Estatísticas da Wikipédia lezgian

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Articles per size range / Records per namespace / Most edited articles / Zeitgeist

Most metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.

Some metrics have been collected from the full archive dump which runs on lower frequency than the usual monthly cycle.
These metrics are columns F,I,J,K,M,N,O,P,Q,R from the first table.


See also metrics definitions


 
Monthly counts & Quarterly rankings: fevereiro 2015
 
DataWikipedistasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
fev 2015+2%   +1%      +81%      +1%
jan 20150%   +1%      +96%      0%
dez 20140%   0%      -29%      0%
nov 20140%   0%      -41%      0%
out 2014+2%   +1%      +57%      +1%
set 2014+2%   +1%      -76%      0%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P____Q____R____S__
fev 20156014 2,2 k 116,1   163      575
jan 201559 3 2,1 k 116,2   90      569
dez 201459 3 2,1 k  16,3   46      567
nov 201459 2 2,1 k  16,3   65      565
out 20145913 2,1 k  16,3   110      564
set 20145813 2,1 k 116,3   70      561
ago 201457 412,1 k 216,4   287      559
jul 201457 212,0 k 116,7   177      552
jun 20145726 2,0 k 116,8   230      549
mai 20145516 2,0 k 116,9   279      541
abr 201454 4 1,9 k  17   159      519
mar 201454 4 1,9 k  17   137      512
fev 201454 2 1,9 k1,7 k 17233179%38%858,5 Mb587 k36 k2402,3 k5,4 k507
jan 2014542611,9 k1,7 k 17233379%38%3548,5 Mb584 k36 k2402,2 k5,4 k504
dez 201352 3 1,9 k1,7 k 16,9233079%38%1448,5 Mb581 k35 k2402,2 k5,4 k501
nov 201352 4 1,9 k1,7 k116,9232879%38%1728,4 Mb578 k35 k2402,2 k5,4 k500
out 2013521311,9 k1,7 k317233279%38%5298,4 Mb574 k35 k2432,2 k5,3 k494
set 201351 311,8 k1,6 k217,5226578%36%5717,7 Mb533 k32 k3552,2 k4,9 k490
ago 201351 211,8 k1,6 k517,7218577%33%9047,3 Mb500 k31 k3552,2 k4,6 k484
jul 201351 2 1,6 k1,4 k118,8207075%29%1586,3 Mb433 k27 k5312,1 k3,9 k449
jun 201351 311,6 k1,4 k218,9205774%29%6366,1 Mb426 k26 k5342,1 k3,9 k446
mai 201351 211,5 k1,3 k219,4199274%27%4125,7 Mb395 k24 k4862,1 k3,5 k434
abr 201351 521,4 k1,2 k120194273%24%6665,3 Mb370 k23 k4892,1 k3,2 k433
mar 2013511511,4 k1,2 k 20,1187171%23%2,1 k4,9 Mb346 k22 k1,1 k2,1 k3,0 k418
fev 201350 321,4 k1,2 k318,7183472%23%1,3 k6,5 Mb337 k21 k67 k2,1 k2,9 k410
jan 201350 421,3 k1,1 k218,9182571%23%1,7 k6,2 Mb318 k21 k66 k2,1 k2,8 k404
dez 201250 511,2 k1,1 k218,5180971%22%1,2 k5,9 Mb301 k20 k64 k2,1 k2,6 k393
nov 2012501711,2 k1,0 k418,5174870%18%1,1 k5,5 Mb276 k18 k63 k2,1 k2,4 k381
out 2012492521,1 k946619,3175768%18%1,2 k5,1 Mb254 k17 k61 k1,9 k2,2 k373
set 201247 51874746122,4185161%21%1,3 k4,5 Mb220 k15 k58 k1,5 k1,9 k357
ago 201247162843711121,7178860%20%9794,3 Mb204 k15 k56 k1,5 k1,7 k351
jul 2012461123821689121,1167358%19%1,3 k3,9 Mb186 k13 k54 k1,2 k1,6 k329
jun 2012451133782637220,4145454%17%1,7 k3,4 Mb154 k11 k50 k1,1 k1,4 k304
mai 201244193722564219,7123749%15%2,2 k2,9 Mb121 k8,2 k47 k1,0 k1,1 k261
abr 201243317566950031898444%12%3,1 k2,4 Mb89 k6,2 k42 k790727189
mar 2012408206567393115,881139%8%2,4 k1,8 Mb61 k3,4 k34 k70834892
fev 201232141539388 12,180040%8%7091,6 Mb59 k3,2 k28 k68830787
jan 201231121535386 10,978040%8%2331,4 Mb57 k3,3 k23 k68730683
dez 201130 41531383110,577240%8%3011,4 Mb56 k3,2 k23 k68430483
nov 201130371508370110,478941%8%4381,3 Mb55 k3,1 k21 k66430376
out 201127 4 488348 9,978440%8%3491,3 Mb52 k2,8 k21 k65029758
set 201127410248334549,378740%8%7701,1 Mb52 k2,8 k14 k64931356
ago 201123610237626959,987643%10%1,1 k954 kb45 k2,4 k12 k53331139
jul 201117181220166111,973245%8%361537 kb23 k8298,7 k35918713
jun 201116 51179131212,680451%10%1,2 k487 kb21 k6528,0 k28016412
mai 2011163811125719,860327%12%436322 kb9,9 k2967,3 k106299
abr 20111325 794018,451125%11%157210 kb5,8 k1484,9 k8817
mar 20111123 613418,360230%15%141201 kb5,3 k1284,9 k7517
fev 20119   4131 8,983641%22%3169 kb4,9 k1223,7 k56 7
jan 20119   4031 9,183642%22%3167 kb4,9 k1223,7 k56 7
dez 2010912 4031 983642%22%77167 kb4,9 k1223,7 k56 7
nov 20108   4023 7131138%22% 130 kb7,8 k1219195922
out 2010812 4023 7131138%22%36130 kb7,8 k1219195922
set 2010711 372216,6145741%19%113128 kb7,6 k1219186322
ago 2010622 1918 7103163%26%5866 kb2,9 k12089457 1
jul 20104   65 12,585750%33%415 kb956151334 1
jun 20104   65 11,885750%33% 15 kb956151334 1
mai 20104   65 11,885750%33%415 kb956151334 1
abr 20104   65 11,285750%33% 15 kb956151334 1
mar 20104   65 11,285750%33% 15 kb956151334 1
fev 20104   65 11,285750%33% 15 kb956151334 1
jan 20104   65 11,285750%33%315 kb956151334 1
dez 20094   65 10,785750%33% 15 kb956151294 1
nov 20094   65 10,785750%33% 15 kb956151294 1
out 20094   65 10,785750%33% 15 kb956151294 1
set 20094   65 10,785750%33% 15 kb956151294 1
ago 20094   65 10,785750%33% 15 kb956151294 1
jul 20094   65 10,785750%33%115 kb956151294 1
jun 20094   65 10,585750%33% 14 kb95615184 1
mai 20094   65 10,585750%33% 14 kb95615184 1
abr 20094   65 10,585750%33% 14 kb95615184 1
mar 20094   65 10,585750%33% 14 kb95615184 1
fev 20094   65 10,585750%33% 14 kb95615184 1
jan 20094   65 10,585750%33% 14 kb95615184 1
dez 2008411 65 10,585750%33%1114 kb95615184 1
nov 20083   65 8,782650%33%112 kb9261183 1
out 20083   65 8,582550%33% 12 kb9231183 1
set 20083   65 8,582550%33% 12 kb9231183 1
ago 20083   65 8,582550%33% 12 kb9231183 1
jul 20083   65 8,582550%33% 12 kb9231183 1
jun 20083   65 8,582550%33% 12 kb9231183 1
mai 20083   65 8,582550%33%712 kb9231183 1
abr 20083   65 7,382550%33%412 kb9231183 1
mar 20083   65 6,781350%33%712 kb9071183 1
fev 20083   44 8,21615100%75% 19 kb1,3 k6921111
jan 2008311 44 8,21615100%75%719 kb1,3 k6921111
dez 2007211 42 6,5145450%50%1818 kb7626629 1
nov 20071   11 82920100%100%65,9 kb3476328  
out 200711  1  242  2104 6     
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
The following table ranks this project in relation to projects in other languages with 1000+ articles
jan 2015159 152 196 160165   180      239
out 2014157143150 196  165   160      239
jul 2014156 171136197 151163   155      239
abr 2014163 138 197  160   164      239
jan 2014160114120144195180159163506727141146160156206139133239
out 2013161145156129195180104164486627109147158156213138133239
jul 2013159139173135203184153152607751158155172170189137139239
abr 2013158146127107203184157146708262141162176175198137144239
jan 2013157146137102204184120151728367154182180174201140143239
out 201215710912210220818985146789187172190185179203140151239
jul 20121581358892214201151209208208207166200191182205154160239
abr 2012156877875216206108207206206204109210211205213166185239
jan 2012182144172136217211150206205205203221222222219219172204239
out 2011189148140141218211160205204204202219219220222219171203239
jul 201121514199136226221157202201201199216227226227229191211239
abr 201122298130132235230155200199199197225233232234233220237239
jan 2011227152213135238232157198197197195238235233234235231237239
out 2010229145170128238234152192191191189234235230235237225237239
jul 2010235160218142238237157186185185183238237237237237237237239
abr 2010235149207138238236160183182182181238237237237237236237239
jan 2010233145201131237236155181181181180233238237237237235237239
out 2009233142206135237236159178178178177235238237237237233237239
jul 2009231190197132236234150172172172171232234234236236234234239
abr 2009231140197143235234147170170170169234235234236236234232239
jan 2009230130203132235233149164164164163237234234235235234233239
out 2008229135194129233228144158158158157233231231232233232232237
jul 2008226147196132230225147152152152150230228228229231228231236
abr 2008223146203129229225149147147146144230227226229231227229236
jan 2008222141199134226222155142142141140224224222217226216224233
out 2007227133189131229227147140140138138224230228228224221221231
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
 WikipedistasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikipedistas (usuários registrados)
A = Wikipedistas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikipedistas que editaram pelo menos dez vezes desde que chegaram
C = Wikipedistas que contribuíram cinco vezes ou mais este mês
D = Wikipedistas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Artigos que contêm pelo menos uma ligação interna e 200 caracteres de texto legível, não contando códigos wiki e html,
      ligações ocultas, etc.; títulos também não contam (outras colunas são baseadas no método oficial de contagem)
G = Novos artigos por dia no mês passado
H = Número médio de revisões por artigo
I = Tamanho médio dos artigos em bytes
J = Porcentagem de artigos com pelo menos 0,5 kb de texto legível (veja F)
K = Porcentagem de artigos com pelo menos 2 kb de texto legível (veja F)

