Estatísticas da Wikipédia lezgian

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Articles per size range / Records per namespace / Most edited articles / Zeitgeist

Most metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.

New Some metrics have been collected from the full archive dump which runs on lower frequency than the usual monthly cycle.
These metrics are columns F,I,J,K,M,N,O,P,Q,R from the first table.


See also metrics definitions


 
Monthly counts & Quarterly rankings: fevereiro 2014
 
DataWikipedistasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
fev 20140%   0%+1%     -76%0%0%0%0%0%+1%+1%
jan 2014+4%   +1%0%     +144%0%0%0%0%0%-0%+1%
dez 20130%   0%+1%     -16%+1%+1%+1%0%0%0%0%
nov 20130%   +1%+1%     -67%+1%+1%+1%-1%+2%+1%+1%
out 2013+2%   +5%+6%     -7%+8%+8%+9%-32%+1%+10%+1%
set 20130%   +3%+3%     -37%+7%+7%+5%0%-1%+6%+1%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P____Q____R____S__
fev 201454 2 1,9 k1,7 k 17233179%38%858,5 Mb587 k36 k2402,3 k5,4 k513
jan 2014542611,9 k1,7 k 17233379%38%3548,5 Mb584 k36 k2402,2 k5,4 k510
dez 201352 3 1,9 k1,7 k 16,9233079%38%1458,5 Mb581 k35 k2402,2 k5,4 k507
nov 201352 4 1,9 k1,7 k116,9232879%38%1728,4 Mb578 k35 k2402,2 k5,4 k506
out 2013521311,9 k1,7 k317233278%38%5298,4 Mb574 k35 k2432,2 k5,3 k500
set 201351 311,8 k1,6 k217,5226577%36%5717,7 Mb533 k32 k3552,2 k4,9 k496
ago 201351 211,8 k1,6 k517,7218577%33%9057,3 Mb500 k31 k3552,2 k4,6 k490
jul 201351 2 1,6 k1,4 k118,8207074%29%1586,3 Mb433 k27 k5312,1 k3,9 k455
jun 201351 311,6 k1,4 k218,9205774%29%6376,1 Mb426 k26 k5342,1 k3,9 k452
mai 201351 211,5 k1,3 k219,4199273%26%4135,7 Mb395 k24 k4862,1 k3,5 k440
abr 201351 521,5 k1,2 k120194272%24%6725,3 Mb370 k23 k4892,1 k3,2 k438
mar 2013511511,4 k1,2 k 20,1187171%23%2,2 k4,9 Mb346 k22 k1,1 k2,1 k3,0 k423
fev 201350 321,4 k1,2 k318,7183472%23%1,3 k6,5 Mb337 k21 k67 k2,1 k2,9 k415
jan 201350 421,3 k1,1 k218,9182570%23%1,7 k6,2 Mb318 k21 k66 k2,1 k2,8 k409
dez 201250 511,3 k1,1 k218,5180971%22%1,2 k5,9 Mb301 k20 k64 k2,1 k2,6 k398
nov 2012501711,2 k1,0 k418,5174869%18%1,1 k5,5 Mb276 k18 k63 k2,1 k2,4 k386
out 2012492521,1 k946619,3175767%18%1,2 k5,1 Mb254 k17 k61 k1,9 k2,2 k378
set 201247 51884746122,3185160%21%1,3 k4,5 Mb220 k15 k58 k1,5 k1,9 k362
ago 201247162852711121,6178859%20%9804,3 Mb204 k15 k56 k1,5 k1,7 k356
jul 2012461123830689121167358%18%1,3 k3,9 Mb186 k13 k54 k1,2 k1,6 k334
jun 2012451133791637220,4145453%17%1,7 k3,4 Mb154 k11 k50 k1,1 k1,4 k308
mai 201244193731564219,7123749%15%2,2 k2,9 Mb121 k8,2 k47 k1,0 k1,1 k264
abr 201243317567850031898443%11%3,1 k2,4 Mb89 k6,2 k42 k790727191
mar 2012408206575393115,781138%8%2,4 k1,8 Mb61 k3,4 k34 k70834893
fev 201232141547388 12,180039%8%7171,6 Mb59 k3,2 k28 k68830788
jan 201231121543386 10,878039%8%2331,4 Mb57 k3,3 k23 k68730684
dez 201130 41539383110,577239%8%3031,4 Mb56 k3,2 k23 k68430484
nov 201130371516370110,478941%8%4391,3 Mb55 k3,1 k21 k66430377
out 201127 4 496348 9,978440%8%3521,3 Mb52 k2,8 k21 k65029759
set 201127410249134549,378740%8%7921,1 Mb52 k2,8 k14 k64931357
ago 201123610238126959,987643%10%1,1 k954 kb45 k2,4 k12 k53331140
jul 201117181223166111,973244%8%361537 kb23 k8298,7 k35918713
jun 201116 51182131212,680451%10%1,2 k487 kb21 k6528,0 k28016412
mai 2011163811145719,860326%11%441322 kb9,9 k2967,3 k106299
abr 20111325 804018,551125%11%157210 kb5,8 k1484,9 k8817
mar 20111123 623418,460229%15%141201 kb5,3 k1284,9 k7517
fev 20119   4231 983640%21%3169 kb4,9 k1223,7 k56 7
jan 20119   4131 9,283641%22%3167 kb4,9 k1223,7 k56 7
dez 2010912 4131 9,183641%22%79167 kb4,9 k1223,7 k56 7
nov 20108   4123 7,2131137%22% 130 kb7,8 k1219195922
out 2010812 4123 7,2131137%22%36130 kb7,8 k1219195922
set 2010711 382216,8145739%18%113128 kb7,6 k1219186322
ago 2010633 2018 7,2103160%25%5966 kb2,9 k12089457 1
jul 20103   75 12,385743%29%415 kb956151334 1
jun 20103   75 11,785743%29% 15 kb956151334 1
mai 20103   75 11,785743%29%515 kb956151334 1
abr 20103   75 1185743%29% 15 kb956151334 1
mar 20103   75 1185743%29% 15 kb956151334 1
