%99.0%99.7%100.0%100.0%
nov 20081.1%2.5%15.6%64.8%76.4%85.6%92.6%96.6%98.8%99.5%99.9%100.0%
out 20081.1%2.6%16.0%66.6%77.9%86.6%92.9%96.8%98.9%99.7%100.0%100.0%
set 20081.2%2.7%16.4%68.4%79.7%88.0%93.9%97.2%98.9%99.6%99.9%100.0%
ago 20081.2%2.8%17.0%68.6%79.8%88.1%94.1%97.5%99.1%99.8%100.0%100.0%
jul 20081.8%4.1%22.2%65.1%75.6%85.5%93.1%96.9%98.8%99.6%100.0%100.0%
jun 20082.4%5.4%30.5%55.7%69.3%81.6%91.3%96.0%98.6%99.4%100.0%100.0%
mai 20083.1%6.6%20.6%47.0%63.1%78.1%89.2%95.0%98.1%99.0%99.7%99.8%
abr 20086.2%12.9%17.4%31.6%54.7%72.4%85.8%92.9%97.0%98.7%99.8%100.0%
mar 20086.8%14.3%19.7%34.6%58.7%73.4%86.1%92.7%96.6%98.3%99.8%100.0%
fev 20089.0%17.6%21.1%36.8%60.2%73.2%85.7%92.4%96.6%98.2%99.8%100.0%
jan 20088.7%17.1%19.9%34.7%58.1%71.8%84.5%91.9%96.2%98.2%99.7%100.0%
dez 20078.8%17.6%20.2%35.5%59.9%72.9%85.9%92.6%96.5%98.3%99.9%100.0%
nov 20079.3%17.8%20.7%36.6%61.2%73.9%86.6%92.7%96.4%98.3%99.9%100.0%
out 20079.3%17.8%20.7%36.9%61.3%74.0%86.7%92.5%96.2%98.1%99.7%100.0%
set 20070.3%2.8%6.0%25.2%54.5%69.3%84.4%91.0%95.4%97.6%99.5%99.8%
ago 20070.3%2.5%6.0%25.2%55.2%69.9%84.3%91.3%95.5%97.7%99.6%99.9%
jul 20070.3%2.5%6.0%25.2%55.9%70.3%84.4%91.4%95.6%97.8%99.7%100.0%
jun 20070.6%2.8%6.3%26.0%56.3%70.6%84.3%91.3%95.4%97.6%99.5%99.8%
mai 20070.6%3.2%6.7%26.7%56.7%70.2%84.1%91.2%95.4%97.7%99.6%99.9%
abr 20070.7%3.4%6.8%27.5%58.0%72.2%86.4%93.2%96.6%98.3%100.0%100.0%
mar 20070.4%3.5%9.2%31.0%59.7%73.9%88.1%95.4%98.1%98.5%100.0%100.0%
fev 20071.3%2.6%7.2%29.0%58.0%73.1%87.4%95.4%97.9%98.3%100.0%100.0%
jan 20072.2%3.5%8.4%30.8%61.7%76.0%89.0%95.7%97.5%97.9%99.7%99.7%
dez 20062.3%3.7%8.7%31.2%62.4%75.7%89.0%95.9%97.7%98.2%100.0%100.0%
nov 20061.9%2.4%6.7%29.7%61.8%76.2%89.1%95.8%97.7%98.2%100.0%100.0%
out 20061.4%1.9%6.2%29.2%61.7%76.1%89.0%95.7%97.6%98.1%100.0%100.0%
set 20061.0%1.5%6.4%31.8%63.0%78.1%88.8%95.6%97.6%98.1%100.0%100.0%
ago 20061.0%1.5%5.9%31.9%62.8%78.5%88.8%95.7%97.7%98.2%100.0%100.0%
jul 20061.0%1.5%5.9%31.9%62.8%78.5%88.8%95.7%97.7%98.2%100.0%100.0%
jun 20061.0%1.5%6.9%32.4%62.8%78.5%88.8%95.7%97.7%98.2%100.0%100.0%
mai 20060.5%1.0%6.4%32.1%62.8%78.6%89.0%95.4%97.4%97.9%99.9%99.9%
abr 20060.5%1.0%6.4%32.1%63.3%79.1%90.0%95.4%97.4%97.9%99.9%99.9%
mar 20060.5%1.0%6.0%32.2%63.4%79.2%90.1%95.5%97.5%98.0%100.0%100.0%
fev 20060.5%1.0%6.0%32.2%62.9%79.2%90.1%95.5%97.5%98.0%100.0%100.0%
jan 20060.5%1.0%6.0%32.4%62.7%79.1%90.5%95.5%97.5%98.0%100.0%100.0%
dez 20050.5%1.6%6.5%33.3%64.4%79.2%89.6%94.5%96.7%97.2%99.9%99.9%
nov 20050.7%2.1%8.3%27.5%58.3%74.1%87.8%93.3%96.0%96.7%100.0%100.0%
out 20050.7%2.8%7.0%26.4%58.3%73.6%87.5%93.1%95.9%96.6%100.0%100.0%
set 20050.7%2.1%6.3%25.9%58.1%73.5%87.5%93.1%95.9%96.6%100.0%100.0%
ago 20050.7%2.1%6.3%25.9%58.1%73.5%87.5%93.1%95.9%96.6%100.0%100.0%
jul 20050.7%2.1%6.3%25.9%58.1%73.5%87.5%93.1%95.9%96.6%100.0%100.0%
jun 20050.7%2.1%6.3%25.9%58.1%73.5%87.5%93.1%95.9%96.6%100.0%100.0%
mai 20051.1%4.3%11.7%26.6%52.1%68.1%86.2%93.6%95.7%97.8%99.9%99.9%
abr 20050.0%4.6%9.2%27.7%58.5%75.4%93.9%97.0%98.5%98.5%100.0%100.0%
mar 20053.6%9.0%14.4%35.8%66.2%80.5%94.8%98.4%100.0%100.0%100.0%100.0%
fev 20053.2%9.7%22.6%45.2%64.6%80.7%90.4%96.9%100.0%100.0%100.0%100.0%
jan 20053.3%10.0%23.3%46.6%66.6%83.3%93.3%96.6%99.9%99.9%99.9%99.9%
dez 20043.6%10.7%25.0%46.4%64.3%82.2%92.9%96.5%100.0%100.0%100.0%100.0%
nov 20045.0%15.0%30.0%45.0%70.0%85.0%90.0%95.0%100.0%100.0%100.0%100.0%
out 200418.2%45.5%45.5%54.6%63.7%91.0%91.0%100.0%100.0%100.0%100.0%100.0%
set 200425.0%37.5%37.5%50.0%75.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
ago 200437.5%37.5%37.5%50.0%62.5%87.5%87.5%100.0%100.0%100.0%100.0%100.0%
jul 20040.0%0.0%0.0%20.0%40.0%80.0%80.0%100.0%100.0%100.0%100.0%100.0%


Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.

See also Category Overview Complete

categorizados 1
jul 201427 k1,7 k7952941014,2 k111,1 k       1525342191
jun 201427 k1,7 k7602941014,2 k111,1 k       1525342191
mai 201427 k1,6 k7392941004,2 k111,1 k       1525342191
abr 201427 k1,6 k708294994,2 k111,1 k       1525342191
mar 201427 k1,6 k673293994,2 k101,1 k       1525342181
fev 201427 k1,6 k616293994,2 k91,1 k      5011525342181
jan 201427 k1,6 k595293994,1 k91,1 k      12121525342181
dez 201327 k1,6 k572293994,1 k91,1 k      17931525342181
nov 201326 k1,6 k557293984,1 k91,1 k      29461525342181
out 201325 k1,6 k545292984,1 k91,0 k      29981525342171
set 201324 k1,5 k518292984,0 k91,0 k      10401525342171
ago 201324 k1,5 k497292984,0 k91,0 k      5241525342171
jul 201324 k1,5 k476292984,0 k91,0 k      5091525342171
jun 201324 k1,5 k442292984,0 k91,0 k      8231525342171
mai 201324 k1,5 k416292984,0 k9992      7771525342171
abr 201324 k1,4 k380292984,0 k9978      4061525342171
mar 201324 k1,4 k332292974,0 k9977      8681525342171
fev 201324 k1,4 k303292973,9 k9968      15191525342171
jan 201324 k1,4 k279292973,9 k9955      11431525342171
dez 201224 k1,3 k242292953,9 k9950      22601525342171
nov 201224 k1,3 k212291893,7 k8899      11491525242171
out 201224 k1,3 k200291873,6 k8865      8251525242171
set 201223 k1,2 k189291843,5 k8854      8361525242171
ago 201223 k1,2 k156290843,5 k8846      5231525242161
jul 201223 k1,2 k141290843,4 k8845      6931525242161
jun 201223 k1,2 k138290833,3 k8836      13781525242161
mai 201223 k1,1 k136290773,0 k8829      13281525242161
abr 201223 k1,1 k133290772,7 k6819      7021525242161
mar 201223 k1,1 k131286772,5 k6811      48515252 2161
fev 201223 k1,0 k128278772,5 k6807      87115250 2101
jan 201223 k1,0 k124278772,4 k6803      158215250 2101
dez 201123 k979122275772,4 k6770      168015247 2101
nov 201123 k960122272772,2 k6728      122815244 2101
out 201123 k925121272772,2 k6718      149415244 2101
set 201122 k906118268772,2 k6709      152215241 291
ago 201122 k886115268772,2 k6698      107915241 291
jul 201122 k870115267772,2 k6695      171315241 281
jun 201121 k848115267772,1 k5691      173815241 281
mai 201121 k831113262772,1 k5687      203315236 281
abr 201121 k811111257772,1 k5681      204715231 281
mar 201120 k794111255772,1 k5671      223915229 281
fev 201120 k780111250772,1 k5664      153815224 281
jan 201119 k761111244772,1 k5660      246115218 281
dez 201019 k742109237772,0 k5625      199615211 281
nov 201018 k730109235772,0 k5618      228715209 281
out 201018 k716109235772,0 k5608      225215209 281
set 201018 k703105235771,9 k5593      261215209 281
ago 201017 k689105235771,9 k5584      291515209 281
jul 201016 k655103231771,9 k5566      199115206 28 
jun 201016 k641102223771,8 k5548      240015198 28 
mai 201016 k607102220771,8 k5534      292315196 18 
abr 201015 k594102217771,8 k5506      253015193 18 
mar 201015 k578102215771,8 k5491      368314192 18 
fev 201014 k552101191771,8 k5473      302314168 18 
jan 201013 k538101184771,8 k5414      306514161 18 
dez 200912 k516100182771,7 k5396      267414159 18 
nov 200912 k506100178771,7 k5377      214614155 18 
out 200911 k490100177771,7 k5366      215414154 18 
set 200910,0 k485100177771,7 k5349      240014154 18 
ago 20098,7 k470100177771,6 k5304      187614154 18 
jul 20097,7 k44699173771,6 k5268      128414150 18 
jun 20096,9 k42898153771,6 k5246      127214130 18 
mai 20096,2 k41898142771,6 k5227      140914119 18 
abr 20095,4 k41096139771,5 k5202      222014116 18 
mar 20093,5 k39496120771,5 k5152      10891497 18 
fev 20092,9 k38593115771,5 k5120      3251492 18 
jan 20092,8 k37192115771,5 k5119      3261492 18 
dez 20082,8 k35889112771,5 k5115      2331489 18 
nov 20082,8 k34889112771,5 k5114      3341489 18 
out 20082,7 k3258894771,4 k5108      3971473 16 
set 20082,7 k3028682771,4 k599      4291462 15 
ago 20082,6 k2898666771,4 k482      937357 15 
jul 20081,9 k2748663771,4 k478      708354 15 
jun 20081,4 k2558561771,4 k477      614352 15 
mai 20081,2 k2318561771,4 k372      845352 15 
abr 20086682198454771,3 k372      221345 15 
mar 20086152128454771,3 k370      301345 15 
fev 20085711988444761,3 k357      192335 15 
jan 20085381938343741,3 k357      174235 15 
dez 20075251848137741,3 k357      147230 14 
nov 20075081787932741,2 k357      37225 14 
out 20074951737829741,2 k357      25222 14 
set 20074441617126741,1 k351      28219 14 
ago 20074291576820741,1 k351      11114 14 
jul 20074251496520741,1 k251      14114 14 
jun 20074241456420741,1 k251      51114 14 
mai 20074191406415741,1 k249      9119 14 
abr 20074021356315731,0 k248      20819 14 
mar 2007352124551219986137      23916 14 
fev 2007323114511018922136      9514 14 
jan 200730510450618912136      41  14 
dez 200630210250518596136      151   4 
nov 20062979550418588136      2    4 
out 20062969450418574136      33    4 
set 20062919150418573136      3    4 
ago 20062878849418572136      3    4 
jul 20062848149418568136      4    4 
jun 20062827849418566135      7    4 
mai 20062807749418553135      13    4 
abr 20062787349418552135      4    4 
mar 20062767249418544135      2    4 
fev 20062727049418536135      8    4 
jan 20062716849418459135      179    4 
dez 20052434545418371 30      123    4 
nov 20051934445417317 29      13    4 
out 20051904045417315 28      2    4 
set 20051893845417310 28      7    4 
ago 20051873645417309 28      7    4 
jul 20051873443417303 28      17    4 
jun 20051873042417299 28      445    4 
mai 20051092931317244 23      285    3 
abr 2005772629217148 20      62    2 
mar 200570222621757 13      94    2 
fev 200547212521743 2      16    2 
jan 200542172521733 2      27    2 
dez 200436162421732 2      45    2 
nov 200427142221628 2      52    2 
out 200418132021621 2      38    2 
set 200415915 1613 1      35      
ago 200410611 155               
jul 2004749 155               
jun 2004348 153               
mai 2004228 103               
abr 2004224 63               
mar 20042 3 62               
fev 20042 1 62               
jan 20042   62               
dez 20031    1               


Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons



For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

jan 2004: 1 1 HomePage

mar 2004: 1 1 મુખપૃષ્ઠ

abr 2004: 1 1 મુખપૃષ્ઠ

mai 2004: 1 1 મુખપૃષ્ઠ

jul 2004: 1 2 મુખપૃષ્ઠ , 2 1 પ્રતિજ્ઞા પત્ર

ago 2004: 1 1 મહાત્મા ગાંધી

set 2004: 1 2 ગુજરાત , 2 1 Main Page

out 2004: 1 3 જાળસ્થળો ની યાદી , 2 2 ભારત , 3 2 મીરાંબાઈ

nov 2004: 1 3 જાળસ્થળો ની યાદી , 2 3 મુખપૃષ્ઠ , 3 2 પાકિસ્તાન , 4 2 ૧૯૯૩ , 5 1 દયારામ

dez 2004: 1 3 જાળસ્થળો ની યાદી , 2 2 બિહાર , 3 2 વર્જિન એટલાંટિક , 4 1 વેલિંગ્ટન

jan 2005: 1 2 આસામ

fev 2005: 1 2 ગૉડફ્રે હારૉલ્ડ હાર્ડિ , 2 2 અમદાવાદ

mar 2005: 1 2 ઐશ્વર્યા રાય , 2 2 જગદીશચંદ્ર બોઝ , 3 2 આશિત દેસાઈ , 4 2 નરેન્દ્ર મોદી , 5 2 મીરાંબાઈ , 6 1 અબૅલ

abr 2005: 1 2 મહાત્મા ગાંધી , 2 2 મુખપૃષ્ઠ , 3 1 ભારત

mai 2005: 1 3 ભુજ , 2 3 વડોદરા , 3 2 ચંદ્ર , 4 2 કાર્બન , 5 2 મોહનદાસ કરમચંદ ગાંધી , 6 2 સૂર્યમંડળ , 7 2 ભારતના વડાપ્રધાન , 8 2 ભારતના રાષ્ટ્રપતિ , 9 1 ભારત

jun 2005: 1 3 નક્ષત્ર , 2 3 અમદાવાદ , 3 2 ભારત , 4 2 છત્તીસગઢ , 5 2 મધ્ય પ્રદેશ , 6 2 મહારાષ્ટ્ર , 7 2 બળ , 8 2 દળ , 9 2 તરંગલંબાઇ , 10 2 વિદ્યુત-ચુંબકીય તરંગો , 11 2 ગંગા નદી , 12 2 ક્ષ-કિરણો , 13 2 ધૂમકેતુ , 14 2 ઉષ્મા

jul 2005: 1 1 ધૂમકેતુ

ago 2005: 1 1 ભૂમિતિ

set 2005: 1 1 ખગોળ શાસ્ત્ર

out 2005: 1 1 જન ગણ મન

nov 2005: 1 1 ઇમરાન ખાન

dez 2005: 1 2 ચલાલા (તા. ધારી) , 2 2 લોકશાહી , 3 1 ભારત

jan 2006: 1 3 કેટલાક જાણીતા ગુજરાતીઓ , 2 2 ગાંધીનગર , 3 2 સાબરકાંઠા જિલ્લો , 4 2 ચલાલા (તા. ધારી) , 5 2 ઇમરાન ખાન , 6 2 હિન્દુ-અરેબીક અંકો , 7 2 અમિતાભ બચ્ચન , 8 2 ગુજરાત , 9 1 ભારત

fev 2006: 1 2 સુરત , 2 1 રોટલી

mar 2006: 1 1 ઇસ્‍લામ

abr 2006: 1 1 ભારત

mai 2006: 1 2 કનૈયાલાલ મુનશી , 2 1 હીન્દી

jun 2006: 1 1 રમેશ પારેખ

jul 2006: 1 1 પાલનપુર

ago 2006: 1 1 ગાંધી આશ્રમ

set 2006: 1 1 સત્ય ઇસુ દેવળ

out 2006: 1 2 રાની મુખર્જી , 2 1 યાક

nov 2006: 1 1 ચીન

dez 2006: 1 1 નેપાલ સ્કાઉટ

jan 2007: 1 1 મુખપૃષ્ઠ/જુનું-૧

fev 2007: 1 2 ભારતના ભાગલા , 2 2 ચાણક્ય , 3 2 રામાયણ , 4 1 શ્રીમદ્ ભગવદ્ ગીતા

mar 2007: 1 3 મુખપૃષ્ઠ/જુનું-૧ , 2 2 વાદળ , 3 2 સંસ્કૃત ભાષા , 4 2 કુરોવ , 5 2 વેગમાન સંરક્ષણનો નિયમ , 6 2 કાઠમંડુ , 7 2 મૌર્ય વંશ , 8 2 રામાયણ , 9 2 વંદે માતરમ્ , 10 1 ભારત

abr 2007: 1 3 સરદાર પટેલ , 2 3 સુભાષચંદ્ર બોઝ , 3 3 સ્વામી વિવેકાનંદ , 4 3 અકબર , 5 3 અશોક , 6 3 આર્યભટ્ટ , 7 3 કાલિદાસ , 8 2 ભારત , 9 2 કરમસદ , 10 2 રાજા રવિ વર્મા

mai 2007: 1 2 સરદાર પટેલ , 2 2 મહાભારત , 3 2 સુરત , 4 2 અમદાવાદ , 5 1 યજ્ઞ

jun 2007: 1 2 ભારત , 2 2 સંયુક્ત રાજ્ય અમેરિકા , 3 2 જામનગર , 4 2 ગુજરાત

jul 2007: 1 1 ભરૂચ

ago 2007: 1 1 સંસ્કૃત

set 2007: 1 1 રવિશંકર રાવળ

out 2007: 1 1 લોયાધામ

nov 2007: 1 1 ઝૂલતા મિનારા

dez 2007: 1 4 ગુજરાત , 2 2 વડનગર , 3 1 ચૈતન્ય મહાપ્રભુ

jan 2008: 1 5 ગુજરાત , 2 3 સત્ય ઇસુ દેવળ , 3 2 બાઇબલ , 4 2 ઇસ્કોન , 5 2 દાળ , 6 2 અમેરિકન ગૅંગ્સ્ટર , 7 1 ભારત

fev 2008: 1 2 ભારત , 2 2 સંગણક , 3 2 વડોદરા જિલ્લો , 4 2 રાજકોટ જિલ્લો , 5 2 રણોત્સવ , 6 2 ડેબિયન , 7 2 મરાઠી લોકો , 8 2 બ્રિટીશ એશિયન , 9 2 અમરેલી , 10 2 વઘઇ

mar 2008: 1 3 નરસિંહ મહેતા , 2 2 ઉમરગામ , 3 2 વ્યારા , 4 2 આદિવાસી , 5 2 ઝઘડીયા , 6 2 તિથલ , 7 2 નારેશ્વર , 8 2 હાલોલ તાલુકો , 9 2 ઉનાઇ , 10 2 પંચમહાલ જિલ્લો , 11 2 બીગરી , 12 2 મઢી , 13 2 ભગવદ્ ગીતા , 14 2 લોયા , 15 2 ઇશ્વર પેટલીકર , 16 2 કલાપી , 17 2 દલપતરામ , 18 2 મનસુખલાલ ઝવેરી , 19 2 કે. કા. શાસ્ત્રી , 20 2 નાનાભાઈ ભટ્ટ , 21 2 બકુલ ત્રિપાઠી , 22 2 ભગવતીકુમાર શર્મા , 23 2 તારક મહેતા , 24 2 નિર્મિશ ઠાકર , 25 2 ધીરુબેન પટેલ

abr 2008: 1 3 હિંદુ ધર્મ , 2 2 વીર નર્મદ દક્ષિણ ગુજરાત યુનિવર્સિટી, સુરત , 3 2 રામનવમી , 4 2 હનુમાન ચાલીસા , 5 2 ત્રિકમ સાહેબ , 6 2 રંગ અવધૂત , 7 2 દાસી જીવણ , 8 2 ભિક્ષુ અખંડાનંદ , 9 2 શ્રીમદ્ રાજચંદ્ર , 10 2 પૂ. મોટા , 11 2 પુનિત મહારાજ , 12 2 પૃથિવીવલ્લભ , 13 2 સત્યના પ્રયોગો અથવા આત્મકથા , 14 2 જ્યોતીન્દ્ર હ. દવે , 15 2 સાત પગલાં આકાશમાં , 16 1 ખીજડીયા

mai 2008: 1 5 બગસરા , 2 3 ગણેશ , 3 3 શિવ , 4 3 ઓખાહરણ , 5 3 સી. વી. રામન , 6 3 વીણા , 7 3 વલ્લભાચાર્ય , 8 3 નેલ્સન મંડેલા , 9 3 સિહોર , 10 3 હિંદુ ધર્મ , 11 3 અમદાવાદ , 12 2 આઇઝેક ન્યુટન , 13 2 માઉન્ટ આબુ , 14 2 મિર્ઝા ગ઼ાલિબ , 15 2 રતન તાતા , 16 2 સોનીપત જિલ્લો , 17 2 રોહતક જિલ્લો , 18 2 સિરસા જિલ્લો , 19 2 કરનાલ જિલ્લો , 20 2 ફરીદાબાદ જિલ્લો , 21 2 યમુનાનગર જિલ્લો , 22 2 પાનીપત જિલ્લો , 23 2 અંબાલા જિલ્લો , 24 2 કરસનભાઇ પટેલ , 25 2 પશ્ચિમી સિંહભૂમ જિલ્લો

jun 2008: 1 4 આસારામ બાપુ , 2 3 બાલાસિનોર ગોળ ભાવસાર સમાજ , 3 3 અંજા જિલ્લો , 4 3 લખનૌ , 5 3 ઇટાનગર , 6 3 ઓખાહરણ , 7 3 ઝવેરચંદ મેઘાણી , 8 3 સુરત , 9 2 ગાઝિયાબાદ , 10 2 નેધરલેંડ , 11 2 બ્લૉગ , 12 2 હંસ , 13 2 અત્રિ , 14 2 ભારદ્વાજ , 15 2 અગસ્ત્ય , 16 2 કુર્નૂલ જિલ્લો , 17 2 પશ્ચિમ ગોદાવરી જિલ્લો , 18 2 પૂર્વ ગોદાવરી જિલ્લો , 19 2 નાલગોંડા જિલ્લો , 20 2 નેલ્લોર જિલ્લો , 21 2 પ્રકાસમ જિલ્લો , 22 2 રંગારેડ્ડી જિલ્લો , 23 2 ચિત્તૂર જિલ્લો , 24 1 બસ્તી

jul 2008: 1 3 ઉલૂપી , 2 3 ભીષ્મ , 3 3 શાંતનુ , 4 3 પુરી જિલ્લો , 5 3 નવોદય વિદ્યાલય , 6 3 ગુજરાત , 7 2 ઉત્તરા , 8 2 અંબાલિકા , 9 2 અંબિકા , 10 2 વિચિત્રવિર્ય , 11 2 નાગેશ્વર , 12 2 અર્જુન , 13 2 ચિત્રાંગદા , 14 2 ચિત્રાંગદ , 15 2 ત્ર્યંબકેશ્વર , 16 2 તમિલ ભાષા , 17 2 કારેલું , 18 2 દૂધી , 19 2 સફરજન , 20 2 રીંગણ , 21 2 જાન્યુઆરી ૩૦ , 22 2 સિરોહી , 23 2 સવાઇ માધોપુર , 24 2 સિકર , 25 1 સિમન્ટેક વૅબ ક્રૉલીંગ

ago 2008: 1 4 જુનાગઢ , 2 3 પાલનપુર , 3 2 આસો , 4 2 અષાઢ , 5 2 ડિસેમ્બર , 6 2 નવેમ્બર , 7 2 ઓક્ટોબર , 8 2 સપ્ટેમ્બર , 9 2 ઓગસ્ટ , 10 2 જુલાઇ , 11 2 જૂન , 12 2 મે , 13 2 એપ્રિલ , 14 2 માર્ચ , 15 2 ફેબ્રુઆરી , 16 2 જાન્યુઆરી , 17 2 મૈથિલી ભાષા , 18 2 કસ્તુરબા , 19 2 સંજય , 20 2 ભવભૂતિ , 21 2 ગયા , 22 2 ભોજપુરી ભાષા , 23 1 ભેંસાણ, જૂનાગઢ જિલ્લો

set 2008: 1 3 મિથુન રાશી , 2 3 વૃષભ રાશી , 3 3 મેષ રાશી , 4 3 રાશી , 5 3 શ્રી નાથજીદાદાની જગ્યા - દાણીધાર , 6 3 જામનગર જિલ્લો , 7 2 મહાબળેશ્વર , 8 2 કલિંગનુ યુધ્ધ , 9 2 કૃષ્ણા નદી , 10 2 ભક્ત કવિઓ , 11 2 કાળું કાણું , 12 2 મીન રાશી , 13 2 કુંભ રાશી , 14 2 વૃશ્ચિક રાશી , 15 2 કન્યા રાશી , 16 2 સિંહ રાશી , 17 2 કર્ક રાશી , 18 2 ગજહ મદ , 19 2 વેદવ્યાસ , 20 2 ખેડા , 21 2 વિક્રમ સંવત , 22 2 સાતારા જિલ્લો , 23 2 ડૉ. ભીમરાવ રામજી આંબેડકર , 24 2 ઉપનિષદ , 25 1 પાટણ, મહારાષ્ટ્ર