Base de dados
L = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
M = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
N = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
O = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
P = Total de ligações para outras wikipédias
Q = Total de imagens apresentadas
R = Total de ligações para outros sítios
S = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  5  10  100  1000  1  3  5  10  25  100  1  3  5  10  25  100  250  5  10  100 
Monthly counts for recent history of wiki
fev 2015115441  1   31     8311   22 
jan 201584332      831    5221   22 
dez 20148331       5      711    22 
nov 201452221  11  21     63211  22 
out 2014114322      3      82111  22 
set 201493331      711    7221   22 
ago 2014844421  11  41     94433  22 
jul 2014922211      1      43221  22 
jun 201496652  11  32     42111  22 
mai 2014176663      3221   95322  22 
abr 2014115432  1   221    82221  21 
mar 2014134442  11  421    5111   22 
fev 201415222       321    7111   22 
jan 20141286431  11  321    6322   32 
dez 2013114332  11  622    52111  11 
nov 2013115433  11  5211   122221  11 
out 20139432111 21  62     633211111 
set 20139332211     53     933321 22 
ago 20134322211 2   53211  8222221431
jul 201342222      31     932211 33 
jun 20137332211 1   8521   733222 32 
mai 20136222111 11  531    112222  21 
abr 201313555321 33  4443   1133322 541
mar 201314652211 7611102211  2054221 541
fev 2013933222  1063 6221   843221 971
jan 201315543221 1363 6322   1033321 961
Quarterly counts for entire history of wiki
jan 201584332      831    5221   22 
out 2014114322      3      82111  22 
jul 2014922211      1      43221  22 
abr 2014115432  1   221    82221  21 
jan 20141286431  11  321    6322   32 
out 20139432111 21  62     633211111 
jul 201342222      31     932211 33 
abr 201313555321 33  4443   1133322 541
jan 201315543221 1363 6322   1033321 961
out 201211655321 862 74321  1254321 851
jul 2012181212853  872 1711842  2314141031 771
abr 201232211710754 971 341914853 572312774143 
jan 2012742221      1      1         
out 201185441  111        11111  11 
jul 201110884111     322    421111    
abr 201165551      1      1         
jan 2011                           
out 20103221              2111      
jul 2010                           
abr 2010                 2         
jan 2010                           
out 2009                           
jul 20091                          
abr 2009                           
jan 2009                 1         
out 2008                           
jul 2008                 2         
abr 200811                         
jan 2008111                         
out 20072                          