fev 20103   75 1185743%29% 15 kb956151334 1
jan 20103   75 1185743%29%315 kb956151334 1
dez 20093   75 10,685743%29% 15 kb956151294 1
nov 20093   75 10,685743%29% 15 kb956151294 1
out 20093   75 10,685743%29% 15 kb956151294 1
set 20093   75 10,685743%29% 15 kb956151294 1
ago 20093   75 10,685743%29% 15 kb956151294 1
jul 20093   75 10,685743%29%115 kb956151294 1
jun 20093   75 10,485743%29% 14 kb95615184 1
mai 20093   75 10,485743%29% 14 kb95615184 1
abr 20093   75 10,485743%29% 14 kb95615184 1
mar 20093   75 10,485743%29% 14 kb95615184 1
fev 20093   75 10,485743%29% 14 kb95615184 1
jan 20093   75 10,485743%29% 14 kb95615184 1
dez 2008311 75 10,485743%29%1214 kb95615184 1
nov 20082   75 8,782643%29%112 kb9261183 1
out 20082   75 8,682543%29% 12 kb9231183 1
set 20082   75 8,682543%29% 12 kb9231183 1
ago 20082   75 8,682543%29% 12 kb9231183 1
jul 20082   75 8,682543%29% 12 kb9231183 1
jun 20082   75 8,682543%29% 12 kb9231183 1
mai 20082   75 8,682543%29%812 kb9231183 1
abr 20082   75 7,482543%29%712 kb9231183 1
mar 20082   75 6,481343%29%812 kb9071183 1
fev 20082   54 7,4161580%60% 19 kb1,3 k6921111
jan 20082 1 54 7,4161580%60%819 kb1,3 k6921111
dez 2007211 52 5,8145440%40%2118 kb7626629 1
nov 20071   11 82920100%100%65,9 kb3476328  
out 200711  1  242  2104 6     
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
The following table ranks this project in relation to projects in other languages with 1000+ articles
jan 2014158112121144194172164160436021141139153148194131126236
out 2013160144158130193172104161416221109140151148201130126236
jul 2013157139173134201176155151537344157147162161179129132236
abr 2013157147128107202175159144617656141154166166188129136236
jan 2013156144138103202175121150637762154174170165188132135236
out 201215610712310320517985145698681171181174169190132143236
jul 20121581368892209189153206198198197165189180172192146152236
abr 2012155877975211195109204196196194109199198195201158176236
jan 2012177145172138213199153203195195193220211207207211165194236
out 2011184149141140213200159202194194192217209206212210164193236
jul 201121414399137223210160199191191189216216214217217182201236
abr 2011221100128131230220155195187187185222221223222221209227236
jan 2011224149211134235221154195187187185235223223222223219227236
out 2010226143170126235222150190182182180232223219223227213227236
jul 2010234158215139235227156184176176174235227227227227227227236
abr 2010233148204135235229159181175175174235229229229229227229236
jan 2010231149201130234230155180176176175231231230230230227230236
out 2009231140204135234233157176175175174233234233233233228233236
jul 2009230187197132233231150172171171170232230230232232229230236
abr 2009230138197142232231145170169169168232231230232232230229236
jan 2009230129200131232230150164163163162234230230231231230230236
out 2008231135191128231227142158157157155232229229230231230230236
jul 2008229146197133228224147152151151148230226226227229226229235
abr 2008228147202129227224148147146145143229225225227229225227235
jan 2008225144194134224220154142141140139223221219215225213221231
out 2007226136190129228225146140139137137222228226226222218219230
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
 WikipedistasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikipedistas (usuários registrados)
A = Wikipedistas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikipedistas que editaram pelo menos dez vezes desde que chegaram
C = Wikipedistas que contribuíram cinco vezes ou mais este mês
D = Wikipedistas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Artigos que contêm pelo menos uma ligação interna e 200 caracteres de texto legível, não contando códigos wiki e html,
      ligações ocultas, etc.; títulos também não contam (outras colunas são baseadas no método oficial de contagem)
G = Novos artigos por dia no mês passado
H = Número médio de revisões por artigo
I = Tamanho médio dos artigos em bytes
J = Porcentagem de artigos com pelo menos 0,5 kb de texto legível (veja F)
K = Porcentagem de artigos com pelo menos 2 kb de texto legível (veja F)