out 2008: 1 3 ગુજરાત , 2 2 ધન તેરસ , 3 2 પ્રાથમિક સારવાર , 4 2 દીપ , 5 2 પંચાંગ , 6 2 વાઘ બારસ , 7 2 નોબેલ પારિતોષિક વડે સન્માનીત મહિલાઓ , 8 2 ભારતનાં વિશ્વ ધરોહર સ્થળો , 9 2 દશેરા , 10 2 રામચકલી-પીળી ચોટલી , 11 2 દિવાળી , 12 2 ભીષ્મ , 13 2 શનિદેવ , 14 2 ધોરાજી , 15 2 ગુજરાતના મુખ્યમંત્રીઓ , 16 2 પોરબંદર જિલ્લો , 17 2 મહેસાણા , 18 2 અશોક , 19 2 ગિરનાર , 20 2 બનાસકાંઠા જિલ્લો , 21 2 રાજકોટ , 22 1 નોબેલ પારિતોષિક વડે સન્માનીત મહાનુભાવો

nov 2008: 1 3 આદિલ મન્સુરી , 2 3 ભરૂચ , 3 2 સર પ્રભાશંકર પટ્ટણી , 4 2 કાર્બ્યુરેટર , 5 2 અચલેશ્વર , 6 2 ચિત્રવિચિત્રનો મેળો , 7 2 ઉપગ્રહ પ્રક્ષેપણ યાન , 8 2 ગીતા પ્રેસ , 9 2 પ્રમબનન , 10 2 વિસાવાડા , 11 2 ભગત સિંહ , 12 2 અભિમન્યુ , 13 2 શ્રી નાથજીદાદાની જગ્યા - દાણીધાર , 14 2 અબુલ ફઝલ

dez 2008: 1 3 દેવાયત પંડિત , 2 3 મદીના , 3 3 મક્કા , 4 3 નવા સુદાસણા , 5 3 રાવણ , 6 3 નરસિંહ મહેતા , 7 2 લીરબાઈ , 8 2 હમીરજી ગોહિલ , 9 2 ઝીંઝરી , 10 2 કેરી , 11 2 કમળ , 12 2 વડ , 13 2 માણાવદર , 14 2 અંશુમાન ગાયકવાડ , 15 2 દ્વારકા , 16 2 ભીષ્મ , 17 2 ગાયત્રી , 18 2 શિવ , 19 2 કુતિયાણા , 20 2 અંજીર , 21 2 દાસી જીવણ , 22 2 ભારત , 23 2 હેમચંદ્રાચાર્ય , 24 2 ઇસ્લામ , 25 1 ખરોિલ

jan 2009: 1 4 કનકાઈ-ગીર , 2 3 પ્રબોધિની એકાદશી , 3 3 જુનાગઢ , 4 2 અડાલજની વાવ , 5 2 કાળાપાણ , 6 2 મકર સંક્રાંતિ , 7 2 કામદા એકાદશી , 8 2 પાપમોચિની એકાદશી , 9 2 આમલકી એકાદશી , 10 2 જયા એકાદશી , 11 2 ષટતિલા એકાદશી , 12 2 પુત્રદા એકાદશી , 13 2 સફલા એકાદશી , 14 2 મોક્ષદા એકાદશી , 15 2 ઉત્પતિ એકાદશી , 16 2 બહાદુર શાહ ઝફર , 17 2 એકાદશી વ્રત , 18 2 આગ્રાનો કિલ્લો , 19 2 ગુરુત્વાકર્ષણ , 20 1 કે.લાલ

fev 2009: 1 3 અવાજની ઝડપ , 2 3 તારાપુર , 3 3 વડ , 4 3 નોબેલ પારિતોષિક વડે સન્માનીત મહિલાઓ , 5 3 સ્વામી વિવેકાનંદ , 6 2 અપ્પુઘર , 7 2 વિશ્વની સાત મોટી ભૂલો , 8 2 અંબિકા નદી , 9 2 નવનીત મદ્રાસી , 10 2 વલંદી, વલસાડ તાલુકો , 11 2 વાંકલ, વલસાડ તાલુકો , 12 2 વેજલપોર, વલસાડ તાલુકો , 13 2 અબ્રામા, વલસાડ તાલુકો , 14 2 સારંગપુર, વલસાડ તાલુકો , 15 2 કુબેર , 16 2 ભગવદ્ગોમંડલ , 17 2 ઝાઝરકા , 18 2 બાગેફિરદોશ કમ્યુનિટિ હોલ,સી.ટી.એમ. , 19 2 કે.લાલ , 20 2 એરિસ્ટોટલ , 21 1 વાંઝણા

mar 2009: 1 4 ક્ષત્રિય , 2 3 બોપલ , 3 3 જાન્યુઆરી ૧ , 4 3 માર્ચ ૨૪ , 5 3 વિશ્વ જળ દિન , 6 3 સારાવાક ગુફા , 7 3 નાસિક , 8 3 નથુરામ ગોડસે , 9 2 માર્ચ ૨૩ , 10 2 સિદ્ધગિરિ ગ્રામજીવન સંગ્રહાલય , 11 2 માર્ચ ૨૧ , 12 2 ઓગસ્ટ ૧૫ , 13 2 વિશ્વ ક્ષય દિન , 14 2 આંતરરાષ્ટ્રીય મહિલા દિન , 15 2 માર્ચ ૧૨ , 16 2 માર્ચ ૮ , 17 2 માર્ચ ૨૦ , 18 2 માર્ચ ૨૨ , 19 2 ઔદિચ્ય બ્રાહ્મણ , 20 2 પ્રહલાદ , 21 2 શનિવાર , 22 2 શુક્રવાર , 23 1 સાદડવેરા

abr 2009: 1 4 રાજકોટ , 2 3 ગીઝાનો મહાન પિરામિડ , 3 3 પિરામિડ , 4 2 વૈશાખ સુદ ૬ , 5 2 એપ્રિલ ૨૭ , 6 2 ચૈત્ર વદ ૦)) , 7 2 પ્રમુખ સ્વામી , 8 2 એપ્રિલ ૨૨ , 9 2 એપ્રિલ ૨૦ , 10 2 એપ્રિલ ૨૧ , 11 2 કુતુબ મિનાર , 12 2 એપ્રિલ ૧૪ , 13 2 ખારાઘોડા , 14 2 પીઝાનો ઢળતો મિનારો , 15 2 સરદાર પટેલ યુનિવર્સિટી , 16 2 એપ્રિલ ૧૦ , 17 2 એપ્રિલ ૯ , 18 2 એપ્રિલ ૮ , 19 2 આજી નદી , 20 2 ચૈત્ર સુદ ૧૧ , 21 2 ચૈત્ર સુદ ૯ , 22 2 એપ્રિલ ૨ , 23 2 એપ્રિલ ફૂલ્સ ડે , 24 2 ભીચરી , 25 2 મંગળના ચંદ્રો

mai 2009: 1 4 ગુજરાત , 2 3 બોલપેન , 3 2 ઉપાસની મહારાજ , 4 2 ૧૦ (અંક) , 5 2 ૧૦૨ (અંક) , 6 2 આંબેડકર નેશનલ કોંગ્રેસ , 7 2 કાચબો , 8 2 સંચળ , 9 2 મે ૧૧ , 10 2 મે ૯ , 11 2 ગુજરાતના અભયારણ્યો તથા રાષ્ટ્રીય ઉદ્યાનો , 12 2 મે ૬ , 13 2 આંતરરાષ્ટ્રીય પરીચારિકા દિવસ , 14 2 આંતરરાષ્ટ્રીય દાયણ દિવસ , 15 2 મે ૫ , 16 2 મે ૪ , 17 2 મે ૨ , 18 2 મે ૧ , 19 2 શક્તિ દર્શનમ્ , 20 2 વિરસા મુંડા , 21 2 કઠોર (કામરેજ) , 22 2 રાજપૂત , 23 2 કોલોસીયમ , 24 2 ભગવદ્ગોમંડલ , 25 2 હઠ યોગ

jun 2009: 1 3 ઇજનેરી , 2 3 ટેક્લોબેન , 3 3 બાહુબલી , 4 3 માઉન્ટ એવરેસ્ટ , 5 3 કંથારીયા (તા.ભરૂચ) , 6 3 કેરી , 7 3 શ્રી નાથજીદાદાની જગ્યા - દાણીધાર , 8 3 વેરાવળ , 9 3 ખોડિયાર , 10 3 નવકાર મંત્ર , 11 2 અષાઢ સુદ ૬ , 12 2 વાર , 13 2 માઇકલ જેકસન , 14 2 વૈશ્વિક સ્થળનિર્ધારણ પ્રણાલી , 15 2 અષાઢ સુદ ૨ , 16 2 બેસતુ વર્ષ , 17 2 પાંડુરંગ શાસ્ત્રી આઠવલે , 18 2 જૂન ૧૩ , 19 2 શુકલતીર્થ , 20 2 બિલ ગેટ્સ , 21 2 છાણીયું ખાતર , 22 2 જેઠ વદ ૪ , 23 2 જેઠ સુદ ૧૫ , 24 2 નગોદ (કામરેજ) , 25 2 નેત્રંગ

jul 2009: 1 5 ગાંઠીયા , 2 4 બાહુબલી , 3 4 શ્રી નિષ્કલંક મહાદેવ કોળિયાક , 4 3 ઉરુગ્વે , 5 3 અષાઢ સુદ ૧૧ , 6 3 હાલોલ તાલુકો , 7 3 ગુજરાતી સાહિત્યકારો , 8 2 અમરસિંહ ચૌધરી , 9 2 શ્રાવણ સુદ ૭ , 10 2 શ્રાવણ સુદ ૬ , 11 2 શ્રાવણ સુદ ૫ , 12 2 સુરીનામ , 13 2 ભીખુદાન ગઢવી , 14 2 સાબરમતી આશ્રમ , 15 2 જુલાઇ ૨૧ , 16 2 મહાત્મા ગાંધી સેતુ (બિહાર) , 17 2 ગુજરાતી ભોજન , 18 2 અષાઢ વદ ૯ , 19 2 બાજરો , 20 2 અષાઢ સુદ ૧૫ , 21 2 અષાઢ સુદ ૧૩ , 22 2 બાર્ટન પુસ્તકાલય , 23 2 બાંદ્રા-વરલી સમુદ્રસેતુ , 24 2 એપ્રિલ ફૂલ્સ ડે , 25 2 ખરોલિ

ago 2009: 1 7 રોઝવા (તા. છોટાઉદેપુર) , 2 6 રોઝકુવા (તા. છોટાઉદેપુર) , 3 6 વલ્લભભાઈ પટેલ , 4 6 તુલસીદાસ , 5 5 રાણીખેડા , 6 5 ઓળી આંબા (તા. છોટાઉદેપુર) , 7 5 નાના રામપુરા (તા. છોટાઉદેપુર) , 8 5 સીમળ ફળીયા (તા. છોટાઉદેપુર) , 9 5 રૂનવાડ (તા. છોટાઉદેપુર) , 10 5 બ્લેકપૂલનો ટાવર , 11 5 કચ્છ જિલ્લો , 12 4 સીંગળાજા , 13 4 રીંછવેલ (તા. છોટાઉદેપુર) , 14 4 રાયસીંગપુરા (હરવાંટ) , 15 4 પુનીયાવાંટ , 16 4 પોટીયા (તા. છોટાઉદેપુર) , 17 4 પીપલેજ (તા. છોટાઉદેપુર) , 18 4 ઓઢી (તા. છોટાઉદેપુર) , 19 4 ઓડી (તા. છોટાઉદેપુર) , 20 4 નવાગામ (તા. છોટાઉદેપુર) , 21 4 નાની સાધલી , 22 4 સનાડા (તા. છોટાઉદેપુર) , 23 4 સીલોદ (તા. છોટાઉદેપુર) , 24 4 પંડિત રામ નારાયણ , 25 4 વિશ્વ કાચબા દિવસ

set 2009: 1 3 એલિફન્ટાની ગુફાઓ , 2 3 તૌરાત , 3 3 સિંગાપુર , 4 3 નબીપુર , 5 3 વામકુક્ષિ , 6 3 ઈમાન , 7 3 માઉન્ટ એવરેસ્ટ , 8 3 નમાજ઼ , 9 3 અરવિંદ આશ્રમ , 10 3 ઇસ્લામ , 11 2 હઠીસિંહનાં દેરા , 12 2 વિદ્યા બાલન , 13 2 આસો સુદ ૮ , 14 2 અર્ધનારીશ્વર , 15 2 આકાશગંગા , 16 2 કચ્છનો અખાત , 17 2 વચનામૃત , 18 2 દુર્વાસા ઋષિ , 19 2 મનોવિજ્ઞાન , 20 2 એસોટેરિક (અમુક વ્યક્તિઓ જ સમજી શકે તેવું) , 21 2 પ્રારંભિક જાહેર ભરણું (આઈપીઓ) , 22 2 બાળગીતો , 23 2 કવ્વાલી , 24 2 અઝેરબીજાન , 25 2 આર્મેનિયા

