Estatísticas da Wikipédia lezgian

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Articles per size range / Records per namespace / Most edited articles / Zeitgeist

Most metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.

Some metrics have been collected from the full archive dump which runs on lower frequency than the usual monthly cycle.
These metrics are columns F,I,J,K,M,N,O,P,Q,R from the first table.


See also metrics definitions


 
Monthly counts & Quarterly rankings: março 2015
 
DataWikipedistasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
mar 2015+3%   0%      +246%      +2%
fev 2015+2%   +1%      +81%      +1%
jan 20150%   +1%      +96%      0%
dez 20140%   0%      -29%      0%
nov 20140%   0%      -41%      0%
out 2014+2%   +1%      +57%      +1%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P____Q____R____S__
mar 2015622512,2 k  16,3   564      573
fev 20156014 2,2 k 116,1   163      563
jan 201559 3 2,1 k 116,2   90      557
dez 201459 3 2,1 k  16,2   46      555
nov 201459 2 2,1 k  16,2   65      553
out 20145913 2,1 k  16,3   110      552
set 20145813 2,1 k 116,3   70      549
ago 201457 412,1 k 216,4   287      547
jul 201457 212,0 k 116,7   177      540
jun 20145726 2,0 k 116,8   230      537
mai 20145516 2,0 k 116,9   279      529
abr 201454 4 1,9 k  17   159      507
mar 201454 4 1,9 k  17   137      500
fev 201454 2 1,9 k1,7 k 17233179%38%858,5 Mb587 k36 k2402,3 k5,4 k495
jan 2014542611,9 k1,7 k 17233379%38%3548,5 Mb584 k36 k2402,2 k5,4 k492
dez 201352 3 1,9 k1,7 k 16,9233079%38%1448,5 Mb581 k35 k2402,2 k5,4 k489
nov 201352 4 1,9 k1,7 k116,9232879%38%1728,4 Mb578 k35 k2402,2 k5,4 k488
out 2013521311,9 k1,7 k317233279%38%5298,4 Mb574 k35 k2432,2 k5,3 k482
set 201351 311,8 k1,6 k217,5226578%36%5717,7 Mb533 k32 k3552,2 k4,9 k478
ago 201351 211,7 k1,6 k517,7218577%33%9047,3 Mb500 k31 k3552,2 k4,6 k472
jul 201351 2 1,6 k1,4 k118,8207075%29%1586,3 Mb433 k27 k5312,1 k3,9 k437
jun 201351 311,6 k1,4 k218,9205774%29%6366,1 Mb426 k26 k5342,1 k3,9 k434
mai 201351 211,5 k1,3 k219,4199274%27%4125,7 Mb395 k24 k4862,1 k3,5 k422
abr 201351 521,4 k1,2 k120194273%24%6665,3 Mb370 k23 k4892,1 k3,2 k421
mar 2013511511,4 k1,2 k 20,1187171%23%2,1 k4,9 Mb346 k22 k1,1 k2,1 k3,0 k406
fev 201350 321,4 k1,2 k318,7183472%23%1,3 k6,5 Mb337 k21 k67 k2,1 k2,9 k398
jan 201350 421,3 k1,1 k218,9182571%23%1,6 k6,2 Mb318 k21 k66 k2,1 k2,8 k392
dez 201250 511,2 k1,1 k218,5180971%22%1,2 k5,9 Mb301 k20 k64 k2,1 k2,6 k381
nov 2012501711,2 k1,0 k418,5174870%18%1,1 k5,5 Mb276 k18 k63 k2,1 k2,4 k369
out 2012492521,1 k946619,3175768%18%1,2 k5,1 Mb254 k17 k61 k1,9 k2,2 k361
set 201247 51873746122,4185161%21%1,3 k4,5 Mb220 k15 k58 k1,5 k1,9 k345
ago 201247162842711121,7178860%20%9774,3 Mb204 k15 k56 k1,5 k1,7 k340
jul 2012461123820689121,1167359%19%1,3 k3,9 Mb186 k13 k54 k1,2 k1,6 k319
jun 2012451133781637220,4145454%17%1,7 k3,4 Mb154 k11 k50 k1,1 k1,4 k295
mai 201244193721564219,7123750%15%2,2 k2,9 Mb121 k8,2 k47 k1,0 k1,1 k252
abr 201243317566850031898444%12%3,1 k2,4 Mb89 k6,2 k42 k790727189
mar 2012408206566393115,881139%8%2,4 k1,8 Mb61 k3,4 k34 k70834892
fev 201232141538388 12,180040%8%7081,6 Mb59 k3,2 k28 k68830787
jan 201231121534386 10,978040%8%2331,4 Mb57 k3,3 k23 k68730683
dez 201130 41530383110,577240%8%2921,4 Mb56 k3,2 k23 k68430483
nov 201130371508370110,478941%8%4381,3 Mb55 k3,1 k21 k66430376
out 201127 4 488348 9,978440%8%3491,3 Mb52 k2,8 k21 k65029758
set 201127410248334549,378740%8%7701,1 Mb52 k2,8 k14 k64931356
ago 201123610237626959,987643%10%1,1 k954 kb45 k2,4 k12 k53331139
jul 201117181220166111,973245%8%361537 kb23 k8298,7 k35918713
jun 201116 51179131212,680451%10%1,2 k487 kb21 k6528,0 k28016412
mai 2011163811125719,860327%12%436322 kb9,9 k2967,3 k106299
abr 20111325 794018,451125%11%157210 kb5,8 k1484,9 k8817
mar 20111123 613418,360230%15%141201 kb5,3 k1284,9 k7517
fev 20119   4131 8,983641%22%3169 kb4,9 k1223,7 k56 7
jan 20119   4031 9,183642%22%3167 kb4,9 k1223,7 k56 7
dez 2010912 4031 983642%22%77167 kb4,9 k1223,7 k56 7
nov 20108   4023 7131138%22% 130 kb7,8 k1219195922
out 2010812 4023 7131138%22%36130 kb7,8 k1219195922
set 2010711 372216,6145741%19%113128 kb7,6 k1219186322
ago 2010622 1918 7103163%26%5866 kb2,9 k12089457 1
jul 20104   65 12,585750%33%415 kb956151334 1
jun 20104   65 11,885750%33% 15 kb956151334 1
mai 20104   65 11,885750%33%415 kb956151334 1
abr 20104   65 11,285750%33% 15 kb956151334 1
mar 20104   65 11,285750%33% 15 kb956151334 1
fev 20104   65 11,285750%33% 15 kb956151334 1
jan 20104   65 11,285750%33%315 kb956151334 1
dez 20094   65 10,785750%33% 15 kb956151294 1
nov 20094   65 10,785750%33% 15 kb956151294 1
out 20094   65 10,785750%33% 15 kb956151294 1
set 20094   65 10,785750%33% 15 kb956151294 1
ago 20094   65 10,785750%33% 15 kb956151294 1
jul 20094   65 10,785750%33%115 kb956151294 1
jun 20094   65 10,585750%33% 14 kb95615184 1
mai 20094   65 10,585750%33% 14 kb95615184 1
abr 20094   65 10,585750%33% 14 kb95615184 1
mar 20094   65 10,585750%33% 14 kb95615184 1
fev 20094   65 10,585750%33% 14 kb95615184 1
jan 20094   65 10,585750%33% 14 kb95615184 1
dez 2008411 65 10,585750%33%1114 kb95615184 1
nov 20083   65 8,782650%33%112 kb9261183 1
out 20083   65 8,582550%33% 12 kb9231183 1
set 20083   65 8,582550%33% 12 kb9231183 1
ago 20083   65 8,582550%33% 12 kb9231183 1
jul 20083   65 8,582550%33% 12 kb9231183 1
jun 20083   65 8,582550%33% 12 kb9231183 1
mai 20083   65 8,582550%33%712 kb9231183 1
abr 20083   65 7,382550%33%412 kb9231183 1
mar 20083   65 6,781350%33%712 kb9071183 1
fev 20083   44 8,21615100%75% 19 kb1,3 k6921111
jan 2008311 44 8,21615100%75%719 kb1,3 k6921111
dez 2007211 42 6,5145450%50%1818 kb7626629 1
nov 20071   11 82920100%100%65,9 kb3476328  
out 200711  1  242  2104 6     
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
The following table ranks this project in relation to projects in other languages with 1000+ articles
jan 2015155 149 193 159163   176      250
out 2014153138146 194  162   156      250
jul 2014153 168133194 150160   153      250
abr 2014159 136 193  157   161      250
jan 2014156113118141192180156160496827138144158156209137130250
out 2013157147155127192180102162476627107145156156216136130250
jul 2013155138170132200184154150597750155153172170187135136250
abr 2013154145126104201184155143698262138161176175197135141250
jan 2013153145135101202183119148718367151182180174201138140250
out 201215310711910020618884143779187169190184179203138148250
jul 20121551348790211199150207206206204164200190182204152157250
abr 2012153867774214202108205204204201108207208206210164183250
jan 2012178144172135215208150204203203200230221221219227173203250
out 2011185148139142217208160203202202199223219219224227172202250
jul 201122014497137235225158200199199196220235229234239193211250
abr 201123097128132246241155197196196193234244243245244231248250
jan 2011236153223135249244157195194194191249246244245246240248250
out 2010239146169128249244152188187187185245245240245248235247250
jul 2010247159222140249248157183182182180249248248248248247248250
abr 2010247149208136249247158180179179178249248248248248246248250
jan 2010244148203129248247154178178178177244249248248248245248250
out 2009243143209135248247159175175175174246249248248248244248250
jul 2009240190200130247245150168168168167243245245247247245245250
abr 2009240140201142245244146166166166165245246245247246244242250
jan 2009238133205130245243146161161161160247244244244245244243249
out 2008238136197128243238143155155155154243241241242243242242247
jul 2008235149200132241236145149149149147241239238240242239242247
abr 2008232145206130240235149144144143141241238235240242238240247
jan 2008229140197131237232151140140139138234234229227238226233244
out 2007239135193130240239146138138136136234241239239236233231242
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
 WikipedistasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikipedistas (usuários registrados)
A = Wikipedistas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikipedistas que editaram pelo menos dez vezes desde que chegaram
C = Wikipedistas que contribuíram cinco vezes ou mais este mês
D = Wikipedistas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Artigos que contêm pelo menos uma ligação interna e 200 caracteres de texto legível, não contando códigos wiki e html,
      ligações ocultas, etc.; títulos também não contam (outras colunas são baseadas no método oficial de contagem)
G = Novos artigos por dia no mês passado
H = Número médio de revisões por artigo
I = Tamanho médio dos artigos em bytes
J = Porcentagem de artigos com pelo menos 0,5 kb de texto legível (veja F)
K = Porcentagem de artigos com pelo menos 2 kb de texto legível (veja F)