Base de dados
L = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
M = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
N = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
O = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
P = Total de ligações para outras wikipédias
Q = Total de imagens apresentadas
R = Total de ligações para outros sítios
S = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  5  10  100  1000  1  3  5  10  25  100  1  3  5  10  25  100  250  5  10  100 
fev 201415222       321    9321   22 
jan 20141286431  11  321    8322   32 
dez 2013114332  11  622    82111  11 
nov 2013115433  11  5211   142221  11 
out 20139432111 21  62     733211111 
set 20139332211     53     933331 22 
ago 20134322211 2   53211  8222221431
jul 201342222      31     932211 33 
jun 20137332211 1   8521   833222 32 
mai 20136222111 11  531    112222  21 
abr 201314555321 33  4443   1133322 541
mar 201314652211 7711102211  2064221 541
fev 2013933222  1063 6221   844221 971
jan 201315543221 1363 6322   1233321 961
dez 201211554211 1282 9443   1364221 86 
nov 201213777211 10102 108541  2398431 86 
out 201211655321 862 74321  1254321 851
set 201212554211 983 95321  14732211761
ago 201219146522  862 103222  2175222 631
jul 2012181212853  872 1711842  2414141031 771
jun 201224151311631 1171 11119641 21996511641
mai 2012211298633 971 1698442 251195421641
abr 201232211710754 971 341914853 592413874143 
mar 2012292020141062 661 34171495  6227221694 22 
fev 20121144411  111 1      2      11 
jan 2012742221      1      1         
jan 20141286431  11  321    8322   32 
out 20139432111 21  62     733211111 
jul 201342222      31     932211 33 
abr 201314555321 33  4443   1133322 541
jan 201315543221 1363 6322   1233321 961
out 201211655321 862 74321  1254321 851
jul 2012181212853  872 1711842  2414141031 771
abr 201232211710754 971 341914853 592413874143 
jan 2012742221      1      1         
out 201185441  111        11111  11 
jul 201110884111     322    421111    
abr 201165551      1      1         
jan 2011                           
out 20103221              2111      
jul 2010                           
abr 2010                 2         
jan 2010                           
out 2009                           
jul 20091                          
abr 2009                           
jan 2009                 1         
out 2008                           
jul 2008                 2         
abr 200822                         
jan 2008111                         
out 20072                          

 

Distribuição de edições de artigos por wikipedistas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikipedistasEdições total
1200100.0%21,906100.0%
38040.0%21,74999.3%
105427.0%21,60198.6%
323115.5%21,20996.8%
100168.0%20,53393.7%
316105.0%19,71990.0%
100052.5%17,01177.7%
316221.0%11,31151.6%

 

17 wikipedistas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdições 
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
 agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
Soul TrainUC2 04,166245,46119mar 28, 2012701951--
MigraghviUC5 01,36118043ago 31, 201191195---
User from DagUC8 05721143-ago 17, 201012901151--
MugerganetsUC13+2130202-out 13, 2012502212--
HydrizUC16...1031038-jan 30, 201428----
JurgenNLUC51...12121-jan 30, 201428----
Midnight GamblerUC71+551--out 29, 2013121----
Breogan2008UC79+641--fev 02, 2013390----
Дагиров УмарUC88+10317-dez 25, 2012429----
פארוקUC103+6621--abr 08, 2013325----
Giorgi BalakhadzeUC108...22--fev 02, 201425----
Faolin42UC195...1122fev 01, 201426----
VivaelceltaUC196...11--fev 02, 201425----
MoengUC197...11--fev 15, 201412----
Jianhui67UC198...11--fev 21, 20146----
Raboe001UC199...11--fev 22, 20145----
DmuradzUC200...11--fev 28, 2014 ----

 