out 2009: 1 4 રોટલી , 2 3 ધારી , 3 3 ગીગાસણ , 4 3 મનુષ્ય ગૌરવદિન , 5 3 સ્વામિનારાયણ સંપ્રદાય , 6 3 ભારતનાં વિશ્વ ધરોહર સ્થળો , 7 3 ભારત , 8 2 લોદરા , 9 2 મહાબલીપુરમ , 10 2 હમ્પી , 11 2 કારતક સુદ ૧૦ , 12 2 છત્રપતિ શિવાજી ટર્મિનસ , 13 2 લોહલંગરી આશ્રમ (ગોંડલ) , 14 2 છપિયા , 15 2 ફૉકલેન્ડ ટાપુઓ , 16 2 બોલીવિયા , 17 2 સ્વિત્ઝરલેન્ડ , 18 2 નિત્યાનંદ સ્વામી , 19 2 ઓક્ટોબર ૧૨ , 20 2 ઓક્ટોબર ૧૧ , 21 2 મોલ્દોવા , 22 2 વાસદ (તા. આણંદ) , 23 2 શરદ પૂર્ણિમા , 24 2 આસો સુદ ૧૫ , 25 2 લક્ઝેમ્બર્ગ

nov 2009: 1 3 મહાબોધિ મંદિર , 2 3 વાયુ , 3 3 મીરાંબાઈ , 4 2 ગળધરા , 5 2 ચંદ્ર યાન , 6 2 કારતક વદ ૦)) , 7 2 જિહાદ , 8 2 કારતક વદ ૭ , 9 2 દશરથ , 10 2 ઇલોરાની ગુફાઓ , 11 2 ભારતની પર્વતીય રેલ્વે , 12 2 પત્તાદકલ , 13 2 ભીમ બેટકાની ગુફાઓ , 14 2 મહાબલીપુરમ , 15 2 ખજુરાહો , 16 2 નદીસર (તા. ગોધરા) , 17 2 જૈન ધર્મ , 18 2 વેડચ (તા.જંબુસર) , 19 2 દીવા (તા.અંકલેશ્વર) , 20 2 મોહણી(તા.ચોર્યાસી) , 21 2 મૈથિલીશરણ ગુપ્ત , 22 2 ધામણ , 23 2 ચામુંડા , 24 2 ભારતનાં વિશ્વ ધરોહર સ્થળો , 25 2 મહેમદાવાદ

dez 2009: 1 3 ઉસ્તીયા (તા. અબડાસા) , 2 3 ગીગાસણ , 3 3 નારગોલ , 4 3 અબ્દુલ કલામ , 5 3 જંબુસર , 6 2 પક્ષી , 7 2 ક્રિકેટનું મેદાન , 8 2 ડિસેમ્બર ૨૫ , 9 2 મનોવિષ્લેષણ , 10 2 ડિસેમ્બર ૧૯ , 11 2 કૃષિ , 12 2 તોરણીયા , 13 2 જળ , 14 2 ઓપન શોર્ટેસ્ટ પાથ ફર્સ્ટ , 15 2 અનિદ્રા , 16 2 ડિસેમ્બર ૧૭ , 17 2 સ્લમડોગ મિલિયોનેર , 18 2 ફિઝિયોથેરાપી , 19 2 પીપળો , 20 2 રૂપિયાપુરા , 21 2 નંદાદેવી રાષ્ટ્રીય ઉદ્યાન , 22 2 માનસ રાષ્ટ્રીય ઉદ્યાન , 23 2 કેવલાદેવ રાષ્ટ્રીય ઉદ્યાન , 24 2 કાઝીરંગા રાષ્ટ્રીય ઉદ્યાન , 25 2 અજંતાની ગુફાઓ

jan 2010: 1 3 આમેરનો કિલ્લો , 2 3 ઇએમઇ મંદિર , 3 3 લહેરીપુરા દરવાજા , 4 3 સયાજી બાગ (કમાટી બાગ) , 5 3 હવા મહેલ , 6 3 વાંસદા રાષ્ટ્રીય ઉદ્યાન , 7 3 દરિયાઈ રાષ્ટ્રીય ઉદ્યાન અને અભયારણ્ય , 8 3 ક્રિસમસ દ્વીપ , 9 3 સુએઝ નહેર , 10 3 જય વસાવડા , 11 2 કુંભ મેળો , 12 2 મહારાજા ફતેહસિંહ મ્યુજીયમ , 13 2 અશોક કુરજીભાઇ પટેલ , 14 2 ચેતેશ્વર પુજારા , 15 2 જલ મહેલ , 16 2 વિશ્વામિત્રી નદી , 17 2 નજર બાગ મહેલ , 18 2 કિર્તિ મંદિર, વડોદરા , 19 2 સરદાર પટેલ પ્લેનેટેરીયમ , 20 2 ઈંડિયા ગેટ , 21 2 રણછોડરાય , 22 2 પ્રાણી , 23 2 રોક ગાર્ડન , 24 2 સુવર્ણ મંદિર, અમૃતસર , 25 2 જાન્યુઆરી ૧૫

fev 2010: 1 4 તુલસી , 2 4 ગુજરાત , 3 3 ગળતેશ્વર , 4 3 સંપ્રદાય , 5 3 પાનકી , 6 3 રણછોડરાય , 7 3 ભારત , 8 3 ડાકોર , 9 3 મહાભારત , 10 2 આતંકવાદ , 11 2 અસોસિએશન ફુટબોલ , 12 2 પ્રાગજી ભગત , 13 2 સેવપુરી , 14 2 સયાજી સરોવર , 15 2 કોથમીર-મરચાંની ચટણી , 16 2 ઈદડાં , 17 2 જે. બી. વોટસન , 18 2 પંડોળી , 19 2 મકબરા (હજીરા) , 20 2 ઝકાત , 21 2 ખંડેરાવ માર્કેટ , 22 2 માંડવી દરવાજા , 23 2 લાલબાગ , 24 2 શેર (તા. માંડલ) , 25 2 વડાપાવ

mar 2010: 1 3 બટાકાં , 2 3 મોગલબારા , 3 3 શેર (તા. માંડલ) , 4 2 એના નિકોલ સ્મિથ , 5 2 મહાકાળેશ્વર જ્યોતિર્લિંગ , 6 2 અરનાથજી દેવ , 7 2 ચૈત્ર સુદ ૫ , 8 2 થુમ્બા , 9 2 ફાગણ વદ ૧૪ , 10 2 ટૅડગાફળિયુ(ઉમરપાડા) , 11 2 બ્રાહ્મણી નદી , 12 2 બળદ ગાડું , 13 2 જીરું , 14 2 કણભા (તા.કરજણ) , 15 2 શક્કરીયાં , 16 2 ડાંગર , 17 2 કામલી , 18 2 ખારા રૂપાલ , 19 2 ધાંધુસણ , 20 2 દેદીયાસણ , 21 2 આખજ , 22 2 દીવાનપુરા-અલીયાસ-અપાપુરા , 23 2 મેમદપુરા , 24 2 વીરસોડા , 25 2 હાડવી

abr 2010: 1 3 લીંભોઈ , 2 3 ખારવા , 3 3 વલ્લભ વિદ્યાનગર , 4 3 સ્વામિનારાયણ સંપ્રદાય , 5 3 ઉચ્છલ , 6 3 સુરત , 7 2 બેગુની , 8 2 વિક્રમાદિત્ય , 9 2 ખીચડી , 10 2 કફોત્પાદક ગ્રંથિ , 11 2 રવાનો શીરો , 12 2 દૂધપાક , 13 2 સંદેશ , 14 2 દિવ્ય ભાસ્કર , 15 2 બરડીયા (તા. વિસાવદર) , 16 2 ભાગળ , 17 2 સુરતી બોલી , 18 2 ગામીત બોલી , 19 2 બોલી , 20 2 ભક્તિવેદાંત બુક ટ્રસ્ટ , 21 2 એ.સી. ભક્તિવેદાંત સ્વામી પ્રભુપાદ , 22 2 માર્કની લખેલી સુવાર્તા , 23 2 કડવા પાટીદારોની પેટા જ્ઞાતિ , 24 2 હરિલાલ ઉપાધ્યાય , 25 2 નરસિંહ

mai 2010: 1 3 સમરસ ગ્રામ પંચાયત , 2 3 ચેવડો , 3 3 ગૂગલ અનુવાદ , 4 3 કચ્છ જિલ્લો , 5 3 સુરત , 6 2 પરોઠા , 7 2 મિસળ , 8 2 એચએએલ તેજસ , 9 2 રોહિણી , 10 2 કૃષ્ણદાસ કવિરાજ , 11 2 ચૈતન્ય ચરિતામૃત , 12 2 જયપતાકા સ્વામી , 13 2 સંન્યાસ , 14 2 ભક્તિબલ્લભ તીર્થ ગોસ્વામી મહારાજ , 15 2 શુભા મુદ્ગલ , 16 2 તમાકુની ખળી , 17 2 થાળી , 18 2 જપમાળા , 19 2 બ્લેક સબાથ , 20 2 લોકનાથ સ્વામી મહારાજ , 21 2 ગોપાલ કૃષ્ણ ગોસ્વામી , 22 2 રાધાનાથ સ્વામી , 23 2 ડો. જીવરાજ નારાયણ મહેતા , 24 2 ગોપીપુરા , 25 2 લિંભોઇ

jun 2010: 1 3 મગની દાળનો શીરો , 2 3 ટાવર ઓફ લંડન , 3 3 કુલેર , 4 3 પેંડા , 5 3 દુધીનો હલવો , 6 3 વાવ , 7 3 ઇએમઇ મંદિર , 8 3 રતનપુર (કાંટડી) , 9 3 ગુજરાતી ભોજન , 10 2 અગ્રસેન , 11 2 પાલિ ભાષા , 12 2 ફૂલવડી , 13 2 પૌંઆ , 14 2 સમોસા , 15 2 શરીર વૃદ્ધી અંતઃસ્ત્રાવ , 16 2 કચોરી , 17 2 પંડિત દીનદયાળ પેટ્રોલિયમ યુનિવર્સિટી , 18 2 ગોળ , 19 2 ગુર્જીય્ફ , 20 2 ભગવદ્ દર્શન , 21 2 લેધરબેક કાચબો , 22 2 મેઘ , 23 2 સૈફ અલી ખાન , 24 2 સેવ , 25 2 બરફી

jul 2010: 1 3 રંગાવલી નદી , 2 3 દેવ-ચાંદની નદી , 3 3 આંકડો (વનસ્પતિ) , 4 3 ઝુલાસણ (તા. કડી) , 5 3 હરેલા ઉત્સવ , 6 3 અશોક ચક્ર , 7 3 આદમ અને હવા , 8 3 અમૃતા શેરગિલ , 9 3 રૂપાયતન આશ્રમશાળા , 10 3 યતી (હિમ માનવ) , 11 3 અગસ્ત્ય , 12 3 ગુજરાતી સાહિત્યકારો , 13 2 રુથ , 14 2 મીંઢોળા નદી , 15 2 ઇબ્રાહિમ , 16 2 કનોડા (તા. બહુચરાજી) , 17 2 ઇંગ્લેન્ડના એલિઝાબેથ પ્રથમ , 18 2 રવિ શંકર , 19 2 ધૌમ્ય , 20 2 શૃંગ , 21 2 ફ્રેન્ક લેમ્પાર્ડ , 22 2 રાપ્તી પ્રાંત (નેપાળ) , 23 2 ધવલાગિરી પ્રાંત (નેપાળ) , 24 2 લુમ્બિની પ્રાંત (નેપાળ) , 25 2 ગંડકી પ્રાંત (નેપાળ)

ago 2010: 1 4 શીખ , 2 4 દાલ બાટી , 3 4 મનમોહન સિંહ , 4 3 દૂરદર્શન , 5 3 ક્રોપ સર્કલ , 6 3 માછલીઘર , 7 3 શિક્ષક , 8 3 ઊંડ નદી , 9 3 દઢવાવ (તા. વિજયનગર) , 10 3 ભડીયાદ (તા. ધંધુકા) , 11 3 પૂ. મોટા , 12 3 કૃષ્ણ , 13 2 પિયાસણ (બતક) , 14 2 આન્દ્રે અગાસી , 15 2 મેનહટન , 16 2 ઑક્સફર્ડ વિશ્વવિદ્યાલય , 17 2 મહુડો , 18 2 જામીનગીરીઓ , 19 2 ભારતીય વાનગીઓ , 20 2 હ્યુસ્ટન , 21 2 ઇન્ડિયાના , 22 2 એમિથિસ્ટ , 23 2 ન્યાયશાસ્ત્ર , 24 2 ફોર્બ્સ , 25 2 બ્રુસ સ્પ્રિન્ગસ્ટીન

set 2010: 1 6 જાપાન , 2 4 ટિમ્બક્ટુ , 3 4 એ. આર. રહેમાન , 4 3 સોનલવા , 5 3 સ્ટેનફોર્ડ યુનિવર્સિટી , 6 3 વાળ ખરવા , 7 3 જયોર્જ સોરોસ , 8 3 નર્ક , 9 3 ચેસ્ટર કાર્લસન , 10 3 સોલોમન , 11 3 પાણી , 12 3 સરઢવ (તા. ગાંધીનગર) , 13 3 યુ.કે. પોસ્ટકોડ્સ , 14 3 ઓક્લાહોમા , 15 3 ૧૯૬૨નું ભારત-ચીન યુદ્ધ , 16 3 ચેરાપુંજી , 17 3 પાટણ , 18 3 ગુજરાતી , 19 2 કાંડુ (શરીર) , 20 2 એબીએન એમ્રો , 21 2 રાહુલ બજાજ , 22 2 સ્થાનકવાસી , 23 2 અન્ના કુર્નિકોવા , 24 2 વિરમપુર (તા. અમીરગઢ) , 25 2 ધ પ્રોડિજિ