Base de dados
L = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
M = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
N = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
O = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
P = Total de ligações para outras wikipédias
Q = Total de imagens apresentadas
R = Total de ligações para outros sítios
S = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  5  10  100  1000  1  3  5  10  25  100  5  10  1  3  5  10  25  100  250  5  10  100 
mar 201512654211 11  311   115211   32 
fev 2015115441  1   31      8311   22 
jan 201584332      831     5221   22 
dez 20148331       5       711    22 
nov 201452221  11  21      63211  22 
out 2014114322      3       82111  22 
set 201493331      711     6211   22 
ago 2014844421  11  41      94433  22 
jul 2014922211      1       43221  22 
jun 201496652  11  32      42111  22 
mai 2014176663      3221    95322  22 
abr 2014115432  1   221     72221  21 
mar 2014134442  11  421     5111   22 
fev 201415222       321     7111   22 
jan 20141286431  11  321     6322   32 
dez 2013114332  11  622     52111  11 
nov 2013115433  11  5211    122221  11 
out 20139432111 21  62      633211111 
set 20139332211     53      933321 22 
ago 20134322211 2   53211   8222221431
jul 201342222      31      932211 33 
jun 20137332211 1   8521    733222 32 
mai 20136222111 11  531     112222  21 
abr 201313555321 33  4443    1133322 541
mar 201314652211 7611102211   2054221 541
fev 2013933222  1063 6221    843221 971
jan 201315543221 1363 6322    933321 961
jan 201584332      831     5221   22 
out 2014114322      3       82111  22 
jul 2014922211      1       43221  22 
abr 2014115432  1   221     72221  21 
jan 20141286431  11  321     6322   32 
out 20139432111 21  62      633211111 
jul 201342222      31      932211 33 
abr 201313555321 33  4443    1133322 541
jan 201315543221 1363 6322    933321 961
out 201211655321 862 74321   1254321 851
jul 2012181212853  872 1711842   2314141031 771
abr 201232211710754 971 341914853  572312774143 
jan 2012742221      1       1         
out 201185441  111         11111  11 
jul 201110884111     322     421111    
abr 201165551      1       1         
jan 2011                            
out 20103221               2111      
jul 2010                            
abr 2010                  2         
jan 2010                            
out 2009                            
jul 20091                           
abr 2009                            
jan 2009                  1         
out 2008                            
jul 2008                  2         
abr 200811                          
jan 2008111                          
out 20072                           