20 wikipedistas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
  Primeira ediçãoúltima edição
 posiçãototaldatadias
atrás
datadias
atrás
Aslan4ikUC17,145jan 21, 2012768out 13, 2013137
Namik555UC32,822mar 07, 20111088abr 21, 2012677
LezgistxaUC41,517set 20, 2011891jun 01, 2012636
SPQRobinUC6643mar 27, 2012702mar 27, 2012702
Tamara UstinovaUC7595nov 14, 2011836dez 04, 201385
KmoksyUC9513ago 11, 2011931jan 27, 2013396
Saint JohannUC10385mar 28, 2012701out 15, 2012500
Cekli829UC11181mar 10, 20111085jan 24, 201434
MaqiviUC12158out 07, 2011874set 03, 2013177
U.SteeleUC14126ago 02, 2011940mar 31, 2012698
LezgiUC15116abr 27, 20111037jun 02, 2012635
NessajaUC1778abr 25, 2012673out 29, 2013121
МаликумUC1873fev 07, 2012751dez 11, 2012443
Master ShadowUC1954out 12, 20101234dez 14, 20101171
91i79UC2054mar 27, 2012702abr 04, 2012694
FsFUC2148jul 26, 2012581jul 29, 2012578
KaiyrUC2246ago 30, 20101277set 02, 2011909
Midnight GreenUC2344jul 30, 2011943abr 22, 2012676
Ruang rak noi nid mahasanUC2441dez 01, 20101184dez 25, 20101160
LezgimanUC2536mar 17, 2012712fev 04, 2013388

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 1.491 edições foram feitas por usuários anônimos, de um total de 33.033 edições ( 4e %)
  


40 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições 
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
 datadias
atrás
datadias
atrás
MerlIwBotUC12,631mai 27, 20111007ago 09, 2013202--
EmausBotUC21,656abr 16, 2012682nov 09, 2013110--
AddbotUC31,488mar 07, 2013357ago 16, 2013195--
XqbotUC41,027abr 16, 2012682mar 06, 2013358--
JackieBotUC5819abr 26, 2012672fev 28, 2014---
AvocatoBotUC6449mar 29, 2012700jul 07, 2012600--
GerakibotUC7328mai 24, 2012644mar 06, 2013358--
RedBotUC8173abr 22, 2012676ago 21, 2012555--
Makecat-botUC9151nov 01, 2012483mar 03, 2013361--
LegobotUC10108mar 11, 2013353abr 02, 2013331--
Idioma-botUC1197mar 27, 2012702mar 04, 2013360--
Justincheng12345-botUC1289jun 25, 2012612jan 10, 2013413--
YFdyh-botUC1363jul 01, 2012606fev 18, 2013374--
LaaknorBotUC1462mai 22, 2012646mar 05, 2013359--
JhsBotUC1555mar 28, 2012701jul 08, 2012599--
EscarbotUC1647abr 03, 2012695out 16, 2012499--
VolkovBotUC1747abr 28, 2012670fev 27, 2013365--
KamikazeBotUC1845mar 29, 2012700jan 24, 2013399--
JAnDbotUC1941mar 29, 2012700jul 02, 2013240--
AvicBotUC2040jun 01, 2012636dez 09, 2012445--
CarsracBotUC2135mar 31, 2012698fev 12, 2013380--
HiW-BotUC2230abr 07, 2012691out 18, 2012497--
VagobotUC2322mar 29, 2012700abr 30, 2012668--
SantoshBotUC2422out 21, 2012494jan 31, 2013392--
SynthebotUC2521set 20, 2012525jan 25, 2013398--
タチコマ robotUC2614out 20, 2012495out 21, 2012494--
PixelBotUC2713jul 20, 2012587mar 06, 2013358--
JotterbotUC2812jan 15, 2013408jan 18, 2013405--
Crochet.david.botUC298mai 07, 20082122mai 07, 20082122--
CommonsDelinkerUC308abr 26, 20111038mar 04, 2012725--
RobbotUC316mai 07, 2012661jan 02, 2013421--
CocuBotUC325ago 26, 2012550dez 15, 2012439--
NjardarBotUC334ago 28, 2012548ago 31, 2012545--
SassoBotUC342mai 29, 2012639jan 07, 2013416--
ObersachsebotUC352nov 24, 2012460jan 08, 2013415--
DragonBotUC362jan 13, 2013410jan 14, 2013409--
MalarzBOTUC371ago 18, 2012558ago 18, 2012558--
GhalyBotUC381jan 18, 2013405jan 18, 2013405--
SAMI.BotUC391fev 05, 2013387fev 05, 2013387--
MastiBotUC401mar 01, 2013363mar 01, 2013363--

 

Artigos que contêm pelo menos uma ligação interna e .. caracteres de texto legível, não contando códigos wiki e html,
ligações ocultas, etc.; títulos também não contam  (excluindo páginas de redirecionamento)

DataArtigos
 < 32 ch< 64 ch< 128 ch< 256 ch< 512 ch< 1 k ch< 2 k ch< 4 k ch< 8 k ch< 16 k ch< 32 k ch< 64 k ch