out 2010: 1 3 એર ઈન્ડિયા ફ્લાઇટ ૧૮૨ , 2 3 કોર્ન , 3 3 ગ્રીક મૂળાક્ષરો , 4 3 ધનતેરશ , 5 3 પીરોજી માખીમાર , 6 3 દિવાળી , 7 3 માળીયા હાટીના , 8 3 મહાત્મા ગાંધી , 9 2 લાઓત્સે , 10 2 સિમા ગુઆંગ , 11 2 શાલીગ્રામ , 12 2 સીમા સુરક્ષા દળ , 13 2 પહાડિયા જનજાતિ , 14 2 શૈલી , 15 2 પીડોફિલિયા (બાળ યૌનશોષણ) , 16 2 હુઆંગ ઝીયાન-ફાન , 17 2 હરિવંશ , 18 2 સિમા કીઆન , 19 2 ડોનાલ્ડ ડક , 20 2 મિનેપોલિસ , 21 2 એલિસ ઇન ચેઇન્સ , 22 2 કેન્સાસ , 23 2 એલન શીયરર , 24 2 બજરંગ દળ , 25 2 સંચય

nov 2010: 1 3 પર્યાયોક્તિ , 2 3 કેસ્પિયન સમુદ્ર , 3 3 ઘડિયાલ , 4 3 આહિર , 5 2 કાતરા (ઈયળ) , 6 2 પોર્ટલેન્ડ, ઑરેગોન , 7 2 ચિત્રકૂટ ધામ , 8 2 પરસ્પરોપગ્રહો જીવાનામ્ , 9 2 સંસ્કૃતિ , 10 2 થોર , 11 2 ચિત્તભ્રમણા , 12 2 બ્લૂઝ , 13 2 સત્રીયા નૃત્ય , 14 2 પેટન્ટ , 15 2 સિટીગ્રુપ , 16 2 કપડાં , 17 2 નિવસન તંત્ર , 18 2 મદ્યાર્ક યુક્ત પીણું , 19 2 એશિયાઈ રમતોત્સવ , 20 2 એશિયન રમતોત્સવ ૨૦૧૦ , 21 2 કાળા મરી , 22 2 સિસ્કો , 23 2 કુપોષણ , 24 2 અનુકૂલન , 25 2 કાળો સમુદ્ર

dez 2010: 1 3 પેન્શન , 2 3 મડાણા ડાંગીયા (તા. પાલનપુર) , 3 3 વિલવણીકરણ , 4 3 સુવર્ણ માનક , 5 3 ફેડએક્સ , 6 3 વિંધ્યાચલ , 7 3 સૂર્યમંદિર, મોઢેરા , 8 3 વચનામૃત , 9 3 કૃષ્ણ વિવર , 10 3 પાલનપુર , 11 3 ચીન , 12 2 ઊન , 13 2 વિષ્ણુ સહસ્રનામ , 14 2 વાયરલેસ સુરક્ષા , 15 2 જળ શુદ્ધિકરણ , 16 2 સ્વચ્છતા , 17 2 હથિયારો , 18 2 વિટામિન બી૬ , 19 2 મેરેથોન , 20 2 ટ્યૂલિપ , 21 2 ઓર્લાન્ડો, ફ્લોરિડા , 22 2 કૅટરિના કૈફ , 23 2 કનિષ્ક , 24 2 યુનિલિવર , 25 2 કોલંબિયા, દક્ષિણ કેરોલિના

jan 2011: 1 5 પ્રાથમિક શાળા , 2 4 ડી. ડી. કૌશામ્બી , 3 3 એસ. એમ. કૃષ્ણ , 4 3 મકડાલા (તા. દિયોદર) , 5 3 જુલિયન અસાંજે , 6 3 ગોળવી (તા. દિયોદર) , 7 3 ખારાખોડા (તા. થરાદ) , 8 3 ઉમરેઠ , 9 3 દસ્ક્રોઇ , 10 3 હિંદુ ધર્મ , 11 3 સ્વામિનારાયણ , 12 3 ભારત , 13 3 સુરત , 14 2 અર્થીંગ , 15 2 વિદ્યુતજનીન , 16 2 ચુંબકીયક્ષેત્ર , 17 2 મડકરી નાયક , 18 2 કિરણ મઝુમદાર-શો , 19 2 ગિનિ પિગ , 20 2 યુનાઇટેડ સ્ટેટ્સ આર્મી , 21 2 સંજીવ કુમાર , 22 2 તમિલનાડુનો ઈતિહાસ , 23 2 સર્વમિત્ર સિકરી , 24 2 એમપીથ્રી , 25 2 ચીરોડા (રાજપરા)

fev 2011: 1 4 સાલ્ઝબર્ગ , 2 4 મેઘપુર , 3 4 નરેન્દ્ર મોદી , 4 3 પ્રણવ મુખર્જી , 5 3 મૃણાલ સેન , 6 3 સામાજિક સાહસિકતા , 7 3 મોહમ્મદ રફી , 8 3 યુનિક આઇડેન્ટિફિકેશન નંબર , 9 3 ૩જી , 10 3 સ્વયં-સહાયક જૂથ (નાણાં વ્યવસ્થા) , 11 3 નિરદ સી. ચૌધુરી , 12 3 બિરજુ મહારાજ , 13 3 અપર્ણા સેન , 14 3 ૨-જી સ્પેક્ટ્રમ કૌભાંડ , 15 3 મેજર ડિપ્રેસિવ ડિસઓર્ડર , 16 3 દ્વિસંગી તારો , 17 3 ઈન્ટરનેટ એક્ટીવિઝમ (ચળવળ) , 18 3 મુનસર તલાવ, વિરમગામ , 19 3 નોર્ધન આયર્લેન્ડ , 20 3 રજકો , 21 3 માઇક્રોસોફ્ટ ઓફિસ ૨૦૦૭ , 22 3 ઈન્સીડ , 23 3 મકડાલા (તા. દિયોદર) , 24 3 કોદરામ (તા. વડગામ) , 25 3 રક્ત

mar 2011: 1 4 ઍલન ટ્યુરિંગ , 2 3 યશવંત સિન્હા , 3 3 જાણદી (તા. થરાદ) , 4 3 ધારોલી (તા.ઝઘડીયા) , 5 3 કકવાડીદાંતી , 6 3 બાલાસિનોર , 7 3 પદમડુંગરી , 8 3 રાજકોટ , 9 2 એસ્સાર ગ્રુપ , 10 2 લૅરી પેજ , 11 2 ભારતીય ઇસ્પાત પ્રાધિકરણ લિમિટેડ , 12 2 બ્રાયન લારા , 13 2 ગૅરી કિર્સ્ટન , 14 2 જામા મસ્જિદ, દિલ્હી , 15 2 ભારતનું સર્વોચ્ચ ન્યાયાલય , 16 2 એન્ડ્રુ કાર્નેગી , 17 2 રૅનબૅક્સી લેબોરેટરીઝ લિમિટેડ , 18 2 આર. કે. નારાયણ , 19 2 હિન્દુસ્તાન પેટ્રોલિયમ , 20 2 ટેક મહિન્દ્રા , 21 2 લાલા લાજપતરાય , 22 2 ટાટા ટી , 23 2 વિરપુર (તા. જેતપુર) , 24 2 ભારતીય સંસદ , 25 2 બૌદ્ધ ગુફાઓ, ખંભાલીડા

abr 2011: 1 3 હિલેરી ક્લિન્ટન , 2 3 શ્રીમદ્ રાજચંદ્રજી , 3 3 કાનજી સ્વામી , 4 3 તારંગા હિલ , 5 3 બાષ્પોત્સર્જન , 6 3 સાકરિયા (તા. મોડાસા) , 7 3 સાંકલી (તા. ગોધરા) , 8 3 રફાળા,તા.રાજકોટ , 9 3 ઇસરો , 10 3 ઈન્દ્રા નૂયી , 11 3 સુરેન્દ્રનગર જિલ્લો , 12 3 વડોદરા , 13 2 સેર્ગેઈ બ્રિન , 14 2 અળવી (વનસ્પતિ) , 15 2 રાઈતું , 16 2 પાલમપુર , 17 2 ઓનલાઈન વિજ્ઞાપન , 18 2 સેમસંગ , 19 2 એસ.ડી. બર્મન , 20 2 ખાંડવપ્રસ્થ , 21 2 બાલોતા (તા.હાંસોટ) , 22 2 અણ્ણા હઝારે , 23 2 મસૂરી , 24 2 તરબૂચ , 25 2 પ્રભાતદેવજી

mai 2011: 1 3 હર્ષદ , 2 3 ગાંધવી (તા. કલ્યાણપુર) , 3 3 ગોરાણા (તા. કલ્યાણપુર) , 4 3 આશિયાવદર (તા. કલ્યાણપુર) , 5 3 હોલો , 6 3 કતાર (અરબસ્તાન) , 7 3 શ્વેતા નંદા , 8 3 દાસી જીવણ , 9 3 નરસિંહ મહેતા , 10 2 જેપુર (તા. કલ્યાણપુર) , 11 2 પટેલકા (તા. કલ્યાણપુર) , 12 2 લાંબા (તા. કલ્યાણપુર) , 13 2 રાણ (તા. કલ્યાણપુર) , 14 2 રાણપરડા (તા. કલ્યાણપુર) , 15 2 નગડિયા (તા. કલ્યાણપુર) , 16 2 હનુમાનધાર , 17 2 બારિયાધાર (તા. કલ્યાણપુર) , 18 2 જામ રાવલ (તા. કલ્યાણપુર) , 19 2 સુર્યાવદર (તા. કલ્યાણપુર) , 20 2 ટંકારિયા (તા. કલ્યાણપુર) , 21 2 ભાટિયા (તા. કલ્યાણપુર) , 22 2 ડાંગરવડ (તા. કલ્યાણપુર) , 23 2 નાણાકીય વર્ષ , 24 2 ચાઇનીઝ ભાષા , 25 2 સ્વાઝીલેન્ડ

jun 2011: 1 3 પડાણા (તા. લાલપુર) , 2 3 ફિંગર ઇલેવન , 3 3 પ્રભાશંકર માસ્તર , 4 3 સ્પેન , 5 3 ઝવેરચંદ મેઘાણી , 6 2 નરગીસ , 7 2 ઇન્ટેલ કોર્પોરેશન , 8 2 નાઈટ્સ ટેમ્પ્લર , 9 2 હાથીના પગ તળે દેહાંતદંડ , 10 2 વિકેટ કીપર , 11 2 મહાશ્વેતા દેવી , 12 2 હલવો , 13 2 ભારતમાં પરીવહન , 14 2 રફેલ નડાલ , 15 2 એલર્જી , 16 2 દિગીશ મહેતા , 17 2 હીમોફીલિયા , 18 2 હૃદયસ્તંભતા , 19 2 હૃદયરોગનો હુમલો , 20 2 બાંયધરી (વોરંટી) , 21 2 પ્રિફર્ડ સ્ટોક , 22 2 હર્ષદ (તા. કલ્યાણપુર) , 23 2 ચાર્લ્સ લુસિઅન બોનાપાર્ટ , 24 2 ભારતીય ઓલિમ્પિક સંઘ , 25 2 ઝડપી ગોલંદાજી

jul 2011: 1 2 પલસદરી (જિ. રાયગઢ) , 2 2 પદ્મનાભસ્વામી મંદિર , 3 2 બલરાજ સહાની , 4 2 દેરડી (તા. ગોંડલ) , 5 2 લાભશંકર ઠાકર , 6 2 અડપોદરા , 7 2 સાયરા (તા. મોડાસા) , 8 2 કંબોયા (તા. ઇડર) , 9 2 થુવાવી , 10 2 બ્રાઝિલ , 11 2 ઉદય મર્ચંટ , 12 2 હળવદ , 13 2 કાલાવડ , 14 2 ભીસ્યા , 15 2 વડનગર , 16 2 નર્મદ , 17 2 ભાવનગર , 18 1 રામફળ

ago 2011: 1 4 જગદ્ગુરુ રામભદ્રાચાર્ય , 2 2 શરબત , 3 2 માથક (તા. હળવદ) , 4 2 ચુરાચાંદપુર , 5 2 આર્ય સમાજ , 6 2 અજાણી ઊડતી વસ્તુ , 7 2 ધર્મજ , 8 2 પ્રિયંકા ચોપરા , 9 2 ઇડર , 10 2 મુખપૃષ્ઠ , 11 1 મહેસૂલી તલાટી

set 2011: 1 3 હંગ્રી પેઢીના , 2 3 સુરજપુરા (તા. હિંમતનગર) , 3 2 સોરઠા (તા. કાલાવડ) , 4 2 નાની ભગેડી (તા. કાલાવડ) , 5 2 પેટન્ટ , 6 2 માતપુર (તા. પાટણ) , 7 2 કનોડા (તા. બહુચરાજી) , 8 2 ઉપાધ્યાય , 9 2 પાલેજ , 10 2 લોકગીત , 11 2 રાયપુર (છત્તીસગઢ) , 12 2 યુરેનસ (ગ્રહ) , 13 2 સુરત , 14 1 મોભીયાણા નવા (તા. રાજુલા)

out 2011: 1 3 ભુટકિયા , 2 3 લોથલ , 3 3 દત્તવાડા , 4 3 તાપી જિલ્લો , 5 2 આરઝી હકૂમત , 6 2 ઉર્વીશ કોઠારી , 7 2 ઈટ્રીયમ , 8 2 બ્રોમિન , 9 2 સેલિનીયમ , 10 2 ક્રોમિયમ , 11 2 વેનેડિયમ , 12 2 ટાઇટેનિયમ , 13 2 એશિયાઇ ચિત્તો , 14 2 ગંધક , 15 2 મેગ્નેશિયમ , 16 2 નિકલ , 17 2 વૈશ્વિક આરોગ્ય , 18 2 ભાણ સાહેબ , 19 2 ખામતા (તા. પડધરી) , 20 2 નોલી (તા. સાયલા) , 21 2 પટોસણ (તા. પાલનપુર) , 22 2 કનોડા (તા. બહુચરાજી) , 23 2 રતુભાઇ અદાણી , 24 2 વ્યવસાય , 25 2 કામલી