 

Distribuição de edições de artigos por wikipedistas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikipedistasEdições total
1250100.0%23,842100.0%
39638.4%23,64999.2%
106224.8%23,46198.4%
323313.2%22,97896.4%
100187.2%22,33393.7%
316124.8%21,55190.4%
100052.0%17,55373.6%
316220.8%11,70349.1%

 

12 wikipedistas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdições 
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
 agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
Soul TrainUC2 04,411455,75330mar 28, 20121097101---
MugerganetsUC6 086222841out 13, 20128981445--
MaxBioHazardUC11...389389--mar 11, 201519----
JaqeliUC42+121311jun 15, 201428811--
AmikecoUC43-22011-nov 14, 20072693----
Страна ГорUC57...1212--mar 04, 20152622--
Kulkin nikolayUC75...66--mar 24, 20156----
BayramovaUC76...6622mar 25, 20155----
Ruy PugliesiUC247...11--mar 06, 201524----
J. Patrick FischerUC248...11--mar 18, 201512----
DIREKTORUC249...11--mar 20, 201510----
OursanaUC250...11--mar 23, 20157----

 

20 wikipedistas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
  Primeira ediçãoúltima edição
 posiçãototaldatadias
atrás
datadias
atrás
Aslan4ikUC17,292jan 21, 20121164ago 16, 2014226
Namik555UC32,781mar 07, 20111484abr 21, 20121073
MigraghviUC41,575ago 31, 20111307fev 28, 201530
LezgistxaUC51,494set 20, 20111287jun 01, 20121032
SPQRobinUC7633mar 27, 20121098mar 27, 20121098
User from DagUC8629ago 17, 20101686fev 15, 201543
Tamara UstinovaUC9589nov 14, 20111232dez 04, 2013481
KmoksyUC10512ago 11, 20111327fev 12, 201546
Saint JohannUC12384mar 28, 20121097out 15, 2012896
Cekli829UC13178mar 10, 20111481mai 17, 2014317
MaqiviUC14154out 07, 20111270set 03, 2013573
U.SteeleUC15125ago 02, 20111336mar 31, 20121094
LezgiUC16116abr 27, 20111433jun 02, 20121031
МаликумUC17106fev 07, 20121147mar 22, 2014373
HydrizUC18103jan 30, 2014424jan 30, 2014424
NessajaUC1990abr 25, 20121069out 05, 2014176
91i79UC2055mar 27, 20121098out 12, 2014169
Master ShadowUC2153out 12, 20101630dez 14, 20101567
FsFUC2248jul 26, 2012977jul 29, 2012974
KaiyrUC2345ago 30, 20101673set 02, 20111305

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 1.578 edições foram feitas por usuários anônimos, de um total de 35.153 edições ( 4e %)
  


42 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições 
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
 datadias
atrás
datadias
atrás
MerlIwBotUC12,605mai 27, 20111403ago 09, 2013598--
EmausBotUC21,645abr 16, 20121078nov 09, 2013506--
AddbotUC31,472mar 07, 2013753ago 16, 2013591--
XqbotUC41,027abr 16, 20121078mar 06, 2013754--
JackieBotUC5909abr 26, 20121068dez 01, 2014119--
AvocatoBotUC6444mar 29, 20121096jul 07, 2012996--
GerakibotUC7324mai 24, 20121040mar 06, 2013754--
RedBotUC8171abr 22, 20121072ago 21, 2012951--
Makecat-botUC9149nov 01, 2012879mar 03, 2013757--
LegobotUC10107mar 11, 2013749abr 02, 2013727--
Idioma-botUC1197mar 27, 20121098mar 04, 2013756--
Justincheng12345-botUC1289jun 25, 20121008jan 10, 2013809--
MBHbotUC1367mar 11, 201519mar 11, 201519--
YFdyh-botUC1463jul 01, 20121002fev 18, 2013770--
LaaknorBotUC1561mai 22, 20121042mar 05, 2013755--
JhsBotUC1655mar 28, 20121097jul 08, 2012995--
EscarbotUC1747abr 03, 20121091out 16, 2012895--
VolkovBotUC1846abr 28, 20121066fev 27, 2013761--
KamikazeBotUC1945mar 29, 20121096jan 24, 2013795--
JAnDbotUC2041mar 29, 20121096jul 02, 2013636--
AvicBotUC2140jun 01, 20121032dez 09, 2012841--
CarsracBotUC2235mar 31, 20121094fev 12, 2013776--
HiW-BotUC2329abr 07, 20121087out 18, 2012893--
VagobotUC2422mar 29, 20121096abr 30, 20121064--
SantoshBotUC2522out 21, 2012890jan 31, 2013788--
SynthebotUC2621set 20, 2012921jan 25, 2013794--
CommonsDelinkerUC2714abr 26, 20111434mar 19, 201511--
タチコマ robotUC2814out 20, 2012891out 21, 2012890--
PixelBotUC2913jul 20, 2012983mar 06, 2013754--
JotterbotUC3012jan 15, 2013804jan 18, 2013801--
Crochet.david.botUC317mai 07, 20082518mai 07, 20082518--
RobbotUC326mai 07, 20121057jan 02, 2013817--
CocuBotUC335ago 26, 2012946dez 15, 2012835--
OctraBotUC345mai 12, 2014322jan 30, 201559--
NjardarBotUC354ago 28, 2012944ago 31, 2012941--
SassoBotUC362mai 29, 20121035jan 07, 2013812--
ObersachsebotUC372nov 24, 2012856jan 08, 2013811--
DragonBotUC382jan 13, 2013806jan 14, 2013805--
MalarzBOTUC391ago 18, 2012954ago 18, 2012954--
GhalyBotUC401jan 18, 2013801jan 18, 2013801--
SAMI.BotUC411fev 05, 2013783fev 05, 2013783--
MastiBotUC421mar 01, 2013759mar 01, 2013759--