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110JpgOggPngSvgWebm
fev 20142,5 k421681121351,1 k 981      531001731
jan 20142,5 k413671121351,1 k 978      2101001731
dez 20132,4 k400651121341,1 k 974      1131001731
nov 20132,4 k398641121211,1 k 962      1381001731
out 20132,4 k386631121211,1 k 955      4451001731
set 20132,3 k37862941211,1 k 936      552841531
ago 20132,3 k35058921211,1 k 916      878821531
jul 20132,1 k34653881121,0 k 857      13679 531
jun 20132,0 k34252881081,0 k 839      60279 531
mai 20132,0 k3355071103994 780      37962 531
abr 20131,9 k3294969103985 762      59660 531
mar 20131,8 k3204851100948 730      44744 421
fev 20131,8 k2984548100936 715      39043 311
jan 20131,7 k285434592921 689      93142 111
dez 20121,7 k276414192889 664      58339 11 
nov 20121,6 k263392592859 645      50623 11 
out 20121,5 k24837491813 640      6502 11 
set 20121,2 k24335487788 622      4192 11 
ago 20121,2 k23134482723 549      4582 11 
jul 20121,2 k21629375674 531      6522 1  
jun 20121,1 k20328372619 494      11042 1  
mai 201299517719270546 423      16132    
abr 201286915812151294 256      25621    
mar 2012668783 3136 92      1952     
fev 2012635    99 69      231     
jan 2012627    97 69      222     
dez 2011623    97 68      277     
nov 2011593    90 62      433     
out 2011555    88 50      145     
set 2011548    85 46      779     
ago 2011421    79 29      1101     
jul 2011236    68 15      351     
jun 2011194    47 12      1148     
mai 2011123    11 7      363     
abr 201187    10 6      120     
mar 201169    10 3      114     
fev 201149    10 3      3     
jan 201148    10 3            
dez 201048    10 3      78     
nov 201043    10 3            
out 201043    10 3      25     
set 201040    6 3      27     
ago 201021    6 3      59     
jul 20108    6 3            
jun 20108    6 3            
mai 20108    6 3            
abr 20108    6 3            
mar 20108    5 3            
fev 20108    5 3            
jan 20108    5 3            
dez 20098    5 3            
nov 20098    5 3            
out 20098    5 3            
set 20098    5 3            
ago 20098    5 3            
jul 20098    5 3      1     
jun 20098    5 3            
mai 20098    5 3            
abr 20098    5 3            
mar 20098    5 3            
fev 20098    5 3            
jan 20098    5 3            
dez 20088    5 3      12     
nov 20088    2              
out 20088    2              
set 20088    2              
ago 20088    2              
jul 20088    2              
jun 20088    2              
mai 20088    2              
abr 20088    2              
mar 20088    2              
fev 20086    1              
jan 20086    1              
dez 20076    1              
nov 20071    1              
out 20071    1              

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

out 2007: 1 2 Кьилин ччин

nov 2007: 1 2 Кьилин ччин

dez 2007: 1 2 Кьилин ччин

jan 2008: 1 1 Кьилин ччин

mar 2008: 1 2 Википедия , 2 1 Кьилин ччин

abr 2008: 1 1 Кьилин ччин

nov 2008: 1 1 Кьилин ччин

dez 2008: 1 1 Кьилин ччин

jul 2009: 1 1 Кьилин ччин

ago 2010: 1 3 Урусат , 2 3 Кьвевар , 3 3 Дагъустан , 4 2 Кьилин ччин , 5 2 Футбол

set 2010: 1 2 Кьилин ччин , 2 2 Лезги кхьинар , 3 2 Андорра

out 2010: 1 2 Шри-Ланка , 2 2 Африка

dez 2010: 1 3 Баку , 2 2 Шри-Ланка , 3 2 ЦӀийи Зеландия , 4 2 Футбол , 5 2 Талибан , 6 2 СтIал Сулейман , 7 2 Урусат , 8 2 Пакистан , 9 2 Лезгистан , 10 2 Лезги , 11 2 Къазакъстан

fev 2011: 1 1 Кьилин ччин

mar 2011: 1 3 Эрменистан , 2 3 Азербайжан , 3 2 Чувудар , 4 2 Париж , 5 2 Нил , 6 2 Гьайванар , 7 2 Лезгияр , 8 2 Гибралтар , 9 1 НуькI

abr 2011: 1 4 Кьилин ччин , 2 4 КцӀар , 3 3 Къазакъстан , 4 3 Ирландия , 5 2 Шри-Ланка , 6 2 Лезгистан , 7 2 Лезги чIал , 8 2 Лам

mai 2011: 1 5 ЧIехибритания , 2 5 Азия , 3 4 Лезгистан , 4 3 Совет Социалист Республикайрин ГалкӀ , 5 2 Эрменистан , 6 2 Шри-Ланка , 7 2 Чувуд чӀал , 8 2 Китай чIал , 9 2 Туьрк чIал , 10 2 ТӀаратӀ , 11 2 Кьиблепатан Америка , 12 2 Къавкъаз , 13 1 Кьилин ччин

jun 2011: 1 4 Океания , 2 3 Эрменистан , 3 3 Перленг , 4 3 Крокодилар , 5 2 Кьилин ччин , 6 2 Юпитер , 7 2 Китайдин Халкьдин Республика , 8 2 Уганда , 9 2 Цифраяр , 10 2 Немец чIал , 11 2 Макао , 12 2 Лезгияр , 13 2 Лезгистан , 14 2 Къарагъанда , 15 2 Канада , 16 2 Кьиблепатан Америка , 17 1 НуькI