nov 2011: 1 4 બ્લેક સબાથ , 2 3 સુબ્રમણ્યન ચંદ્રશેખર , 3 3 ફીજી હિન્દી , 4 3 પાનસડ (તા. બાબરા) , 5 3 ભુટકિયા , 6 3 ગુજરાતી સાહિત્ય પરિષદ , 7 3 ઘંટીયાળી (તા. થરાદ) , 8 3 જેનપુર (તા. પ્રાંતિજ) , 9 3 દત્તવાડા , 10 3 રાપર , 11 3 ધોળાવીરા , 12 3 ખગોળશાસ્ત્ર , 13 3 મુંબઈ , 14 2 ચારણ , 15 2 નારાયણ સરોવર , 16 2 રીડગુજરાતી.કોમ , 17 2 ભીમડાદ (તા.ગઢડા) , 18 2 પેજ રેન્ક , 19 2 અર્બિયમ , 20 2 યોગસૂત્ર , 21 2 ગોરખનાથ , 22 2 નેશનલ સ્ટોક એક્સચેન્જ , 23 2 ખારી જળાશય (ભુટકિયા) , 24 2 ટેલુરિયમ , 25 2 ટીન

dez 2011: 1 4 માતપુર (તા. પાટણ) , 2 3 મહારાજા સયાજીરાવ ગાયકવાડ ત્રીજા , 3 3 ધોળીધજા ડેમ , 4 3 રેશમ , 5 3 સલામત મૈથુન , 6 3 કાર્તિકેય , 7 3 મૌલાના આઝાદ , 8 3 નેસડી (તા. સાવરકુંડલા) , 9 3 સુરખાબ , 10 3 ખોખલા (તા. ચાણસ્મા) , 11 3 વાંચ (તા. દસ્ક્રોઇ) , 12 3 કુરાન , 13 3 દેથલી , 14 3 એરથાણ , 15 3 યમનોત્રી , 16 3 સુત્રાપાડા , 17 3 જસદણ , 18 3 લીંબડી , 19 3 ખગોળશાસ્ત્ર , 20 3 ભાવનગર , 21 3 મહાભારત , 22 3 ગુજરાતી , 23 2 બકાસુર , 24 2 શ્રીહરિકોટા , 25 2 ઘાંચી

jan 2012: 1 4 મહેશ ભટ્ટ , 2 4 આંકડો (વનસ્પતિ) , 3 4 ગોઝારીયા , 4 4 અમદાવાદ , 5 3 જાંબુઘોડા અભયારણ્ય , 6 3 છૂંદો , 7 3 અમૂલ , 8 3 નેસડી (તા. સાવરકુંડલા) , 9 3 પાણીપૂરી , 10 3 જામા મસ્જિદ, અમદાવાદ , 11 3 ગીર રાષ્ટ્રીય ઉદ્યાન અને અભયારણ્ય , 12 3 ઉદવાડા , 13 3 નિશાના , 14 3 ડેબિયન , 15 3 પીરમબેટ , 16 3 પાલનપુર , 17 3 રાજ્ય સભા , 18 3 કાંકરિયા તળાવ , 19 2 સર પ્રભાશંકર પટ્ટણી , 20 2 કોઠી , 21 2 તલાટી-કમ-મંત્રી , 22 2 ચિત્રા (તા. ભાવનગર) , 23 2 દ્રાક્ષાસવ , 24 2 દીવાદાંડી , 25 2 જામા મસ્જિદ

fev 2012: 1 5 અમદાવાદ , 2 4 અલકા યાજ્ઞિક , 3 4 લેઉવા પટેલ , 4 3 શકરપુર (તા.ખંભાત) , 5 3 સોનૂ નિગમ , 6 3 સુનિધિ ચૌહાણ , 7 3 આહિર , 8 3 અક્ષરધામ (દિલ્હી) , 9 3 ગુરુત્વાકર્ષણ , 10 3 મહાત્મા ગાંધી , 11 2 વિદ્યુત ક્ષેત્ર , 12 2 આલિશા ચિનોઇ , 13 2 નિરમા યુનિવર્સિટી , 14 2 ડૉ.કમલા બેનિવાલ , 15 2 ભીમપુરા (તા. તલોદ) , 16 2 તેરા , 17 2 અંબાડી , 18 2 પપૈયાં , 19 2 અમૂલ , 20 2 મહેશ ભટ્ટ , 21 2 વાગડીયા (તા. જામનગર) , 22 2 પીપર (તા. કાલાવડ) , 23 2 કાળો કોશી , 24 2 ખીલ (રોગ) , 25 2 દૈયપ (તા. વાવ)

mar 2012: 1 4 ભીમાશંકર , 2 4 ગુજરાતની નદીઓની યાદી , 3 4 નરેન્દ્ર મોદી , 4 3 વિદ્યુત ક્ષેત્ર , 5 3 સાયના નેહવાલ , 6 3 ખડાણા (તા. પેટલાદ) , 7 3 ક્ષત્રિય , 8 2 તાલુકા વિકાસ અધિકારી , 9 2 ધુંઆધાર ધોધ , 10 2 આરસ ખડકો , 11 2 સ્ટ્રોબેરી , 12 2 પીએચપી , 13 2 બાખલકા (તા. તળાજા) , 14 2 ફ્લોપી ડિસ્ક , 15 2 ઇમેજ સ્કેનર , 16 2 મણિશંકર રત્નજી ભટ્ટ ‘કાન્ત’ , 17 2 નૃસિંહપ્રસાદ ભટ્ટ , 18 2 નંદકુમાર પાઠક , 19 2 શેખ આદમ આબુવાલા , 20 2 અનવર આગેવાન , 21 2 હિંમતલાલ અંજારિયા , 22 2 હાજી અલારખિયા , 23 2 ભૂપેશ અધ્વર્યુ , 24 2 આયેશા ટાકિયા , 25 2 મુકેશ અમૃતલાલ આચાર્ય

abr 2012: 1 4 કુરુક્ષેત્ર , 2 4 વસ્ત્રાપુર તળાવ , 3 4 ઍફીલ ટાવર , 4 4 ક્ષેત્રફળ , 5 4 અમદાવાદ , 6 3 ગુજરાતના પુરસ્કારો , 7 3 ભૂરિશ્રવા , 8 3 લાલભાઈ દલપતભાઈ ઈજનેરી મહાવિદ્યાલય , 9 3 ધરણીધર , 10 3 છૂંદો , 11 3 જગદ્ગુરુ રામભદ્રાચાર્ય , 12 3 પંડોળી , 13 3 સત્યના પ્રયોગો અથવા આત્મકથા , 14 3 ઝવેરચંદ મેઘાણી , 15 3 રાજકોટ , 16 3 નરેન્દ્ર મોદી , 17 2 જીસ્વાન , 18 2 ધૃષ્ટકેતુ , 19 2 વૃષકેતુ , 20 2 એકમ , 21 2 ગબ્બર , 22 2 સ્વચ્છ ગામ સ્વસ્થ ગામ યોજના , 23 2 દિકરી યોજના , 24 2 મહાત્મા ગાંધી રાષ્ટ્રીય ગ્રામીણ રોજગાર બાહેધરી યોજના , 25 2 રાષ્ટ્રીય ગ્રામીણ રોજગાર બાહેધરી યોજના

mai 2012: 1 5 દીક્ષાભૂમિ , 2 5 તરખંડા , 3 5 અમલનેર , 4 5 ડૉ. ભીમરાવ રામજી આંબેડકર , 5 4 અજમો , 6 4 મહાત્મા જ્યોતિરાવ ફુલે , 7 4 ડૉ.બાબાસાહેબ આંબેડકર , 8 4 અંતરા , 9 4 અમદાવાદ સીટી તાલુકો , 10 4 નાનાભાઈ ભટ્ટ , 11 3 વિશ્વનાથ ભટ્ટ , 12 3 ડો. બાબાસાહેબ આંબેડકર , 13 3 Portal:સબસ્ટબ કાર્યકારિણી , 14 3 પાળેલાં પશુઓ પર થતી શસ્ત્રક્રિયાની યાદી , 15 3 ખડિયા , 16 3 ભીમાશંકર , 17 3 માધુરી દીક્ષિત , 18 3 પટ્ટદકલ , 19 3 સિદસર (તા. ભાવનગર) , 20 3 રબારી , 21 3 ભૂસ્તરશાસ્ત્રી , 22 3 સપ્તપર્ણી , 23 3 આહિર , 24 3 ખાંટિયાવાંટ , 25 3 ઢીંકવા

jun 2012: 1 6 નરેન્દ્ર મોદી , 2 5 સુહાસી ધામી , 3 4 અમૃતા રાવ , 4 4 મહાભારત , 5 4 ગુજરાત , 6 3 રૂપશંકર ઓઝા , 7 3 શશિન્ ઓઝા , 8 3 કૃષ્ણકાન્ત કડકડિયા , 9 3 રામજીભાઈ કડિયા , 10 3 યશવંત કડીકર , 11 3 ધનવંત ઓઝા , 12 3 દિગન્ત ઓઝા , 13 3 તનસુખરાય ઓઝા , 14 3 મીનું એડનવાળા , 15 3 ઉષા ઉપાધ્યાય , 16 3 ઉમર ઉઘરાતદાર , 17 3 વઝીરુદ્દીન અલવી , 18 3 રમણિક અરાલવાળા , 19 3 સ્વામી સચ્ચિદાનંદ , 20 3 રમણ સોની , 21 3 હિમાંશી શેલત , 22 3 ગુલામમોહમ્મદ શેખ , 23 3 ધનંજય શાહ , 24 3 સતીશ વ્યાસ , 25 3 યોગેન્દ્ર વ્યાસ

jul 2012: 1 4 અનુષ્કા શેટ્ટી , 2 4 ધાનેરા , 3 4 ગણદેવી , 4 3 વૈદ્યનાથં , 5 3 રોઝાવાડા (તા. કપડવંજ) , 6 3 છોટાઉદેપુર , 7 3 વડગામ , 8 3 ત્રિકમ સાહેબ , 9 3 સોનગઢ , 10 3 વ્યારા , 11 3 કડી , 12 3 ચંદ્રકાંત બક્ષી , 13 3 માંડવી , 14 2 ગરબી , 15 2 તલીયારા , 16 2 બાલુચરી સાડી , 17 2 ખોપાળા (તા.ગઢડા) , 18 2 કાકરાપાર અણુ શક્તિ મથક , 19 2 ગઢડા તાલુકો , 20 2 ધણફુલીયા (તા. વંથલી) , 21 2 ચકરી , 22 2 લીંબુનું અથાણું , 23 2 બાપા સીતારામ , 24 2 તાજ ફાર્માસ્યૂટિકલ્સ ગ્રુપ , 25 2 આમરા (તા. જામનગર)

ago 2012: 1 3 એકવાર પીયુને મળવા આવજે (ચલચિત્ર) , 2 3 વડગામ (તા. દસાડા) , 3 3 સાયના નેહવાલ , 4 3 મહાત્મા ગાંધી , 5 2 જાળીયાળા (તા. લીંબડી) , 6 2 અબડાસા , 7 2 કલ્પના ચાવલા , 8 2 મીથુન ચક્રવર્તી , 9 2 પાયથાગોરસ , 10 2 સઈ , 11 2 મગ , 12 2 જસત , 13 2 ઝારેરા નેસ (તા. રાણાવાવ) , 14 2 હડમતીયા (તા. જામનગર) , 15 2 ધોળી (તા. લીંબડી) , 16 2 નીરજી , 17 2 ક્ષારાતુ , 18 2 આચાર્ય હજારી પ્રસાદ દ્વિવેદી , 19 2 અરજણસર (તા. રાધનપુર) , 20 2 કોલીવાડા (તા. સાંતલપુર) , 21 2 મિસળ , 22 2 ભારતનાં રાજ્યોના મુખ્ય મંત્રીઓ , 23 2 ભોળાદ (તા. ધોળકા) , 24 2 ડિસેમ્બર ૨૨ , 25 2 આહિર

set 2012: 1 4 શ્રી હરિલીલામૃત , 2 4 ઇ-મેઇલ , 3 4 અબ્દુલ કલામ , 4 4 સ્વામિનારાયણ , 5 4 ગુજરાતી દૈનિકપત્રોની યાદી , 6 3 દરબારી દેતાલ , 7 3 શીખ , 8 3 ભૂમિતિ , 9 2 TV9 ગુજરાત , 10 2 શ્રી હરિ દિગ્વિજય , 11 2 શ્રી હરિલીલાકલ્પતરુ , 12 2 આકાશવાણી , 13 2 મુઝફ્ફર વંશ , 14 2 વિશ્વ સાક્ષરતા દિન , 15 2 દિવાન બલ્લુભાઇ શાળા , 16 2 ભૌતિક અનુસંધાન પ્રયોગશાળા , 17 2 નાનીધારી , 18 2 ફરેણી , 19 2 અક્ષરધામ (ગાંધીનગર) , 20 2 નિરુપા રોય , 21 2 વીર્ય દાન , 22 2 રાવલા મંડી , 23 2 શિક્ષાપત્રી , 24 2 દીના પાઠક , 25 2 બાલુચરી સાડી