 

Distribuição de edições de artigos por wikipedistas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikipedistasEdições total
1242100.0%23,380100.0%
39238.0%23,19199.2%
106024.8%23,01598.4%
323213.2%22,54896.4%
100177.0%21,90393.7%
316114.5%21,12190.3%
100052.1%17,53275.0%
316220.8%11,67349.9%

 

11 wikipedistas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdições 
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
 agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
Soul TrainUC2 04,379185,72722mar 28, 20121066101---
MigraghviUC4 01,57528834ago 31, 201112761261--
MugerganetsUC6 0840104831out 13, 201286713922--
User from DagUC8 0629171482ago 17, 201016551281--
KmoksyUC10 0512137-ago 11, 20111296121---
RotlinkUC32 0321--ago 04, 2013572----
AbbasXanUC60...1010--fev 14, 20151322--
MagioladitisUC92...44--fev 15, 201512----
TegelUC112+64211-jan 19, 2013769----
TEMURCHI TENGIZ KHANUC241...11--fev 01, 201526----
AlexTref871UC242...11--fev 15, 201512----

 

20 wikipedistas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
  Primeira ediçãoúltima edição
 posiçãototaldatadias
atrás
datadias
atrás
Aslan4ikUC17,294jan 21, 20121133ago 16, 2014195
Namik555UC32,781mar 07, 20111453abr 21, 20121042
LezgistxaUC51,503set 20, 20111256jun 01, 20121001
SPQRobinUC7634mar 27, 20121067mar 27, 20121067
Tamara UstinovaUC9590nov 14, 20111201dez 04, 2013450
Saint JohannUC11384mar 28, 20121066out 15, 2012865
Cekli829UC12178mar 10, 20111450mai 17, 2014286
MaqiviUC13154out 07, 20111239set 03, 2013542
U.SteeleUC14125ago 02, 20111305mar 31, 20121063
LezgiUC15116abr 27, 20111402jun 02, 20121000
МаликумUC16106fev 07, 20121116mar 22, 2014342
HydrizUC17103jan 30, 2014393jan 30, 2014393
NessajaUC1890abr 25, 20121038out 05, 2014145
91i79UC1955mar 27, 20121067out 12, 2014138
Master ShadowUC2053out 12, 20101599dez 14, 20101536
FsFUC2148jul 26, 2012946jul 29, 2012943
KaiyrUC2245ago 30, 20101642set 02, 20111274
Midnight GreenUC2344jul 30, 20111308abr 22, 20121041
Ruang rak noi nid mahasanUC2440dez 01, 20101549dez 25, 20101525
LezgimanUC2537mar 17, 20121077jan 18, 201540

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 1.571 edições foram feitas por usuários anônimos, de um total de 34.636 edições ( 4e %)
  


41 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições 
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
 datadias
atrás
datadias
atrás
MerlIwBotUC12,612mai 27, 20111372ago 09, 2013567--
EmausBotUC21,646abr 16, 20121047nov 09, 2013475--
AddbotUC31,474mar 07, 2013722ago 16, 2013560--
XqbotUC41,030abr 16, 20121047mar 06, 2013723--
JackieBotUC5910abr 26, 20121037dez 01, 201488--
AvocatoBotUC6446mar 29, 20121065jul 07, 2012965--
GerakibotUC7326mai 24, 20121009mar 06, 2013723--
RedBotUC8171abr 22, 20121041ago 21, 2012920--
Makecat-botUC9150nov 01, 2012848mar 03, 2013726--
LegobotUC10107mar 11, 2013718abr 02, 2013696--
Idioma-botUC1197mar 27, 20121067mar 04, 2013725--
Justincheng12345-botUC1289jun 25, 2012977jan 10, 2013778--
YFdyh-botUC1363jul 01, 2012971fev 18, 2013739--
LaaknorBotUC1462mai 22, 20121011mar 05, 2013724--
JhsBotUC1555mar 28, 20121066jul 08, 2012964--
EscarbotUC1647abr 03, 20121060out 16, 2012864--
VolkovBotUC1746abr 28, 20121035fev 27, 2013730--
KamikazeBotUC1845mar 29, 20121065jan 24, 2013764--
JAnDbotUC1941mar 29, 20121065jul 02, 2013605--
AvicBotUC2040jun 01, 20121001dez 09, 2012810--
CarsracBotUC2135mar 31, 20121063fev 12, 2013745--
HiW-BotUC2229abr 07, 20121056out 18, 2012862--
VagobotUC2322mar 29, 20121065abr 30, 20121033--
SantoshBotUC2422out 21, 2012859jan 31, 2013757--
SynthebotUC2521set 20, 2012890jan 25, 2013763--
タチコマ robotUC2614out 20, 2012860out 21, 2012859--
CommonsDelinkerUC2713abr 26, 20111403fev 24, 20153--
PixelBotUC2813jul 20, 2012952mar 06, 2013723--
JotterbotUC2912jan 15, 2013773jan 18, 2013770--
Crochet.david.botUC307mai 07, 20082487mai 07, 20082487--
RobbotUC316mai 07, 20121026jan 02, 2013786--
CocuBotUC325ago 26, 2012915dez 15, 2012804--
OctraBotUC335mai 12, 2014291jan 30, 201528--
NjardarBotUC344ago 28, 2012913ago 31, 2012910--
SassoBotUC352mai 29, 20121004jan 07, 2013781--
ObersachsebotUC362nov 24, 2012825jan 08, 2013780--
DragonBotUC372jan 13, 2013775jan 14, 2013774--
MalarzBOTUC381ago 18, 2012923ago 18, 2012923--
GhalyBotUC391jan 18, 2013770jan 18, 2013770--
SAMI.BotUC401fev 05, 2013752fev 05, 2013752--
MastiBotUC411mar 01, 2013728mar 01, 2013728--