jul 2011: 1 4 Германия , 2 3 Европадин гьукуматар , 3 3 Греция , 4 2 Хьилер , 5 2 Саха чӀал , 6 2 Саха Республика , 7 2 Мегьарамдхуьр , 8 2 Лезгистан , 9 2 Къазакъстан , 10 1 Кьилин ччин

ago 2011: 1 3 НуькI , 2 3 Кьилин ччин , 3 3 Чурчул , 4 3 Хуьшрекандиз ухшар маймун , 5 3 Супик чӀал , 6 3 Саваннадин фил , 7 3 Наукандин юпик чӀал , 8 3 Мирикина , 9 3 Латин чIал , 10 3 Кьвевар , 11 3 Ибериядин сувайрин чурчул , 12 3 ГъвечӀи панда , 13 3 Гну , 14 3 Садхьанвай Араб Эмиратар , 15 3 Атна чӀал , 16 3 Аляскадин юпик чӀал , 17 3 Алеут чӀал , 18 2 Яру бубал , 19 2 Юпик чӀалар , 20 2 Эяк чӀал , 21 2 Эскимос-алеут чӀалар , 22 2 Экуь вили антилопа , 23 2 Чувуд чӀал , 24 2 Чевакдин чупик чӀал , 25 2 Чапла Канададин инуит чӀал

set 2011: 1 4 Туьркиядин лезги хуьрер , 2 3 Кьилин ччин , 3 3 Шергир , 4 3 Чинеруг , 5 3 Химия , 6 3 Харза , 7 3 Туьтуьнуькl , 8 3 Хундуз , 9 3 Ортажа , 10 3 Лезги кхьинар , 11 3 Къванцин цуцӀул , 12 3 Йайлакёй , 13 3 ЦуцӀул-балугъчи , 14 3 Дагъустан , 15 3 Гьатем ага ЧӀакарви , 16 3 Гиенадал ухшар кицӀ , 17 3 География , 18 3 Ахцегь , 19 2 НуькI , 20 2 Яру жанавур , 21 2 Юсуф ал-Лезги , 22 2 МичIи куьрен кард , 23 2 Шахин , 24 2 Шангъар , 25 2 Чалагъан

out 2011: 1 3 Кьилин ччин , 2 3 Топонимика , 3 3 Сатурн , 4 2 Чил (планета) , 5 2 Хьилер , 6 2 Хашпара дин , 7 2 Футбол , 8 2 Теннис , 9 2 Урусат , 10 2 Мегьарамдхуьруьн район

nov 2011: 1 4 Рутул район , 2 4 Лезгистан , 3 3 Кьилин ччин , 4 3 Яру жанавур , 5 3 Финн чӀал , 6 3 Гъуьгъвезар , 7 3 Ахцегь , 8 3 Антилопа , 9 2 Цуругъ , 10 2 ЦIийи Кьуруш , 11 2 Хьилер , 12 2 Хуьшрекандиз ухшар маймун , 13 2 Хуьшрекан хьтин маймун , 14 2 УсухвацI , 15 2 Урус чIал , 16 2 Урбис , 17 2 Туьрк чIал , 18 2 Топонимика , 19 2 Смугъул , 20 2 Ситатунга , 21 2 СикӀер , 22 2 Планета , 23 2 Пирал , 24 2 Осло , 25 2 Орхидея

dez 2011: 1 3 Франция , 2 3 Къуйсун , 3 3 Имарат Къавкъаз , 4 2 Кьилин ччин , 5 2 Туьркменистан , 6 2 Суварин цӀиргъ , 7 2 Кеферпатан МуркIарин океан , 8 2 Монако , 9 2 Марсельеза , 10 2 Люксембург , 11 2 Инд океан , 12 1 НуькI

jan 2012: 1 4 Тай чӀал , 2 3 Мукьтадир , 3 2 Кьилин ччин , 4 2 Усугъчай , 5 2 Совет Социалист Республикайрин ГалкӀ

fev 2012: 1 4 Кьилин ччин , 2 3 Гьажи Мегьамед Эфенди Штулви , 3 2 Мукьтадир , 4 2 Луткун , 5 2 Википедия

mar 2012: 1 13 Кьилин ччин , 2 10 Лезгияр , 3 8 Азербайжан , 4 7 Лезгистан , 5 7 Къуба , 6 7 Ингъушар , 7 7 Баку , 8 6 Урусат , 9 6 Къазакъстан , 10 6 Ахцегь район , 11 5 Эрменистан , 12 5 Европадин гьукуматар , 13 5 Совет Социалист Республикайрин ГалкӀ , 14 5 ТӀаратӀ , 15 5 Лезгийрин тарих , 16 5 Кьиблепатан Америка , 17 5 Инглис чIал , 18 5 Заира Аминова , 19 5 Дагъустан , 20 5 Ахцегь , 21 5 Антарктида , 22 5 Али Султан , 23 4 Табасаранар , 24 4 Урусар , 25 4 ЦIийи Дуьнья