out 2012: 1 3 તારક મેહતા કા ઉલ્ટા ચશ્મા , 2 3 પ્રેમાનંદ , 3 3 નાઈટ્સ ટેમ્પ્લર , 4 3 ભારતીય રૂપિયો , 5 3 અમીયા (તા. બાયડ) , 6 3 ગણોલ (તા. ધોળકા) , 7 3 આનંદપુરા (તા. ધોળકા) , 8 3 બીજું વિશ્વ યુદ્ધ , 9 3 રાજેન્દ્ર શુક્લ , 10 3 બકુલ ત્રિપાઠી , 11 3 મીરાંબાઈ , 12 2 ગુજરાત વિધાનસભા , 13 2 ભારતીય થલસેના , 14 2 ધુમા , 15 2 ગૌરીશંકર ગોવર્ધનરામ જોષી , 16 2 સર પ્રભાશંકર પટ્ટણી , 17 2 મધુસૂદન પારેખ , 18 2 ગજડી , 19 2 ફુલઝર (તા. જસદણ) , 20 2 પ્રણવ મિસ્ત્રી , 21 2 ગુણવંત શાહ , 22 2 તાજપુર કેમ્પ (તા. તલોદ) , 23 2 કૃષ્ણનગર (સાબલી) (તા. ઇડર) , 24 2 રાજાસોરસ , 25 2 ભારતીય ભૂમિસેના

nov 2012: 1 5 ભાઇ બીજ , 2 4 કમ્પ્યુટર નેટવર્ક , 3 4 PHP (પ્રોગ્રામિંગ ભાષા) , 4 4 જાવા (પ્રોગ્રામિંગ ભાષા) , 5 4 અણ્ણા હઝારે , 6 3 કલ્પના (કંપની) , 7 3 પોન્ટી ચઢ્ઢા , 8 3 પાયથોન(પ્રોગ્રામિંગ ભાષા) , 9 3 ગો (પ્રોગ્રામિંગ ભાષા) , 10 3 કોમ્પ્યુટર નેટવર્ક , 11 3 C++(પ્રોગ્રામિંગ ભાષા) , 12 3 તારક મેહતા કા ઉલ્ટા ચશ્મા , 13 3 લાલભાઈ દલપતભાઈ ઈજનેરી મહાવિદ્યાલય , 14 3 પીએચપી , 15 3 પાનેસડા (તા. વાવ) , 16 3 રીબડી (તા. માંડલ) , 17 3 કારતક સુદ ૨ , 18 3 સુખદેવ , 19 3 મોરબી , 20 3 નથુરામ ગોડસે , 21 3 જુનાગઢ , 22 3 અમદાવાદ , 23 2 આઇ.આઇ.એમ. અમદાવાદ , 24 2 તલાશ (ચલચિત્ર) , 25 2 ઇસ પ્યાર કો ક્યા નામ દું?

dez 2012: 1 8 ૨૦૧૨ દિલ્હી બળાત્કાર ઘટના , 2 5 ડેન્ગ્યુ , 3 5 લાલભાઈ દલપતભાઈ ઈજનેરી મહાવિદ્યાલય , 4 5 નરેન્દ્ર મોદી , 5 4 ગુજરાતના પાવનકારી શક્તિપીઠો , 6 4 અમદાવાદની ગુફા , 7 4 અશ્વિની ભટ્ટ , 8 4 આલિશા ચિનોઇ , 9 4 મોરારજી દેસાઈ , 10 4 પાટણ , 11 4 વર્ષા અડાલજા , 12 3 કાજલ ઓઝા-વૈદ્ય , 13 3 સિવિલ હોસ્પિટલ, અમદાવાદ , 14 3 કેશુભાઈ પટેલ , 15 3 સલીમ સુલેમાન , 16 3 વર્ચ્યુઅલાઈઝેશન , 17 3 સેપ્ટ યુનિવર્સીટી , 18 3 કમ્પ્યુટર નેટવર્ક , 19 3 માધુરી દીક્ષિત , 20 3 અણ્ણા હઝારે , 21 3 ગુણવંત શાહ , 22 3 પાણશીણા (તા. લીંબડી) , 23 3 સંડેર (તા. પાટણ) , 24 3 ગુજરાત યુનિવર્સિટી , 25 3 સાણોદા (તા. દહેગામ)

jan 2013: 1 6 વલ્લભભાઈ પટેલ , 2 5 સાબરમતી મેરેથોન , 3 4 કોરોકોરો ટાપુ , 4 4 એરન સ્વાર્ટઝ , 5 4 સરદાર પટેલ રાષ્ટ્રીય મ્યુઝીયમ , 6 4 બારડોલી સત્યાગ્રહ , 7 3 OSI મોડેલ , 8 3 કમલેશ્વર બંધ , 9 3 ભારતીય રાષ્ટ્રીય કોંગ્રેસ , 10 3 કોચરબ આશ્રમ , 11 3 બારડોલી સ્વરાજ આશ્રમ , 12 3 ઈન્ટરનેટ પ્રોટોકોલ સ્યુટ , 13 3 ઓએસઆઈ મોડેલ , 14 3 ગોપાલ કૃષ્ણ ગોખલે , 15 3 મકડાલા (તા. દિયોદર) , 16 3 શેત્રુંજી નદી , 17 3 મચ્છુ નદી , 18 3 ગુજરાત , 19 2 જાપાનનો ઇતિહાસ , 20 2 કેદારેશ્વર મંદિર બારડોલી , 21 2 મહેન્દ્ર સિંઘ ધોની , 22 2 ભારતમાં આરોગ્યસંભાળ , 23 2 ચિત્તાગોંગ , 24 2 ઈન્ટરનેટ પ્રોટોકોલ , 25 2 ભારતીય માનક સમય

fev 2013: 1 5 ગુજરાત વિધાનસભા , 2 4 થાણાપીપળી (તા. વંથલી) , 3 4 અમદાવાદ બીઆરટીએસ , 4 3 નેહા શર્મા , 5 3 ચણા , 6 3 ફાઇલ ટ્રાન્સ્ફર પ્રોટોકોલ , 7 3 યાહૂ! , 8 3 નારિયેળ , 9 3 માતાનો મઢ , 10 3 પિસ્તા , 11 3 જાપાનનો ઇતિહાસ , 12 3 વેળવા , 13 3 મગ , 14 3 શેઠુભાર (તા. અમરેલી) , 15 3 કડછ (તા. પોરબંદર) , 16 3 દુધીયા (તા. કલ્યાણપુર) , 17 3 ઠાકોર , 18 3 સિન્ડ્રેલા , 19 3 વડગામ , 20 3 મોરબી , 21 2 ચોઘડિયા , 22 2 કુંવારપાઠું , 23 2 પ્રોફે. મહેબૂબ દેસાઈ , 24 2 મઠ , 25 2 ટ્યુનિશિયા

mar 2013: 1 5 દોડગામ (તા. થરાદ) , 2 4 વાધગઢ (તા. ધ્રાંગધ્રા) , 3 3 રતાળુ , 4 3 રવીન્દ્ર પ્રભાત , 5 3 મગ , 6 3 રાત્રિ સ્ખલન , 7 3 ટાટા ઈન્ડિગો , 8 3 થરાદ , 9 3 ગુજરાત વિદ્યાપીઠ , 10 2 ૨૦૦૨ ગુજરાત હિંસા , 11 2 રૂબિન ડેવિડ , 12 2 મધર ઇન્ડિયા , 13 2 સુષ્મા સ્વરાજ , 14 2 લુશાળા (તા. વંથલી) , 15 2 ભાટીયા (તા. વંથલી) , 16 2 વાડલા (તા. વંથલી) , 17 2 સ્નેહ દેસાઇ , 18 2 મસુર , 19 2 વડાલ (તા.જુનાગઢ) , 20 2 ગુજરાત વિધાનસભા , 21 2 અડદ , 22 2 ચમારડી (તા. બાબરા) , 23 2 મોણપુર (તા. અમરેલી) , 24 2 સૂરણ , 25 2 અમેરિકન એરલાઇન્સ

abr 2013: 1 3 મેરી કોમ , 2 3 રવીન્દ્ર પ્રભાત , 3 3 શ્રવણબેલગોડા , 4 3 રામ પ્રસાદ બિસ્મિલ , 5 3 હાંડવો , 6 3 ગીર રાષ્ટ્રીય ઉદ્યાન અને અભયારણ્ય , 7 3 ગુજરાતનો નાથ , 8 2 ક્વિક ક્વિઝ , 9 2 ફિબોનાકિ , 10 2 ફેસબુક , 11 2 રાયણ , 12 2 નગડીયા (તા. વંથલી) , 13 2 માખીયાળા (તા.જુનાગઢ) , 14 2 મોટા (તા. પાલનપુર) , 15 2 હાડફોડી (તા. ઉપલેટા) , 16 2 વાંગધ્રા (તા. જસદણ) , 17 2 બાબા રામદેવ , 18 2 કરોલ (તા. પ્રાંતિજ) , 19 2 રવિન્દ્ર જાડેજા , 20 2 શેરડી , 21 2 ઋત્વિક રોશન , 22 2 કેવડીયા (તા. કપડવંજ) , 23 2 ત્રાજ (તા. માતર) , 24 2 ગોલીડા, રાજકોટ , 25 2 પ્લેટો

mai 2013: 1 4 પૂજ્ય શ્રી મોટા , 2 3 નેપોલિયન હિલ , 3 3 મૂળદાસ , 4 3 નસ્લી વાડિયા , 5 3 નામસ્મરણ , 6 3 ટ્રાન્સપોર્ટ ફોર લંડન , 7 3 દ્રાક્ષ , 8 3 અમૂલ , 9 3 નૅનો ટેક્નૉલોજિ , 10 3 મેડી (તા. અમરેલી) , 11 3 બાબાપુર (તા. અમરેલી) , 12 3 માવજીંજવા (તા. બગસરા) , 13 3 હેબતપુર (તા. દસાડા) , 14 3 મહમદ અલી ઝીણા , 15 3 મકતુપુર (તા. ઉંઝા) , 16 3 ખંભાત , 17 3 દિનકર જોષી , 18 3 મોહરમ , 19 3 વડનગર , 20 3 લંડન , 21 3 હિંદી ભાષા , 22 2 કે.જી.પરમાર , 23 2 વણાટકામ , 24 2 કરીના કપૂર , 25 2 જબ તક હૈ જાન

jun 2013: 1 3 હડકવા , 2 3 ઢોલિવુડ , 3 3 મરકી , 4 3 યુનિટ ૭૩૧ , 5 3 દેરાળા (તા.ગઢડા) , 6 3 ગુજરાત વિધાનસભા ચૂંટણી, ૨૦૧૨ , 7 3 મહમદ અલી ઝીણા , 8 3 અડાલજની વાવ , 9 3 સુરેન્દ્રનગર જિલ્લો , 10 3 જામનગર , 11 3 નરેન્દ્ર મોદી , 12 3 નરસિંહ મહેતા , 13 2 ભડલા , 14 2 લખાણકા (તા.ગઢડા) , 15 2 લીંબડીયા (તા.ગઢડા) , 16 2 લીંબાળા (તા.ગઢડા) , 17 2 લીંબાળી (તા.ગઢડા) , 18 2 હામાપર (તા.ગઢડા) , 19 2 હરીપર (તા.ગઢડા) , 20 2 હોળાયા (તા.ગઢડા) , 21 2 ઇંગોરાળા (તા.ગઢડા) , 22 2 ઇંગોરાળા (ખાલસા) (તા.ગઢડા) , 23 2 ઇશ્વરીયા (તા.ગઢડા) , 24 2 ઇતરીયા (તા.ગઢડા) , 25 2 જલાલપુર (તા.ગઢડા)

jul 2013: 1 4 ગુજરાતી દૈનિકપત્રોની યાદી , 2 3 થાના ગલોલ (તા. જેતપુર) , 3 3 જસરા (તા. ડીસા) , 4 3 સુરેન્દ્રનગર જિલ્લો , 5 2 સામાન્ય જ્ઞાન , 6 2 પંચામૃત , 7 2 રાયડો , 8 2 અશેળિયો , 9 2 જગતસિંઘજી મહારાજ , 10 2 ભાગ મિલ્ખા ભાગ , 11 2 હીરાકુડ બંધ , 12 2 કળથી , 13 2 મહાવીર જયંતી , 14 2 ખેરખટ્ટો , 15 2 હંસાબેન મહેતા , 16 2 કરીના કપૂર , 17 2 બોર , 18 2 દૈયડ , 19 2 દોડવીર મિલખા સિંઘ , 20 2 સોમાસર (તા. મુળી) , 21 2 અમૃતા રાવ , 22 2 રજકો , 23 2 કૅટરિના કૈફ , 24 2 આગથળા (તા. ડીસા) , 25 2 બાજરી

ago 2013: 1 4 જુનાગઢ , 2 3 કોદરા , 3 3 પન્ના ધાઈ , 4 3 કોડીનાર , 5 3 નરેન્દ્ર મોદી , 6 2 ચોળાફળી , 7 2 બ્રેમ્પ્ટન, ઓન્ટારીયો , 8 2 ફાફડા , 9 2 લાકડશી , 10 2 તારા માછલી , 11 2 સામો , 12 2 રેડિયો સ્ટુડિયો 54 નેટવર્કના , 13 2 ખીરભવાની મંદિર , 14 2 થાણાપીપળી (તા. વંથલી) , 15 2 ઋગ્વેદ , 16 2 સુર્યપરા (તા. જામનગર) , 17 2 ધ્રોલીયા (તા. ટંકારા) , 18 2 જીવાપર (તા. જસદણ) , 19 2 કારાકાસ , 20 2 એર બસ , 21 2 જેતલવાસણા (તા. વિસનગર) , 22 2 પેંડા , 23 2 જનાલી (તા. ભિલોડા) , 24 2 સંદેશ (અખબાર) , 25 2 શરીર વજન અનુક્રમ