 

Artigos que contêm pelo menos uma ligação interna e .. caracteres de texto legível, não contando códigos wiki e html,
ligações ocultas, etc.; títulos também não contam  (excluindo páginas de redirecionamento)

DataArtigos
 < 32 ch< 64 ch< 128 ch< 256 ch< 512 ch< 1 k ch< 2 k ch< 4 k ch< 8 k ch< 16 k ch< 32 k ch< 64 k ch

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110JpgOggPngSvgWebm
fev 20152,7 k392841111111,2 k 1,0 k       991641
jan 20152,7 k388841111111,2 k 1,0 k       991641
dez 20142,7 k382821111111,2 k 1,0 k       991641
nov 20142,7 k378811111111,2 k 1,0 k       991641
out 20142,7 k374801111111,2 k 1,0 k       991641
set 20142,7 k373781111111,2 k 1,0 k       991641
ago 20142,6 k367771111081,2 k 1,0 k       991641
jul 20142,6 k362761111081,2 k 998       991641
jun 20142,6 k361751111081,1 k 996       991641
mai 20142,5 k361741111061,1 k 989       991641
abr 20142,5 k357711101031,1 k 982       991631
mar 20142,5 k354691101031,1 k 981       991631
fev 20142,4 k351681091021,1 k 979      53991531
jan 20142,4 k346671091021,1 k 976      210991531
dez 20132,4 k337651091021,1 k 972      113991531
nov 20132,4 k33664109971,1 k 960      138991531
out 20132,4 k32963109971,1 k 953      445991531
set 20132,3 k3246291971,1 k 934      552831331
ago 20132,2 k3065889971,1 k 914      877811331
jul 20132,0 k3025385931,0 k 855      13678 331
jun 20132,0 k2995285891,0 k 837      60278 331
mai 20131,9 k295506884990 778      37861 331
abr 20131,9 k289496684981 760      59059 331
mar 20131,8 k280484881944 728      44143 221
fev 20131,8 k263454581932 713      39042 111
jan 20131,7 k252434474918 687      92841 111
dez 20121,6 k246414074886 662      58238 11 
nov 20121,6 k234392474856 643      50622 11 
out 20121,4 k22037473810 638      6502 11 
set 20121,2 k21535470785 620      4142 11 
ago 20121,2 k20534465720 548      4582 11 
jul 20121,1 k19429358671 530      6512 1  
jun 20121,1 k18228355616 493      11012 1  
mai 201298315919253543 422      16072    
abr 201285814012139291 255      25381    
mar 2012659683 1134 91      1933     
fev 2012626    97 69      231     
jan 2012618    95 69      222     
dez 2011614    95 68      275     
nov 2011584    88 62      432     
out 2011546    86 50      144     
set 2011539    83 46      757     
ago 2011415    77 29      1091     
jul 2011233    66 15      351     
jun 2011191    47 12      1135     
mai 2011121    11 7      360     
abr 201186    10 6      120     
mar 201168    10 3      114     
fev 201148    10 3      3     
jan 201147    10 3            
dez 201047    10 3      76     
nov 201042    10 3            
out 201042    10 3      25     
set 201039    6 3      27     
ago 201020    6 3      58     
jul 20107    6 3            
jun 20107    6 3            
mai 20107    6 3            
abr 20107    6 3            
mar 20107    5 3            
fev 20107    5 3            
jan 20107    5 3            
dez 20097    5 3            
nov 20097    5 3            
out 20097    5 3            
set 20097    5 3            
ago 20097    5 3            
jul 20097    5 3      1     
jun 20097    5 3            
mai 20097    5 3            
abr 20097    5 3            
mar 20097    5 3            
fev 20097    5 3            
jan 20097    5 3            
dez 20087    5 3      11     
nov 20087    2              
out 20087    2              
set 20087    2              
ago 20087    2              
jul 20087    2              
jun 20087    2              
mai 20087    2              
abr 20087    2              
mar 20087    2              
fev 20085    1              
jan 20085    1              
dez 20075    1              
nov 20071    1              
out 20071    1              

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

out 2007: 1 2 Кьилин ччин

nov 2007: 1 2 Кьилин ччин

dez 2007: 1 2 Кьилин ччин

jan 2008: 1 1 Кьилин ччин

mar 2008: 1 2 Википедия , 2 1 Кьилин ччин

abr 2008: 1 1 Кьилин ччин

nov 2008: 1 1 Кьилин ччин

dez 2008: 1 1 Кьилин ччин

jul 2009: 1 1 Кьилин ччин

ago 2010: 1 3 Урусат , 2 3 Кьвевар , 3 3 Дагъустан , 4 2 Кьилин ччин , 5 2 Футбол

set 2010: 1 2 Кьилин ччин , 2 2 Лезги кхьинар , 3 2 Андорра

out 2010: 1 2 Шри-Ланка , 2 2 Африка

dez 2010: 1 3 Баку , 2 2 Шри-Ланка , 3 2 ЦӀийи Зеландия , 4 2 Футбол , 5 2 Талибан , 6 2 СтIал Сулейман , 7 2 Урусат , 8 2 Пакистан , 9 2 Лезгистан , 10 2 Лезги , 11 2 Къазакъстан