 

Artigos que contêm pelo menos uma ligação interna e .. caracteres de texto legível, não contando códigos wiki e html,
ligações ocultas, etc.; títulos também não contam  (excluindo páginas de redirecionamento)

DataArtigos
 < 32 ch< 64 ch< 128 ch< 256 ch< 512 ch< 1 k ch< 2 k ch< 4 k ch< 8 k ch< 16 k ch< 32 k ch< 64 k ch

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110JpgOggPngSvgWebm
mar 20152,7 k391871111001,2 k 1,0 k       991641
fev 20152,7 k38884111971,2 k 1,0 k       991641
jan 20152,7 k38484111971,2 k 1,0 k       991641
dez 20142,7 k37882111971,2 k 1,0 k       991641
nov 20142,7 k37481111971,2 k 1,0 k       991641
out 20142,7 k37080111971,2 k 1,0 k       991641
set 20142,6 k36978111971,2 k 1,0 k       991641
ago 20142,6 k36477111941,2 k 1,0 k       991641
jul 20142,6 k35976111941,2 k 998       991641
jun 20142,5 k35875111941,1 k 996       991641
mai 20142,5 k35874111921,1 k 989       991641
abr 20142,5 k35471110891,1 k 982       991631
mar 20142,4 k35169110891,1 k 981       991631
fev 20142,4 k34868109881,1 k 979      53991531
jan 20142,4 k34367109881,1 k 976      210991531
dez 20132,4 k33465109881,1 k 972      113991531
nov 20132,4 k33364109841,1 k 960      138991531
out 20132,4 k32663109841,1 k 953      445991531
set 20132,3 k3216291841,1 k 934      552831331
ago 20132,2 k3035889841,1 k 914      877811331
jul 20132,0 k2995385801,0 k 855      13678 331
jun 20132,0 k2965285781,0 k 837      60278 331
mai 20131,9 k292506873989 778      37861 331
abr 20131,9 k286496673980 760      59059 331
mar 20131,8 k277484872943 728      44143 221
fev 20131,8 k260454572931 713      39042 111
jan 20131,7 k249434465917 687      92641 111
dez 20121,6 k244414065885 662      58238 11 
nov 20121,5 k232392465855 643      50622 11 
out 20121,4 k21837464809 638      6502 11 
set 20121,2 k21335461784 620      4122 11 
ago 20121,2 k20334456719 548      4572 11 
jul 20121,1 k19229349670 530      6502 1  
jun 20121,1 k18028346616 493      11012 1  
mai 201297315719244543 422      15982    
abr 201285713912130291 255      25381    
mar 2012658673 1134 91      1931     
fev 2012625    97 69      231     
jan 2012617    95 69      222     
dez 2011613    95 68      266     
nov 2011584    88 62      432     
out 2011546    86 50      144     
set 2011539    83 46      757     
ago 2011415    77 29      1091     
jul 2011233    66 15      351     
jun 2011191    47 12      1135     
mai 2011121    11 7      360     
abr 201186    10 6      120     
mar 201168    10 3      114     
fev 201148    10 3      3     
jan 201147    10 3            
dez 201047    10 3      76     
nov 201042    10 3            
out 201042    10 3      25     
set 201039    6 3      27     
ago 201020    6 3      58     
jul 20107    6 3            
jun 20107    6 3            
mai 20107    6 3            
abr 20107    6 3            
mar 20107    5 3            
fev 20107    5 3            
jan 20107    5 3            
dez 20097    5 3            
nov 20097    5 3            
out 20097    5 3            
set 20097    5 3            
ago 20097    5 3            
jul 20097    5 3      1     
jun 20097    5 3            
mai 20097    5 3            
abr 20097    5 3            
mar 20097    5 3            
fev 20097    5 3            
jan 20097    5 3            
dez 20087    5 3      11     
nov 20087    2              
out 20087    2              
set 20087    2              
ago 20087    2              
jul 20087    2              
jun 20087    2              
mai 20087    2              
abr 20087    2              
mar 20087    2              
fev 20085    1              
jan 20085    1              
dez 20075    1              
nov 20071    1              
out 20071    1              

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

out 2007: 1 2 Кьилин ччин

nov 2007: 1 2 Кьилин ччин

dez 2007: 1 2 Кьилин ччин

jan 2008: 1 1 Кьилин ччин

mar 2008: 1 2 Википедия , 2 1 Кьилин ччин

abr 2008: 1 1 Кьилин ччин

nov 2008: 1 1 Кьилин ччин

dez 2008: 1 1 Кьилин ччин

jul 2009: 1 1 Кьилин ччин

ago 2010: 1 3 Урусат , 2 3 Кьвевар , 3 3 Дагъустан , 4 2 Кьилин ччин , 5 2 Футбол

set 2010: 1 2 Кьилин ччин , 2 2 Лезги кхьинар , 3 2 Андорра

out 2010: 1 2 Шри-Ланка , 2 2 Африка

dez 2010: 1 3 Баку , 2 2 Шри-Ланка , 3 2 ЦӀийи Зеландия , 4 2 Футбол , 5 2 Талибан , 6 2 СтIал Сулейман , 7 2 Урусат , 8 2 Пакистан , 9 2 Лезгистан , 10 2 Лезги , 11 2 Къазакъстан