set 2013: 1 6 અમદાવાદ , 2 5 ભાવનગર , 3 4 બખરલા (તા. પોરબંદર) , 4 3 રાયણ , 5 3 શિક્ષક દિન , 6 3 ખીજડો , 7 3 ખાટી આમલી , 8 3 વડ , 9 3 દ્રોણ , 10 3 ડીસા , 11 3 સ્વામી વિવેકાનંદ , 12 3 લીંબુ , 13 3 જામનગર , 14 2 ઇલાયચી , 15 2 ગુજરાતની હસ્તકળાઓ , 16 2 મોટા હરીપુરા (તા. વિરમગામ) , 17 2 બાજ (પક્ષી) , 18 2 આંધળીચાકળ (સર્પ) , 19 2 કપોત કુળ , 20 2 લવિંગ , 21 2 સિંધવ , 22 2 શમીમ દેવ આઝાદ , 23 2 સાંભળો, શરીર શું કહે છે ! (પુસ્તક) , 24 2 જૂનાગઢ સિંચાઇ વિભાગના જળબંધો , 25 2 જીમ કોર્બેટ

out 2013: 1 7 અમદાવાદ , 2 4 દરિયાઈ રાષ્ટ્રીય ઉદ્યાન અને અભયારણ્ય , 3 4 આસારામ બાપુ , 4 4 ઝૂલેલાલ , 5 3 પાલક (ભાજી) , 6 3 પાલખ (ભાજી) , 7 3 ચિત્રા (તા. ભાવનગર) , 8 3 ઉંચા કોટડા , 9 3 નારાયણ સરોવર , 10 3 ઢાંક (તા. ઉપલેટા) , 11 3 પાનેસડા (તા. વાવ) , 12 3 ઉતેળીયા (તા. ધોળકા) , 13 3 હેબતપુર (તા. બરવાળા) , 14 3 સાંગાસર (તા. બરવાળા) , 15 3 વેળાવદર કાળિયાર રાષ્ટ્રીય ઉદ્યાન , 16 3 ઇસનપુર મોટા (તા. ગાંધીનગર) , 17 3 મદીના , 18 3 દાહોદ , 19 3 રોજીદ , 20 3 ચેટીચંડ , 21 3 ભાવનગર , 22 2 વસતી ગણતરી ૨૦૧૧ (અમદાવાદ) , 23 2 કુલધારા, રાજસ્થાન , 24 2 જીંજાવદર (તા.ગઢડા) , 25 2 ઉગામેડી (તા.ગઢડા)

nov 2013: 1 4 ઠાકોર , 2 3 સાંપડ (તા. પ્રાંતિજ) , 3 3 કુદરતી આફતો , 4 3 મહુવા , 5 3 શ્રીમદ્ ભગવદ્ ગીતા , 6 3 પાલીતાણા , 7 2 ગુજરાતના ધોરીમાર્ગોની યાદી , 8 2 બુદ્ધ અને તેમનો ધમ્મ , 9 2 કંસારી નેસ (તા. ઉના) , 10 2 પાલક (ભાજી) , 11 2 સતાણા નેસ (તા. પાલીતાણા) , 12 2 વિજાણા નેસ (તા. પાલીતાણા) , 13 2 બોદાણા નેસ (તા. પાલીતાણા) , 14 2 અગિયાળી (તા. સિહોર) , 15 2 વાઘનગર (તા.મહુવા) , 16 2 સમઢીયાળા (પાનબાઇ) (તા. ઉમરાળા) , 17 2 ઇંગોરાળા (તા. ઉમરાળા) , 18 2 બોચડવા (તા. ઉમરાળા) , 19 2 આંબલા (તા. સિહોર) , 20 2 ઘેલડા (તા. જામજોધપુર) , 21 2 દુકાળ , 22 2 ગરીયા (તા. વાંકાનેર) , 23 2 કોલંબો , 24 2 ફલુ (તા. વિજાપુર) , 25 2 વાવ (તા. ઘોઘંબા)

dez 2013: 1 3 હલદરવા નેસ (તા. વિસાવદર) , 2 3 બારવાનીયા નેસ (તા. વિસાવદર) , 3 3 સામાપોર , 4 3 દાંડી (જલાલપોર) , 5 3 વાછાવડ , 6 2 જાંબુડી નેશ (તા. મેંદરડા) , 7 2 કિલોરીયા નેશ (તા. મેંદરડા) , 8 2 કંથાળા નેશ (તા. મેંદરડા) , 9 2 વિસણવેલ(તા. માળીયા હાટીના) , 10 2 લાંગોદ્રા(તા. માળીયા હાટીના) , 11 2 ઘુમલી(તા. માળીયા હાટીના) , 12 2 દંડેરી(તા. માળીયા હાટીના) , 13 2 ઝડકા(તા. માળીયા હાટીના) , 14 2 આછીદ્રા(તા. માળીયા હાટીના) , 15 2 ઝરીયાવાડા (તા.માંગરોળ) , 16 2 વિરપુર (તા.માંગરોળ) , 17 2 વિરોલ (તા.માંગરોળ) , 18 2 વાડલા (તા.માંગરોળ) , 19 2 થલી (તા.માંગરોળ) , 20 2 તલોદ્રા (તા.માંગરોળ) , 21 2 સુલ્તાનપુર (તા.માંગરોળ) , 22 2 શીલ (તા.માંગરોળ) , 23 2 શેરિયાખાણ (તા.માંગરોળ) , 24 2 શેરિયાજ (તા.માંગરોળ) , 25 2 શેપા (તા.માંગરોળ)

jan 2014: 1 3 ચાણસ્મા , 2 2 લચિત બોરફૂકન , 3 2 પ્રાણલાલ પટેલ , 4 2 લોપકચિહ્ન , 5 2 અવતરણ ચિહ્ન , 6 2 મહારેખા , 7 2 વિગ્રહરેખા , 8 2 મહાવિરામ , 9 2 અર્ધ વિરામ , 10 2 ચોરવાડ(તા. માળીયા હાટીના) , 11 2 જાપાનનો ઇતિહાસ , 12 2 ગારીયાધાર , 13 2 પાણીયા ડુંગરી (તા. ધારી) , 14 2 માણાવાવ (તા. ધારી) , 15 2 કરમદડી (તા. ધારી) , 16 2 ખંભાળીયા (તા. ધારી) , 17 2 ખીસરી (તા. ધારી) , 18 2 જળજીવડી (તા. ધારી) , 19 2 કરેણ (તા. ધારી) , 20 2 દલખાણીયા (તા. ધારી) , 21 2 દિતલા (તા. ધારી) , 22 2 ધારગણી (તા. ધારી) , 23 2 રાજસ્થળી (તા. ધારી) , 24 2 સુખપુર (તા. ધારી) , 25 2 દેવળા (તા. ધારી)

fev 2014: 1 3 કલાલી , 2 2 ધરતી , 3 2 લોકનૃત્ય , 4 2 વિજ્ઞાનની દૃષ્ટિએ માનવશરીર , 5 2 અબુડી (તા. ઉના) , 6 2 સાબરમતી મેરેથોન , 7 2 વેલી ઓફ ફ્લાવર્સ રાષ્ટ્રીય ઉદ્યાન , 8 2 સ્વામિનારાયણ સંપ્રદાય , 9 2 વચનામૃત , 10 2 વણછરા , 11 2 મુળી , 12 2 ડૉ. ભીમરાવ રામજી આંબેડકર , 13 1 ધનપુર (તા. લીમખેડા)

mar 2014: 1 6 સરસવણી (તા. મહેમદાવાદ) , 2 4 રવિશંકર મહારાજ , 3 4 ચિખલી, મહારાષ્ટ્ર , 4 4 રવિશંકર વ્યાસ , 5 3 જેસલ જાડેજા , 6 3 છાંયા (તા. પોરબંદર) , 7 2 વિવેકાનંદ , 8 2 યરૂશાલેમના હિબ્રુ યુનિવર્સિટી , 9 2 શંકર મહાદેવન , 10 2 સુરેશ વાડકર , 11 2 કુંવારપાઠું , 12 2 ઇશ્વરનગર (તા. હળવદ) , 13 2 બૌદ્ધ ગુફાઓ, ખંભાલીડા , 14 2 ગોમતા (તા. ગોંડલ) , 15 2 કરણાસર (તા. થરાદ) , 16 2 રામ પ્રસાદ બિસ્મિલ , 17 2 મોરા (તા. મોડાસા) , 18 2 ગુરુના ચંદ્રો , 19 2 પટવાણ (તા. લીમખેડા) , 20 2 જુલાઇ ૧ , 21 2 ખોખડદળ , 22 2 દાહોદ , 23 2 પોપટ , 24 2 સંત કબીર , 25 1 પૂજ્ય રવિશંકર મહારાજ

abr 2014: 1 4 ભારતીય સામાન્ય ચૂંટણી, ૨૦૧૪ , 2 4 ઉના , 3 3 અવાક , 4 3 ઇજનેરી મહાવિદ્યાલય, પુણે , 5 3 વિનોદ ભટ્ટ , 6 3 રૂવા (તા. ભાવનગર) , 7 3 બહુચર માતા , 8 3 મોરારજી દેસાઈ , 9 3 સરસવણી (તા. મહેમદાવાદ) , 10 3 રાપર , 11 3 આહવા , 12 2 નવી મુંબઈ , 13 2 સુલોચના (રામાયણ) , 14 2 વિલાયતી પટ્ટાઇ , 15 2 પટ્ટી પટ્ટાઇ , 16 2 પાન પટ્ટાઇ , 17 2 કાચબરંગી , 18 2 અબલખ , 19 2 કરકરો , 20 2 ચલ , 21 2 વન લલેડુ , 22 2 દસાડી , 23 2 ભારતીય ઉપખંડના પક્ષીઓની યાદી , 24 2 સ્તેનેશ્વર મહાદેવ, તેના , 25 2 શબરી

mai 2014: 1 7 નરેન્દ્ર મોદી , 2 4 માતૃભાષા અભિયાન , 3 3 મનમોહન સિંહ , 4 3 ઉપલેટા , 5 3 રાજકોટ , 6 2 ગૂજરાત વિદ્યાપીઠ , 7 2 સાર્ક , 8 2 હિંદ મહાસાગર , 9 2 સન્ધિ (વ્યાકરણ) , 10 2 વિવેકાનંદ રોક મેમોરિયલ , 11 2 ઈગ્નસ તિર્કિ , 12 2 મમતા સોઢા , 13 2 ડૉ. શરદ ઠાકર , 14 2 ગમડાઉ (તા. ભચાઉ ) , 15 2 કબરાઉ (તા. ભચાઉ ) , 16 2 ભારતીય સામાન્ય ચૂંટણી, ૨૦૧૪ , 17 2 પ્રાણલાલ પટેલ , 18 2 કણખોઇ (તા. ભચાઉ ) , 19 2 અળવી , 20 2 પાટણા (તા.ગઢડા) , 21 2 લુવારવાવ (તા. પાલીતાણા) , 22 2 ગોરડકા (તા.ગઢડા) , 23 2 ઑડિશાના મુખ્યમંત્રીઓ , 24 2 રામવાવ , 25 2 ઑડિશાના જિલ્લા અને શહેરો

jun 2014: 1 3 દર્શન જરીવાલા , 2 3 અભિષેક જૈન , 3 3 હેબતપુર (તા. દસાડા) , 4 3 ઉમરેઠ , 5 3 નર્મદા નદી , 6 2 માખણ , 7 2 સોપારી , 8 2 કાકડી , 9 2 રેકી , 10 2 સેઓંગ જેઇ-જીઆઇ , 11 2 સાબલવાડ કંપા (જનકપુર) (તા. ઇડર) , 12 2 જાપાનનો ઇતિહાસ , 13 2 કેવી રીતે જઈશ (ચલચિત્ર‌‌) , 14 2 નૅનો ટેક્નૉલોજિ , 15 2 ગુજરાત યુનિવર્સિટી , 16 2 ચોરીવાડ (તા. વડાલી) , 17 2 બેસિલિકા ઑફ બોમ જીસસ

jul 2014: 1 2 મહી નદી , 2 2 હોટલ તાજ મહેલ પેલેસ , 3 2 ઇન્દ્રાયણી એક્સપ્રેસ , 4 2 આઈ ટી સી ગ્રાંડ ચોલા હોટલ , 5 2 એર ઇન્ડિયા એક્સપ્રેસ , 6 2 વોલ્ટર બેન્ડેર , 7 2 પુસ્તક પરબ , 8 2 એર એશિયા ઇન્ડિયા , 9 2 માખણ , 10 2 માતૃભાષા અભિયાન , 11 2 શોભાવડ (તા. તળાજા) , 12 2 કાજલ ઓઝા-વૈદ્ય , 13 2 ખીચા (તા. ધારી) , 14 2 ક્રોપ સર્કલ , 15 1 ચોલા સામ્રાજ્ય

No data on this page have been normalized to 30 day months (as WMF does on certain traffic reports).
Wikipedias are initially ordered by number of speakers of the language

Speakers: Number of speakers of a language is the estimated total of primary and secondary speakers, is in many cases a very rough estimation (based on the page on the English Wikipedia about that language)
Regions are parts of the world where the language is spoken in substantial amounts (compared to total number of speakers). Regions where a language gained presence only by a recent diaspora are generally not included.
Region codes: AF:Africa, AS:Asia, EU:Europe, NA:North America, OC:Oceania, SA:South America, W:World Wide, CL:Constructed Language

Estatísticas geradas em Quarta-feira, 3 de setembro 2014 22:24

Dump file guwiki-20140820-stub-meta-history.xml.gz (edits only), size 23 Mb as gz -> 173 Mb
Dump processed till Jul 31, 2014, on server stat1002, ready at Thu-21/08/2014-05:21 after 2 min, 27 sec.

Versão do script:2.6
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### =
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.