fev 2011: 1 1 Кьилин ччин

mar 2011: 1 3 Эрменистан , 2 3 Азербайжан , 3 2 Чувудар , 4 2 Париж , 5 2 Нил , 6 2 Гьайванар , 7 2 Лезгияр , 8 2 Гибралтар , 9 1 НуькI

abr 2011: 1 4 Кьилин ччин , 2 4 КцӀар , 3 3 Къазакъстан , 4 3 Ирландия , 5 2 Шри-Ланка , 6 2 Лезгистан , 7 2 Лезги чIал , 8 2 Лам

mai 2011: 1 5 ЧIехибритания , 2 5 Азия , 3 4 Лезгистан , 4 3 Советрин Социализмдин Республикайрин ГалкӀ , 5 2 Эрменистан , 6 2 Шри-Ланка , 7 2 Чувуд чӀал , 8 2 Китай чIал , 9 2 Туьрк чIал , 10 2 ТӀаратӀ , 11 2 Кьиблепатан Америка , 12 2 Къавкъаз , 13 1 Кьилин ччин

jun 2011: 1 4 Океания , 2 3 Эрменистан , 3 3 Крокодилар , 4 2 Кьилин ччин , 5 2 Юпитер , 6 2 Китайдин Халкьдин Республика , 7 2 Уганда , 8 2 Цифраяр , 9 2 Немец чIал , 10 2 Макао , 11 2 Лезгияр , 12 2 Лезгистан , 13 2 Къарагъанда , 14 2 Канада , 15 2 Кьиблепатан Америка , 16 1 НуькI

jul 2011: 1 4 Германия , 2 3 Европадин гьукуматар , 3 3 Греция , 4 2 Хьилер , 5 2 Саха чӀал , 6 2 Саха Республика , 7 2 Мегьарамдхуьр , 8 2 Лезгистан , 9 2 Къазакъстан , 10 1 Кьилин ччин

ago 2011: 1 3 НуькI , 2 3 Кьилин ччин , 3 3 Чурчул , 4 3 Хуьшрекандиз ухшар маймун , 5 3 Супик чӀал , 6 3 Саваннадин фил , 7 3 Наукандин юпик чӀал , 8 3 Мирикина , 9 3 Латин чIал , 10 3 Кьвевар , 11 3 Ибериядин сувайрин чурчул , 12 3 ГъвечӀи панда , 13 3 Гну , 14 3 Садхьанвай Араб Эмиратар , 15 3 Атна чӀал , 16 3 Аляскадин юпик чӀал , 17 3 Алеут чӀал , 18 2 Яру бубал , 19 2 Юпик чӀалар , 20 2 Эяк чӀал , 21 2 Эскимос-алеут чӀалар , 22 2 Экуь вили антилопа , 23 2 Чувуд чӀал , 24 2 Чевакдин чупик чӀал , 25 2 Чапла Канададин инуит чӀал

set 2011: 1 4 Туьркиядин лезги хуьрер , 2 3 Кьилин ччин , 3 3 Шергир , 4 3 Чинеруг , 5 3 Химия , 6 3 Туьтуьнуькl , 7 3 Хундуз , 8 3 Ортажа , 9 3 Лезги кхьинар , 10 3 Къванцин цуцӀул , 11 3 Йайлакёй , 12 3 ЦуцӀул-балугъчи , 13 3 Дагъустан , 14 3 Гьатем ага ЧӀакарви , 15 3 Гиенадал ухшар кицӀ , 16 3 География , 17 3 Ахцегь , 18 2 НуькI , 19 2 Яру жанавур , 20 2 Юсуф ал-Лезги , 21 2 МичIи куьрен кард , 22 2 Шахин , 23 2 Шангъар , 24 2 Чалагъан , 25 2 ЧIехибритания

out 2011: 1 3 Кьилин ччин , 2 3 Топонимика , 3 3 Сатурн , 4 2 Чил (планета) , 5 2 Хьилер , 6 2 Хашпара дин , 7 2 Футбол , 8 2 Теннис , 9 2 Урусат , 10 2 Мегьарамдхуьруьн район

nov 2011: 1 4 Рутул район , 2 4 Лезгистан , 3 3 Кьилин ччин , 4 3 Яру жанавур , 5 3 Финн чӀал , 6 3 Гъуьгъвезар , 7 3 Ахцегь , 8 3 Антилопа , 9 2 Цуругъ , 10 2 ЦIийи Кьуруш , 11 2 Хьилер , 12 2 Хуьшрекандиз ухшар маймун , 13 2 Хуьшрекан хьтин маймун , 14 2 УсухвацI , 15 2 Урус чIал , 16 2 Урбис , 17 2 Туьрк чIал , 18 2 Топонимика , 19 2 Смугъул , 20 2 Ситатунга , 21 2 СикӀер , 22 2 Планета , 23 2 Пирал , 24 2 Осло , 25 2 Орхидея

dez 2011: 1 3 Франция , 2 3 Къуйсун , 3 3 Имарат Къавкъаз , 4 2 Кьилин ччин , 5 2 Туьркменистан , 6 2 Суварин цӀиргъ , 7 2 Кеферпатан МуркIарин океан , 8 2 Монако , 9 2 Марсельеза , 10 2 Люксембург , 11 2 Индиядин океан , 12 1 НуькI

jan 2012: 1 4 Тай чӀал , 2 3 Мукьтадир , 3 2 Кьилин ччин , 4 2 Усугъчай , 5 2 Советрин Социализмдин Республикайрин ГалкӀ

fev 2012: 1 4 Кьилин ччин , 2 3 Гьажи Мегьамед Эфенди Штулви , 3 2 Мукьтадир , 4 2 Луткун , 5 2 Википедия