fev 2011: 1 1 Кьилин ччин

mar 2011: 1 3 Эрменистан , 2 3 Азербайжан , 3 2 Чувудар , 4 2 Париж , 5 2 Нил , 6 2 Гьайванар , 7 2 Лезгияр , 8 2 Гибралтар , 9 1 НуькI

abr 2011: 1 4 Кьилин ччин , 2 4 КцӀар , 3 3 Къазакъстан , 4 3 Ирландия , 5 2 Шри-Ланка , 6 2 Лезгистан , 7 2 Лезги чIал , 8 2 Лам

mai 2011: 1 5 ЧIехибритания , 2 5 Азия , 3 4 Лезгистан , 4 3 Советрин Социализмдин Республикайрин ГалкӀ , 5 2 Эрменистан , 6 2 Шри-Ланка , 7 2 Чувуд чӀал , 8 2 Китай чIал , 9 2 Туьрк чIал , 10 2 ТӀаратӀ , 11 2 Кьиблепатан Америка , 12 2 Къавкъаз , 13 1 Кьилин ччин

jun 2011: 1 4 Океания , 2 3 Эрменистан , 3 3 Крокодилар , 4 2 Кьилин ччин , 5 2 Юпитер , 6 2 Китайдин Халкьдин Республика , 7 2 Уганда , 8 2 Цифраяр , 9 2 Немец чIал , 10 2 Макао , 11 2 Лезгияр , 12 2 Лезгистан , 13 2 Къарагъанда , 14 2 Канада , 15 2 Кьиблепатан Америка , 16 1 НуькI

jul 2011: 1 4 Германия , 2 3 Европадин гьукуматар , 3 3 Греция , 4 2 Хьилер , 5 2 Саха чӀал , 6 2 Саха Республика , 7 2 Мегьарамдхуьр , 8 2 Лезгистан , 9 2 Къазакъстан , 10 1 Кьилин ччин

ago 2011: 1 3 НуькI , 2 3 Кьилин ччин , 3 3 Чурчул , 4 3 Хуьшрекандиз ухшар маймун , 5 3 Супик чӀал , 6 3 Саваннадин фил , 7 3 Наукандин юпик чӀал , 8 3 Мирикина , 9 3 Латин чIал , 10 3 Кьвевар , 11 3 Ибериядин сувайрин чурчул , 12 3 ГъвечӀи панда , 13 3 Гну , 14 3 Садхьанвай Араб Эмиратар , 15 3 Атна чӀал , 16 3 Аляскадин юпик чӀал , 17 3 Алеут чӀал , 18 2 Яру бубал , 19 2 Юпик чӀалар , 20 2 Эяк чӀал , 21 2 Эскимос-алеут чӀалар , 22 2 Экуь вили антилопа , 23 2 Чувуд чӀал , 24 2 Чевакдин чупик чӀал , 25 2 Чапла Канададин инуит чӀал

set 2011: 1 4 Туьркиядин лезги хуьрер , 2 3 Кьилин ччин , 3 3 Шергир , 4 3 Чинеруг , 5 3 Химия , 6 3 Туьтуьнуькl , 7 3 Хундуз , 8 3 Ортажа , 9 3 Лезги кхьинар , 10 3 Къванцин цуцӀул , 11 3 Йайлакёй , 12 3 ЦуцӀул-балугъчи , 13 3 Дагъустан , 14 3 Гьатем ага ЧӀакарви , 15 3 Гиенадал ухшар кицӀ , 16 3 География , 17 3 Ахцегь , 18 2 НуькI , 19 2 Яру жанавур , 20 2 Юсуф ал-Лезги , 21 2 МичIи куьрен кард , 22 2 Шахин , 23 2 Шангъар , 24 2 Чалагъан , 25 2 ЧIехибритания

out 2011: 1 3 Кьилин ччин , 2 3 Топонимика , 3 3 Сатурн , 4 2 Чил (планета) , 5 2 Хьилер , 6 2 Хашпара дин , 7 2 Футбол , 8 2 Теннис , 9 2 Урусат , 10 2 Мегьарамдхуьруьн район

nov 2011: 1 4 Рутул район , 2 4 Лезгистан , 3 3 Кьилин ччин , 4 3 Яру жанавур , 5 3 Финн чӀал , 6 3 Гъуьгъвезар , 7 3 Ахцегь , 8 3 Антилопа , 9 2 Цуругъ , 10 2 ЦIийи Кьуруш , 11 2 Хьилер , 12 2 Хуьшрекандиз ухшар маймун , 13 2 Хуьшрекан хьтин маймун , 14 2 УсухвацI , 15 2 Урус чIал , 16 2 Урбис , 17 2 Туьрк чIал , 18 2 Топонимика , 19 2 Смугъул , 20 2 Ситатунга , 21 2 СикӀер , 22 2 Планета , 23 2 Пирал , 24 2 Осло , 25 2 Орхидея

dez 2011: 1 3 Франция , 2 3 Къуйсун , 3 3 Имарат Къавкъаз , 4 2 Кьилин ччин , 5 2 Туьркменистан , 6 2 Суварин цӀиргъ , 7 2 Кеферпатан МуркIарин океан , 8 2 Монако , 9 2 Марсельеза , 10 2 Люксембург , 11 2 Индиядин океан , 12 1 НуькI

jan 2012: 1 4 Тай чӀал , 2 3 Мукьтадир , 3 2 Кьилин ччин , 4 2 Усугъчай , 5 2 Советрин Социализмдин Республикайрин ГалкӀ

fev 2012: 1 4 Кьилин ччин , 2 3 Гьажи Мегьамед Эфенди Штулви , 3 2 Мукьтадир , 4 2 Луткун , 5 2 Википедия

mar 2012: 1 13 Кьилин ччин , 2 10 Лезгияр , 3 8 Азербайжан , 4 7 Лезгистан , 5 7 Къуба , 6 7 Ингъушар , 7 7 Баку , 8 6 Урусат , 9 6 Къазакъстан , 10 6 Ахцегь район , 11 5 Эрменистан , 12 5 Европадин гьукуматар , 13 5 Советрин Социализмдин Республикайрин ГалкӀ , 14 5 ТӀаратӀ , 15 5 Лезгийрин тарих , 16 5 Кьиблепатан Америка , 17 5 Инглис чIал , 18 5 Заира Аминова , 19 5 Дагъустан , 20 5 Ахцегь , 21 5 Антарктида , 22 5 Али Султан , 23 4 Табасаранар , 24 4 Урусар , 25 4 ЦIийи Дуьнья