abr 2012: 1 6 Кьилин ччин , 2 6 Лезгияр , 3 5 Христофор Колумб , 4 5 Дуьньядин кьведлагьай дяве , 5 5 Польша , 6 5 Агъул район , 7 5 Рейн , 8 5 Литва , 9 5 Сауди Арабистан , 10 5 Пакистан , 11 5 Лезги чIал , 12 5 Азербайжан , 13 4 Философия , 14 4 Боливия , 15 4 Пакистандин пайдах , 16 4 Исламабад , 17 4 Мегьамед Мегьамедан хва Гьажиев , 18 4 Италия , 19 4 Лезги Википедия , 20 4 Сара Бернар , 21 4 ЦӀийи гафарин сиягь , 22 4 Грекрин алфавит , 23 4 Тегьран , 24 4 Урусар , 25 4 Кореядин Халкьдинни-Демократиядин Республика

mai 2012: 1 5 Португалия , 2 5 Мисри , 3 5 Ахцегь , 4 4 Каир , 5 4 Puzzling World , 6 4 Владимир Владимирович Путин , 7 4 Falco vespertinus , 8 4 I Наполеон Бонапарт , 9 4 Трпиня , 10 4 Кьилин ччин , 11 4 Италия , 12 4 Дунай , 13 4 Гъед (гьайванар) , 14 3 Абдул Мажид , 15 3 Португал чIал , 16 3 Колибри , 17 3 Дуэро , 18 3 Португалиядин шегьерар , 19 3 Альберт Эйнштейн , 20 3 Кьибле-Африкадин Республика , 21 3 Улуб , 22 3 Мастурбация , 23 3 Яру улуб , 24 3 Астероид , 25 3 Динозавраяр

jun 2012: 1 7 Мугьаммад , 2 6 Византий империя , 3 5 Исаак Ньютон , 4 5 Аллагьдин 99 тӀвар , 5 5 Алюминий , 6 5 Урусат , 7 4 Аврил Лавин , 8 4 Гелхен , 9 4 Химиядин элементрин девирдин система , 10 4 Шахматар , 11 4 Осман империя , 12 4 Византиядин императоррин сиягь , 13 4 Республика Корея , 14 4 The Macallan , 15 4 Суван Къарабагъ , 16 4 Китайдин Халкьдин Республика , 17 4 Финн чӀал , 18 4 Ахцегь , 19 4 Айдагьо , 20 3 Брест , 21 3 Вольфганг Амадеус Моцарт , 22 3 Математика , 23 3 Бубуяр , 24 3 Сятдин чӀул , 25 3 Гьукуматдин идара авунин тегьер

jul 2012: 1 4 Санкт-Петербург , 2 4 ЧӀехи Француз инкъилаб , 3 4 Рим империя , 4 4 Куба , 5 3 Дуьньядин чими хьун , 6 3 Эсперанто , 7 3 Волга , 8 3 Эрнесто Че Гевара , 9 3 Яд , 10 3 Автомобилдин код , 11 3 Математика , 12 3 Чил (планета) , 13 3 Сев , 14 2 Лелевар , 15 2 Постессив аватвал , 16 2 Археяр , 17 2 Биология , 18 2 Дезоксирибонуклеин цурувал , 19 2 Велс , 20 2 Садхьанвай миллетрин тешкилат , 21 2 Че Гевара , 22 2 Расим Загьирбег хва Тагирбеков , 23 2 Рахазвайбурун кьадардиз килигна чӀаларин сиягь , 24 2 Автомобил код , 25 2 Почтунин индекс

ago 2012: 1 7 Лезгистан , 2 5 Олимпиядин къугъунар , 3 4 Рим , 4 3 КӀамс , 5 3 Сочи , 6 3 Биология , 7 3 Грекрин алфавит , 8 2 Экваториал Гвинея , 9 2 Чарльз Дарвин , 10 2 Искандер Македонжув , 11 2 The Beatles , 12 2 Иосиф Виссарионович Сталин , 13 2 Сингапур , 14 2 Гуржи чIал , 15 2 Хунзах район , 16 2 2012 Гатун Олимпия къугъунар , 17 2 Велс , 18 2 Эсперанто , 19 2 Куба , 20 2 Португалия , 21 2 Тегьран , 22 2 Урус чIал , 23 2 Тувалу , 24 2 Лас океан , 25 1 Никlи