mar 2012: 1 13 Кьилин ччин , 2 10 Лезгияр , 3 8 Азербайжан , 4 7 Лезгистан , 5 7 Къуба , 6 7 Ингъушар , 7 7 Баку , 8 6 Урусат , 9 6 Къазакъстан , 10 6 Ахцегь район , 11 5 Эрменистан , 12 5 Европадин гьукуматар , 13 5 Советрин Социализмдин Республикайрин ГалкӀ , 14 5 ТӀаратӀ , 15 5 Лезгийрин тарих , 16 5 Кьиблепатан Америка , 17 5 Инглис чIал , 18 5 Заира Аминова , 19 5 Дагъустан , 20 5 Ахцегь , 21 5 Антарктида , 22 5 Али Султан , 23 4 Табасаранар , 24 4 Урусар , 25 4 ЦIийи Дуьнья

abr 2012: 1 6 Кьилин ччин , 2 6 Лезгияр , 3 5 Христофор Колумб , 4 5 Дуьньядин кьведлагьай дяве , 5 5 Польша , 6 5 Агъул район , 7 5 Рейн , 8 5 Литва , 9 5 Сауди Арабистан , 10 5 Пакистан , 11 5 Лезги чIал , 12 5 Азербайжан , 13 4 Философия , 14 4 Боливия , 15 4 Пакистандин пайдах , 16 4 Мегьамед Мегьамедан хва Гьажиев , 17 4 Италия , 18 4 Лезги Википедия , 19 4 Сара Бернар , 20 4 ЦӀийи гафарин сиягь , 21 4 Грекрин алфавит , 22 4 Тегьран , 23 4 Урусар , 24 4 Кореядин Халкьдинни-Демократиядин Республика , 25 4 Афинар

mai 2012: 1 5 Португалия , 2 5 Мисри , 3 5 Ахцегь , 4 4 Каир , 5 4 Puzzling World , 6 4 Владимир Владимирович Путин , 7 4 Falco vespertinus , 8 4 I Наполеон Бонапарт , 9 4 Трпиня , 10 4 Кьилин ччин , 11 4 Италия , 12 4 Дунай , 13 4 Гъед (гьайванар) , 14 3 Абдул Мажид , 15 3 Португал чIал , 16 3 Колибри , 17 3 Дуэро , 18 3 Португалиядин шегьерар , 19 3 Альберт Эйнштейн , 20 3 Кьибле-Африкадин Республика , 21 3 Улуб , 22 3 Мастурбация , 23 3 Яру улуб , 24 3 Астероид , 25 3 Динозавраяр

jun 2012: 1 7 Мугьаммад , 2 6 Византий империя , 3 5 Исаак Ньютон , 4 5 Аллагьдин 99 тӀвар , 5 5 Алюминий , 6 5 Урусат , 7 4 Аврил Лавин , 8 4 Гелхен , 9 4 Химиядин элементрин девирдин система , 10 4 Шахматар , 11 4 Осман империя , 12 4 Византиядин императоррин сиягь , 13 4 Республика Корея , 14 4 The Macallan , 15 4 Суван Къарабагъ , 16 4 Китайдин Халкьдин Республика , 17 4 Финн чӀал , 18 4 Ахцегь , 19 4 Айдагьо , 20 3 Брест , 21 3 Вольфганг Амадеус Моцарт , 22 3 Математика , 23 3 Бубуяр , 24 3 Сятдин чӀул , 25 3 Гьукуматдин идара авунин тегьер

jul 2012: 1 4 Санкт-Петербург , 2 4 ЧӀехи Француз инкъилаб , 3 4 Рим империя , 4 4 Куба , 5 3 Дуьньядин чими хьун , 6 3 Эсперанто , 7 3 Волга , 8 3 Эрнесто Че Гевара , 9 3 Яд , 10 3 Автомобилдин код , 11 3 Математика , 12 3 Чил (планета) , 13 3 Сев , 14 2 Лелевар , 15 2 Постессив аватвал , 16 2 Археяр , 17 2 Биология , 18 2 Дезоксирибонуклеин цуруцӀ , 19 2 Велс , 20 2 Садхьанвай миллетрин тешкилат , 21 2 Че Гевара , 22 2 Расим Загьирбег хва Тагирбеков , 23 2 Рахазвайбурун кьадардиз килигна чӀаларин сиягь , 24 2 Автомобил код , 25 2 Почтунин индекс

ago 2012: 1 7 Лезгистан , 2 5 Олимпиядин къугъунар , 3 4 Рим , 4 3 КӀамс , 5 3 Сочи , 6 3 Биология , 7 3 Грекрин алфавит , 8 2 Экваториал Гвинея , 9 2 Чарльз Дарвин , 10 2 Искандер Македонжув , 11 2 The Beatles , 12 2 Иосиф Виссарионович Сталин , 13 2 Сингапур , 14 2 Гуржи чIал , 15 2 Хунзах район , 16 2 2012 Гатун Олимпия къугъунар , 17 2 Велс , 18 2 Эсперанто , 19 2 Куба , 20 2 Португалия , 21 2 Тегьран , 22 2 Урус чIал , 23 2 Тувалу , 24 2 Лас океан , 25 1 Никlи

set 2012: 1 3 Юлий Цезарь , 2 3 Иерусалим , 3 3 Таиланд , 4 3 Жозе Мария Эса ди Кейруш , 5 3 Ботлих , 6 3 Акуша , 7 3 Алпан , 8 3 Хошимин , 9 3 Кьулан вацI , 10 3 Париж , 11 2 Физика , 12 2 Дегь Мисри , 13 2 ПIатIар , 14 2 Сарфунъял , 15 2 Экология , 16 2 Вунгтау , 17 2 Нячанг , 18 2 Америка , 19 2 Кертагъ Давдакь , 20 2 С , 21 2 Слово (газет, Португалия) , 22 2 Эйсебио , 23 2 Маяк Португалии , 24 1 Донгхой

out 2012: 1 4 Мадрид , 2 4 Вена , 3 3 Хуьруьн майишат , 4 3 Кефердинни рагъакIидай Англия , 5 3 Ливерпульдин агломерация , 6 3 Неаполь , 7 3 Турин , 8 3 ЦIуру Худат , 9 3 Хурай (КцIар) , 10 3 Немец чIал , 11 2 Мирземугьаммадхъишлах , 12 2 Эрдэнэт , 13 2 Монгол чӀал , 14 2 Улан-Батор , 15 2 Чархы , 16 2 Жанахир , 17 2 ЧIал , 18 2 Карл Маркс , 19 2 Салвадор Дали , 20 2 Акбар ЧӀехи , 21 2 Гаф , 22 2 Slayer , 23 2 Пекин , 24 2 Къусарчай (Хъачмаз) , 25 2 Гуьнешли