abr 2012: 1 6 Кьилин ччин , 2 6 Лезгияр , 3 5 Христофор Колумб , 4 5 Дуьньядин кьведлагьай дяве , 5 5 Польша , 6 5 Агъул район , 7 5 Рейн , 8 5 Литва , 9 5 Сауди Арабистан , 10 5 Пакистан , 11 5 Лезги чIал , 12 5 Азербайжан , 13 4 Философия , 14 4 Боливия , 15 4 Пакистандин пайдах , 16 4 Мегьамед Мегьамедан хва Гьажиев , 17 4 Италия , 18 4 Лезги Википедия , 19 4 Сара Бернар , 20 4 ЦӀийи гафарин сиягь , 21 4 Грекрин алфавит , 22 4 Тегьран , 23 4 Урусар , 24 4 Кореядин Халкьдинни-Демократиядин Республика , 25 4 Афинар

mai 2012: 1 5 Португалия , 2 5 Мисри , 3 5 Ахцегь , 4 4 Каир , 5 4 Puzzling World , 6 4 Владимир Владимирович Путин , 7 4 Falco vespertinus , 8 4 I Наполеон Бонапарт , 9 4 Трпиня , 10 4 Кьилин ччин , 11 4 Италия , 12 4 Дунай , 13 4 Гъед (гьайванар) , 14 3 Абдул Мажид , 15 3 Португал чIал , 16 3 Колибри , 17 3 Дуэро , 18 3 Португалиядин шегьерар , 19 3 Альберт Эйнштейн , 20 3 Кьибле-Африкадин Республика , 21 3 Улуб , 22 3 Мастурбация , 23 3 Яру улуб , 24 3 Астероид , 25 3 Динозавраяр

jun 2012: 1 7 Мугьаммад , 2 6 Византий империя , 3 5 Исаак Ньютон , 4 5 Аллагьдин 99 тӀвар , 5 5 Алюминий , 6 5 Урусат , 7 4 Аврил Лавин , 8 4 Гелхен , 9 4 Химиядин элементрин девирдин система , 10 4 Шахматар , 11 4 Осман империя , 12 4 Византиядин императоррин сиягь , 13 4 Республика Корея , 14 4 The Macallan , 15 4 Суван Къарабагъ , 16 4 Китайдин Халкьдин Республика , 17 4 Финн чӀал , 18 4 Ахцегь , 19 4 Айдагьо , 20 3 Брест , 21 3 Вольфганг Амадеус Моцарт , 22 3 Математика , 23 3 Бубуяр , 24 3 Сятдин чӀул , 25 3 Гьукуматдин идара авунин тегьер

jul 2012: 1 4 Санкт-Петербург , 2 4 ЧӀехи Француз инкъилаб , 3 4 Рим империя , 4 4 Куба , 5 3 Дуьньядин чими хьун , 6 3 Эсперанто , 7 3 Волга , 8 3 Эрнесто Че Гевара , 9 3 Яд , 10 3 Автомобилдин код , 11 3 Математика , 12 3 Чил (планета) , 13 3 Сев , 14 2 Лелевар , 15 2 Постессив аватвал , 16 2 Археяр , 17 2 Биология , 18 2 Дезоксирибонуклеин цуруцӀ , 19 2 Велс , 20 2 Садхьанвай миллетрин тешкилат , 21 2 Че Гевара , 22 2 Расим Загьирбег хва Тагирбеков , 23 2 Рахазвайбурун кьадардиз килигна чӀаларин сиягь , 24 2 Автомобил код , 25 2 Почтунин индекс

ago 2012: 1 7 Лезгистан , 2 5 Олимпиядин къугъунар , 3 4 Рим , 4 3 КӀамс , 5 3 Сочи , 6 3 Биология , 7 3 Грекрин алфавит , 8 2 Экваториал Гвинея , 9 2 Чарльз Дарвин , 10 2 Искандер Македонжув , 11 2 The Beatles , 12 2 Иосиф Виссарионович Сталин , 13 2 Сингапур , 14 2 Гуржи чIал , 15 2 Хунзах район , 16 2 2012 Гатун Олимпия къугъунар , 17 2 Велс , 18 2 Эсперанто , 19 2 Куба , 20 2 Португалия , 21 2 Тегьран , 22 2 Урус чIал , 23 2 Тувалу , 24 2 Лас океан , 25 1 Никlи

set 2012: 1 3 Юлий Цезарь , 2 3 Иерусалим , 3 3 Таиланд , 4 3 Жозе Мария Эса ди Кейруш , 5 3 Ботлих , 6 3 Акуша , 7 3 Алпан , 8 3 Хошимин , 9 3 Кьулан вацI , 10 3 Париж , 11 2 Физика , 12 2 Дегь Мисри , 13 2 ПIатIар , 14 2 Сарфунъял , 15 2 Экология , 16 2 Вунгтау , 17 2 Нячанг , 18 2 Америка , 19 2 Кертагъ Давдакь , 20 2 С , 21 2 Слово (газет, Португалия) , 22 2 Эйсебио , 23 1 Донгхой

out 2012: 1 4 Мадрид , 2 4 Вена , 3 3 Хуьруьн майишат , 4 3 Кефердинни рагъакIидай Англия , 5 3 Ливерпульдин агломерация , 6 3 Неаполь , 7 3 Турин , 8 3 ЦIуру Худат , 9 3 Хурай (КцIар) , 10 3 Немец чIал , 11 2 Мирземугьаммадхъишлах , 12 2 Эрдэнэт , 13 2 Монгол чӀал , 14 2 Улан-Батор , 15 2 Чархы , 16 2 Жанахир , 17 2 ЧIал , 18 2 Карл Маркс , 19 2 Салвадор Дали , 20 2 Акбар ЧӀехи , 21 2 Гаф , 22 2 Slayer , 23 2 Пекин , 24 2 Къусарчай (Хъачмаз) , 25 2 Гуьнешли

nov 2012: 1 4 Компьютер , 2 4 Садвал , 3 3 Чепер , 4 3 Уран (планета) , 5 3 Каракорум (шегьер) , 6 3 Куритиба , 7 3 Гилияр , 8 3 Водород , 9 3 Грар , 10 3 Магьачкъала , 11 3 Дербент район , 12 2 Людвиг ван Бетховен , 13 2 Ӄ , 14 2 Дагъустандин ЦIаяр , 15 2 Дагъустандин шегьерар , 16 2 Ухул , 17 2 1930 йис , 18 2 Мичегь , 19 2 Калук , 20 2 Приморск (Дагъустан) , 21 2 Венесуэла , 22 2 КьепIир Къазмаяр , 23 2 Хуьлуьхъ , 24 2 ПIатIар , 25 2 Рим

dez 2012: 1 3 Кьулан СтIал , 2 3 Къайи дяве , 3 3 Вепс чӀал , 4 3 Пудлагьай рейх , 5 3 Велс , 6 3 Астероид , 7 3 Ле Корбюзье , 8 2 Камарван , 9 2 Пиперхуьр , 10 2 КIахцугъ , 11 2 Герейханован совхоздин 2-лагьай отделение , 12 2 Зари , 13 2 Алкьвадар , 14 2 Усур , 15 2 Хашпересрин финар , 16 2 Вьетнамдин дяве , 17 2 1930 йис , 18 2 Сарфунъял , 19 2 Усугъчай , 20 2 Туьркер-Месхетинар , 21 2 ТӀиб , 22 2 Марс , 23 2 Кьасумхуьр , 24 1 Пак тир Рим империя

jan 2013: 1 3 Индуизм , 2 3 Лезгияр , 3 2 Вашингтон (кьилин шегьер) , 4 2 Ахвах район , 5 2 Акуша район , 6 2 1812 йис , 7 2 1866 йис , 8 2 1878 йис , 9 2 1969 йис , 10 2 Вини СтIал , 11 2 , 12 2 Пак тир Рим империя , 13 2 Компьютер , 14 2 Велиханрин Къудрат Кибечханан хва , 15 2 Волга , 16 2 Мугьаммад , 17 2 ЧӀулав тӀеквен , 18 2 Сампи , 19 2 Промышленность , 20 2 2012 йис , 21 2 Рейн , 22 2 Пси (гьарф) , 23 2 Фи , 24 2 Ипсилон , 25 2 Тау

fev 2013: 1 2 Фридрих Ницше , 2 2 Бум , 3 2 Къарасу , 4 2 Къарадейн , 5 2 Кичик ПIирали , 6 2 Курд (Кьвепеле) , 7 2 Кветуьклуь , 8 2 Имамлы , 9 2 Зергерли , 10 2 Зараган , 11 2 Залам , 12 2 Жигъателли , 13 2 Жорлу , 14 2 Енгиже

mar 2013: 1 3 1949 йис , 2 3 1969 йис , 3 3 Турция , 4 3 Айдагьо , 5 3 Абхазия , 6 2 Дегь Греция , 7 2 Валенсия (мана) , 8 2 Илим , 9 2 АСШ-дин граждан дяве , 10 2 Гарринча , 11 2 ЧӀулав хъалхъам , 12 2 Элвис Пресли , 13 2 Байуба , 14 2 Дунчэн (Пекин) , 15 2 Садхьанвай миллетрин тешкилат , 16 2 Каир , 17 2 ЧӀулав тӀеквен , 18 2 Лекь (анатомия) , 19 2 Яру жанавур , 20 2 Февраль , 21 2 Китайдин Халкьдин Республика , 22 2 Июль , 23 2 Лас океан , 24 2 Август , 25 2 Некхъвадайбур

abr 2013: 1 5 Амстердам , 2 3 Гонконг , 3 3 Октавиан Август , 4 3 Плазма , 5 3 Ракь , 6 3 Рио-де-Жанейро , 7 3 Метр , 8 3 Буэнос-Айрес , 9 3 Иерусалим , 10 3 Дагъустан , 11 2 Умар Хайям , 12 2 Сувар (ансамбль) , 13 2 Керимрин Седакъет Къайинбеган руш , 14 2 Метаболизм , 15 2 Кизилюрт , 16 2 Михаил Лезгинцев , 17 2 Атом , 18 2 Гьуьсейнов Абдусалам Абдулкериман хва , 19 2 Барселона (мана) , 20 2 Агъдам район , 21 2 Нежефхуьр , 22 2 Ахцегьрин гьамамар , 23 2 Грар , 24 2 Юсуф ал-Лезги , 25 2 Эфиопидин чъакъал

mai 2013: 1 3 Франция , 2 2 Москва вилаят , 3 2 Альгеро , 4 2 Алпан (манаяр) , 5 2 Алпан (астрономия) , 6 2 Алпан

jun 2013: 1 3 Марко Поло , 2 3 Демократия , 3 3 Фу , 4 2 Мидгьед Ширинбегов , 5 2 Иисусан гьакъикъи клиса , 6 2 Александр Ильич Рыбников , 7 2 Кьавал , 8 2 Агъул чIал , 9 2 Хвереж (Кьурагь район) , 10 2 Усугъ , 11 2 Вулкан (геология) , 12 2 Абилов Магьмуд Абдулрзадин хва , 13 2 Митаги хуьруьнсовет , 14 2 Хазар хуьруьнсовет , 15 1 Кьилерин хуьруьнсовет

jul 2013: 1 2 Хъачмаз район , 2 1 Зигмунд Фрейд

ago 2013: 1 3 Католицизм , 2 3 Чингисхан , 3 3 Винстон Черчилль , 4 2 Урусатдин тӀаратӀ , 5 2 Табасаран чIал , 6 2 Дагъустандин тIаратI , 7 2 Гоа (Дагъустан) , 8 2 Мыгра (Дагъустан) , 9 2 Кина (Дагъустан) , 10 2 Британиядин империя , 11 2 Вини Катрух , 12 2 Автомобиль , 13 2 Марко Поло , 14 2 Агъул чIал , 15 2 ЧIал , 16 2 ЦIийихуьр , 17 2 Христофор Колумб , 18 2 ТӀаратӀ , 19 2 Лезги чIал , 20 2 Кьвевар , 21 1 Будугъ чIал