nov 2012: 1 4 Компьютер , 2 4 Садвал , 3 3 Чепер , 4 3 Уран (планета) , 5 3 Каракорум (шегьер) , 6 3 Куритиба , 7 3 Гилияр , 8 3 Водород , 9 3 Грар , 10 3 Магьачкъала , 11 3 Дербент район , 12 2 Людвиг ван Бетховен , 13 2 Ӄ , 14 2 Дагъустандин ЦIаяр , 15 2 Дагъустандин шегьерар , 16 2 Ухул , 17 2 1930 йис , 18 2 Мичегь , 19 2 Калук , 20 2 Приморск (Дагъустан) , 21 2 Венесуэла , 22 2 КьепIир Къазмаяр , 23 2 Хуьлуьхъ , 24 2 ПIатIар , 25 2 Рим

dez 2012: 1 3 Кьулан СтIал , 2 3 Къайи дяве , 3 3 Вепс чӀал , 4 3 Пудлагьай рейх , 5 3 Велс , 6 3 Астероид , 7 3 Ле Корбюзье , 8 2 Камарван , 9 2 Пиперхуьр , 10 2 КIахцугъ , 11 2 Герейханован совхоздин 2-лагьай отделение , 12 2 Зари , 13 2 Алкьвадар , 14 2 Усур , 15 2 Хашпересрин финар , 16 2 Вьетнамдин дяве , 17 2 1930 йис , 18 2 Сарфунъял , 19 2 Усугъчай , 20 2 Туьркер-Месхетинар , 21 2 ТӀиб , 22 2 Марс , 23 2 Кьасумхуьр , 24 1 Пак тир Рим империя

jan 2013: 1 3 Индуизм , 2 3 Лезгияр , 3 2 Вашингтон (кьилин шегьер) , 4 2 Ахвах район , 5 2 Акуша район , 6 2 1812 йис , 7 2 1866 йис , 8 2 1878 йис , 9 2 1969 йис , 10 2 Вини СтIал , 11 2 , 12 2 Пак тир Рим империя , 13 2 Компьютер , 14 2 Велиханрин Къудрат Кибечханан хва , 15 2 Волга , 16 2 Мугьаммад , 17 2 ЧӀулав тӀеквен , 18 2 Сампи , 19 2 Промышленность , 20 2 2012 йис , 21 2 Рейн , 22 2 Пси (гьарф) , 23 2 Фи , 24 2 Ипсилон , 25 2 Тау

fev 2013: 1 2 Фридрих Ницше , 2 2 Бум , 3 2 Къарасу , 4 2 Къарадейн , 5 2 Кичик ПIирали , 6 2 Курд (Кьвепеле) , 7 2 Кветуьклуь , 8 2 Имамлы , 9 2 Зергерли , 10 2 Зараган , 11 2 Залам , 12 2 Жигъателли , 13 2 Жорлу , 14 2 Енгиже

mar 2013: 1 3 1949 йис , 2 3 1969 йис , 3 3 Турция , 4 3 Айдагьо , 5 3 Абхазия , 6 2 Дегь Греция , 7 2 Валенсия (мана) , 8 2 Илим , 9 2 АСШ-дин граждан дяве , 10 2 Гарринча , 11 2 ЧӀулав хъалхъам , 12 2 Элвис Пресли , 13 2 Байуба , 14 2 Дунчэн (Пекин) , 15 2 Садхьанвай миллетрин тешкилат , 16 2 Каир , 17 2 ЧӀулав тӀеквен , 18 2 Лекь (анатомия) , 19 2 Яру жанавур , 20 2 Эхен , 21 2 Китайдин Халкьдин Республика , 22 2 Чиле , 23 2 Лас океан , 24 2 Пахун , 25 2 Некхъвадайбур

abr 2013: 1 5 Амстердам , 2 3 Гонконг , 3 3 Октавиан Август , 4 3 Плазма , 5 3 Ракь , 6 3 Рио-де-Жанейро , 7 3 Метр , 8 3 Буэнос-Айрес , 9 3 Иерусалим , 10 3 Дагъустан , 11 2 Умар Хайям , 12 2 Сувар (ансамбль) , 13 2 Керимрин Седакъет Къайинбеган руш , 14 2 Метаболизм , 15 2 Кизилюрт , 16 2 Михаил Лезгинцев , 17 2 Атом , 18 2 Гьуьсейнов Абдусалам Абдулкериман хва , 19 2 Барселона (мана) , 20 2 Агъдам район , 21 2 Нежефхуьр , 22 2 Ахцегьрин гьамамар , 23 2 Грар , 24 2 Юсуф ал-Лезги , 25 2 Эфиопидин чъакъал

mai 2013: 1 3 Франция , 2 2 Москва вилаят , 3 2 Альгеро , 4 2 Алпан (манаяр) , 5 2 Алпан (астрономия) , 6 2 Алпан

jun 2013: 1 3 Марко Поло , 2 3 Демократия , 3 3 Фу , 4 2 Мидгьед Ширинбегов , 5 2 Иисусан гьакъикъи клиса , 6 2 Александр Ильич Рыбников , 7 2 Кьавал , 8 2 Агъул чIал , 9 2 Хвереж (Кьурагь район) , 10 2 Усугъ , 11 2 Вулкан (геология) , 12 2 Абилов Магьмуд Абдулрзадин хва , 13 2 Митаги хуьруьнсовет , 14 2 Хазар хуьруьнсовет , 15 1 Кьилерин хуьруьнсовет

jul 2013: 1 2 Хъачмаз район , 2 1 Зигмунд Фрейд

ago 2013: 1 3 Католицизм , 2 3 Чингисхан , 3 3 Винстон Черчилль , 4 2 Урусатдин тӀаратӀ , 5 2 Табасаран чIал , 6 2 Дагъустандин тIаратI , 7 2 Гоа (Дагъустан) , 8 2 Мыгра (Дагъустан) , 9 2 Кина (Дагъустан) , 10 2 Британиядин империя , 11 2 Вини Катрух , 12 2 Автомобиль , 13 2 Марко Поло , 14 2 Агъул чIал , 15 2 ЧIал , 16 2 ЦIийихуьр , 17 2 Христофор Колумб , 18 2 ТӀаратӀ , 19 2 Лезги чIал , 20 2 Кьвевар , 21 1 Будугъ чIал

set 2013: 1 3 Авраам Линкольн , 2 3 КъирицI чIал , 3 2 Чилин зурзунар , 4 2 Хинелугъ чIал , 5 2 Нидерландар , 6 2 Китайдин Халкьдин Республика , 7 2 Саха Республика , 8 1 ЦIуру Киркар

out 2013: 1 3 Лезгияр , 2 2 Холокост , 3 2 Хамаматюрт , 4 2 Адиль-Янгиюрт , 5 2 Бабаюрт , 6 2 Чилин зурзунар , 7 2 Табасаранар , 8 1 ЧӀутрацуьк

nov 2013: 1 3 Аристотель , 2 3 Бактерияр , 3 2 Ингушетия , 4 2 UTC+4 , 5 2 Терек , 6 2 Хуьр , 7 2 Шегьер , 8 2 АхцегьвацӀ , 9 2 Мустафа Камал Ататуьрк , 10 1 Муниципал район

dez 2013: 1 3 КуртӀухъан , 2 3 Атлантик океан , 3 3 Харахуба , 4 2 Пепеяр , 5 2 Малярия , 6 1 Тарих

jan 2014: 1 3 Мирослава Вавринец , 2 3 Роджер Федерер , 3 3 Валентина Васильевна Толкунова , 4 3 Кьвепеле , 5 2 Затор , 6 2 Бойнице , 7 2 Куколивка

fev 2014: 1 3 Шахматар , 2 2 Сан-Паулу , 3 2 Гуржистан , 4 2 Абхазия , 5 1 Славян чIалар

mar 2014: 1 3 Поляк чIал , 2 3 Словак чIал , 3 3 Чех чIал , 4 2 Кашуб чIал , 5 1 НАТО

abr 2014: 1 3 Алискерово (посёлок) , 2 2 Тито Виланова , 3 2 Баламирзоев Абдул Гьажибаладин хва , 4 2 Поречье хуьруьнсовет (Тула вилаят) , 5 2 Дубна (Тула вилаят) , 6 2 Фотосинтез , 7 1 Синусоида

mai 2014: 1 3 Грек чӀал , 2 3 Сидней , 3 3 Вичи-вич кьин , 4 3 Сеул , 5 3 Салигьов Эсед Бабастанан хва , 6 3 Верем , 7 2 Metallica , 8 2 Пурни , 9 2 Мумбаи , 10 2 ТӀач , 11 2 Бебелук , 12 2 2014 ХъуьтӀуьн Олимпия къугъунар , 13 2 ЧӀулавкьал , 14 2 ЦӀегьрекарч , 15 2 Словак чIал , 16 1 Лезги литература

jun 2014: 1 2 Фернан Магеллан , 2 2 Цур , 3 2 Геология , 4 2 Етим Эмин , 5 2 Храхуба , 6 2 Гуржи чIал , 7 2 Далдам , 8 1 Инд океан

jul 2014: 1 2 Джяравица , 2 2 Европадин таж , 3 2 Квеста , 4 2 Париж бассейн , 5 1 Ботсвана

ago 2014: 1 3 Робин Уильямс , 2 2 Джульярд мектеб , 3 2 ЦIуьлуьк , 4 2 Хъутур-Куьредин наибвал , 5 1 Аль-Муайдар

set 2014: 1 3 Ио , 2 2 Вилиам Хьайд Волластон , 3 2 Владимир Владимирович Путин , 4 2 Юрий Алексеевич Гагарин , 5 1 Черногориядин шегьерар

out 2014: 1 2 Чай , 2 2 Балтик гьуьлуьн пешекарвилин галкIрин чил , 3 2 Латвия , 4 2 Эстония , 5 2 Братислава , 6 2 Прагьа , 7 1 Кения

nov 2014: 1 2 Анархизм , 2 2 Аргентина , 3 2 Нью-Йорк , 4 1 Амадора

dez 2014: 1 2 Дакка , 2 2 Гьукумат Палестина , 3 1 Къеди

jan 2015: 1 2 Сокольническая цӀар , 2 2 ТупӀалдин цӀар (Москва) , 3 1 Эседуллагь Эмирагъайрин

fev 2015: 1 2 Яргъал тир рагъэкъечӀдайпатан федерал округ , 2 2 Абдусамад Гьамидов , 3 2 Гьарйяна , 4 2 Никола Тесла , 5 2 Халилов Юсиф Мевлуьдан хва , 6 2 Экономика , 7 2 Чингисхан , 8 2 Умар ибн Гьаттаб , 9 1 Кьилин мефтӀ

No data on this page have been normalized to 30 day months (as WMF does on certain traffic reports).
Wikipedias are initially ordered by number of speakers of the language

Speakers: Number of speakers of a language is the estimated total of primary and secondary speakers, is in many cases a very rough estimation (based on the page on the English Wikipedia about that language)
Regions are parts of the world where the language is spoken in substantial amounts (compared to total number of speakers). Regions where a language gained presence only by a recent diaspora are generally not included.
Region codes: AF:Africa, AS:Asia, EU:Europe, NA:North America, OC:Oceania, SA:South America, W:World Wide, CL:Constructed Language

Estatísticas geradas em Quinta-feira, 26 de março 2015 22:09

Dump file lezwiki-20150324-stub-meta-history.xml.gz (edits only), size 3.6 Mb as gz -> 25 Mb
Dump processed till Feb 28, 2015, on server stat1002, ready at Tue-24/03/2015-10:04 after 23 sec.

Versão do script:2.6
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.