set 2013: 1 3 Авраам Линкольн , 2 3 КъирицI чIал , 3 2 Чилин зурзунар , 4 2 Хинелугъ чIал , 5 2 Нидерландар , 6 2 Китайдин Халкьдин Республика , 7 2 Саха Республика , 8 1 ЦIуру Киркар

out 2013: 1 3 Лезгияр , 2 2 Холокост , 3 2 Хамаматюрт , 4 2 Адиль-Янгиюрт , 5 2 Бабаюрт , 6 2 Чилин зурзунар , 7 2 Табасаранар , 8 1 ЧӀутрацуьк

nov 2013: 1 3 Аристотель , 2 3 Бактерияр , 3 2 Ингушетия , 4 2 UTC+4 , 5 2 Терек , 6 2 Хуьр , 7 2 Шегьер , 8 2 АхцегьвацӀ , 9 2 Мустафа Камал Ататуьрк , 10 1 Муниципал район

dez 2013: 1 3 КуртӀухъан , 2 3 Атлантик океан , 3 3 Харахуба , 4 2 Пепеяр , 5 2 Малярия , 6 1 Тарих

jan 2014: 1 3 Мирослава Вавринец , 2 3 Роджер Федерер , 3 3 Валентина Васильевна Толкунова , 4 3 Кьвепеле , 5 2 Затор , 6 2 Бойнице , 7 2 Куколивка

fev 2014: 1 3 Шахматар , 2 2 Сан-Паулу , 3 2 Гуржистан , 4 2 Абхазия , 5 1 Славян чIалар

mar 2014: 1 3 Поляк чIал , 2 3 Словак чIал , 3 3 Чех чIал , 4 2 Кашуб чIал , 5 1 НАТО

abr 2014: 1 3 Алискерово (посёлок) , 2 2 Тито Виланова , 3 2 Баламирзоев Абдул Гьажибаладин хва , 4 2 Поречье хуьруьнсовет (Тула вилаят) , 5 2 Дубна (Тула вилаят) , 6 2 Фотосинтез , 7 1 Синусоида

mai 2014: 1 3 Грек чӀал , 2 3 Сидней , 3 3 Вичи-вич кьин , 4 3 Сеул , 5 3 Салигьов Эсед Бабастанан хва , 6 3 Верем , 7 2 Metallica , 8 2 Пурни , 9 2 Мумбаи , 10 2 ТӀач , 11 2 Бебелук , 12 2 2014 ХъуьтӀуьн Олимпия къугъунар , 13 2 ЧӀулавкьал , 14 2 ЦӀегьрекарч , 15 2 Словак чIал , 16 1 Лезги литература

jun 2014: 1 2 Фернан Магеллан , 2 2 Цур , 3 2 Геология , 4 2 Етим Эмин , 5 2 Храхуба , 6 2 Гуржи чIал , 7 2 Далдам , 8 1 Инд океан

jul 2014: 1 2 Джяравица , 2 2 Европадин таж , 3 2 Квеста , 4 2 Париж бассейн , 5 1 Ботсвана

ago 2014: 1 3 Робин Уильямс , 2 2 Джульярд мектеб , 3 2 ЦIуьлуьк , 4 2 Хъутур-Куьредин наибвал , 5 1 Аль-Муайдар

set 2014: 1 3 Ио , 2 2 Вилиам Хьайд Волластон , 3 2 Владимир Владимирович Путин , 4 2 Юрий Алексеевич Гагарин , 5 1 Черногориядин шегьерар

out 2014: 1 2 Чай , 2 2 Балтик гьуьлуьн пешекарвилин галкIрин чил , 3 2 Латвия , 4 2 Эстония , 5 2 Братислава , 6 2 Прагьа , 7 1 Кения

nov 2014: 1 2 Анархизм , 2 2 Аргентина , 3 2 Нью-Йорк , 4 1 Амадора

dez 2014: 1 2 Дакка , 2 2 Гьукумат Палестина , 3 1 Къеди

jan 2015: 1 2 Сокольническая цӀар , 2 2 ТупӀалдин цӀар (Москва) , 3 1 Эседуллагь Эмирагъайрин

fev 2015: 1 2 Яргъал тир рагъэкъечӀдайпатан федерал округ , 2 2 Абдусамад Гьамидов , 3 2 Гьарйяна , 4 2 Никола Тесла , 5 2 Халилов Юсиф Мевлуьдан хва , 6 2 Экономика , 7 2 Чингисхан , 8 2 Умар ибн Гьаттаб , 9 1 Кьилин мефтӀ

mar 2015: 1 3 Пудлагьай рейх , 2 2 Украинадин вилаятар: абурун ибарат , 3 2 Украинадин административ паюн , 4 2 I Фарнаваз , 5 2 Асалийрин Асали Мугьаммадалидин хва , 6 2 СакӀватал район , 7 2 Братислава , 8 2 ЧӀулав гьуьл , 9 2 Украина , 10 2 Уругвай , 11 2 Пакистан , 12 2 Немец чIал , 13 1 Фарнаваз I

No data on this page have been normalized to 30 day months (as WMF does on certain traffic reports).
Wikipedias are initially ordered by number of speakers of the language

Speakers: Number of speakers of a language is the estimated total of primary and secondary speakers, is in many cases a very rough estimation (based on the page on the English Wikipedia about that language)
Regions are parts of the world where the language is spoken in substantial amounts (compared to total number of speakers). Regions where a language gained presence only by a recent diaspora are generally not included.
Region codes: AF:Africa, AS:Asia, EU:Europe, NA:North America, OC:Oceania, SA:South America, W:World Wide, CL:Constructed Language

Estatísticas geradas em Quinta-feira, 7 de maio 2015 16:56

Dump file lezwiki-20150416-stub-meta-history.xml.gz (edits only), size 3.7 Mb as gz -> 25 Mb
Dump processed till Mar 31, 2015, on server stat1002, ready at Thu-16/04/2015-12:51 after 23 sec.

Versão do script:2.6
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.