set 2012: 1 3 Юлий Цезарь , 2 3 Иерусалим , 3 3 Таиланд , 4 3 Жозе Мария Эса ди Кейруш , 5 3 Ботлих , 6 3 Акуша , 7 3 Алпан , 8 3 Хошимин , 9 3 Кьулан вацI , 10 3 Париж , 11 2 Физика , 12 2 Дегь Мисри , 13 2 ПIатIар , 14 2 Сарфунъял , 15 2 Экология , 16 2 Вунгтау , 17 2 Нячанг , 18 2 Америка , 19 2 Кертагъ Давдакь , 20 2 С , 21 2 Слово (газет, Португалия) , 22 2 Эйсебио , 23 2 Маяк Португалии , 24 1 Донгхой

out 2012: 1 4 Мадрид , 2 4 Вена , 3 3 Хуьруьн майишат , 4 3 Кефердинни рагъакIидай Англия , 5 3 Ливерпульдин агломерация , 6 3 Неаполь , 7 3 Турин , 8 3 ЦIуру Худат , 9 3 Хурай (КцIар) , 10 3 Немец чIал , 11 2 Мирземугьаммадхъишлах , 12 2 Эрдэнэт , 13 2 Монгол чӀал , 14 2 Улан-Батор , 15 2 Чархы , 16 2 Жанахир , 17 2 ЧIал , 18 2 Карл Маркс , 19 2 Салвадор Дали , 20 2 Акбар ЧӀехи , 21 2 Гаф , 22 2 Slayer , 23 2 Пекин , 24 2 Къусарчай (Хъачмаз) , 25 2 Гуьнешли

nov 2012: 1 4 Компьютер , 2 4 Садвал , 3 3 Чепер , 4 3 Уран (планета) , 5 3 Каракорум (шегьер) , 6 3 Куритиба , 7 3 Гилияр , 8 3 Водород , 9 3 Грар , 10 3 Магьачкъала , 11 3 Дербент район , 12 2 Людвиг ван Бетховен , 13 2 Ӄ , 14 2 Дагъустандин ЦIаяр , 15 2 Дагъустандин шегьерар , 16 2 Ухул , 17 2 1930 йис , 18 2 Мичегь , 19 2 Калук , 20 2 Приморск (Дагъустан) , 21 2 Венесуэла , 22 2 КьепIир Къазмаяр , 23 2 Хуьлуьхъ , 24 2 ПIатIар , 25 2 Рим

dez 2012: 1 3 Кьулан СтIал , 2 3 Къайи дяве , 3 3 Вепс чӀал , 4 3 Пудлагьай рейх , 5 3 Велс , 6 3 Астероид , 7 3 Ле Корбюзье , 8 2 Камарван , 9 2 Пиперхуьр , 10 2 КIахцугъ , 11 2 Герейханован совхоздин 2-лагьай отделение , 12 2 Зари , 13 2 Алкьвадар , 14 2 Усур , 15 2 Хашпересрин финар , 16 2 Вьетнамдин дяве , 17 2 1930 йис , 18 2 Сарфунъял , 19 2 Усугъчай , 20 2 Туьркер-Месхетинар , 21 2 ТӀиб , 22 2 Марс , 23 2 Кьасумхуьр , 24 1 Пак тир Рим империя

jan 2013: 1 3 Индуизм , 2 3 Лезгияр , 3 2 Вашингтон (кьилин шегьер) , 4 2 Ахвах район , 5 2 Акуша район , 6 2 1812 йис , 7 2 1866 йис , 8 2 1878 йис , 9 2 1969 йис , 10 2 Вини СтIал , 11 2 , 12 2 Пак тир Рим империя , 13 2 Компьютер , 14 2 Велиханрин Къудрат Кибечханан хва , 15 2 Волга , 16 2 Мугьаммад , 17 2 ЧӀулав тӀеквен , 18 2 Сампи , 19 2 Промышленность , 20 2 2012 йис , 21 2 Рейн , 22 2 Пси (гьарф) , 23 2 Фи , 24 2 Ипсилон , 25 2 Тау

fev 2013: 1 2 Фридрих Ницше , 2 2 Бум , 3 2 Къарасу , 4 2 Къарадейн , 5 2 Кичик ПIирали , 6 2 Курд (Кьвепеле) , 7 2 Кветуьклуь , 8 2 Имамлы , 9 2 Зергерли , 10 2 Зараган , 11 2 Залам , 12 2 Жигъателли , 13 2 Жорлу , 14 2 Енгиже

mar 2013: 1 3 1949 йис , 2 3 1969 йис , 3 3 Турция , 4 3 Айдагьо , 5 3 Абхазия , 6 2 Дегь Греция , 7 2 Валенсия (мана) , 8 2 Илим , 9 2 АСШ-дин граждан дяве , 10 2 Гарринча , 11 2 ЧӀулав хъалхъам , 12 2 Элвис Пресли , 13 2 Байуба , 14 2 Дунчэн (Пекин) , 15 2 Садхьанвай миллетрин тешкилат , 16 2 Каир , 17 2 ЧӀулав тӀеквен , 18 2 Лекь (анатомия) , 19 2 Яру жанавур , 20 2 Эхен , 21 2 Китайдин Халкьдин Республика , 22 2 Чиле , 23 2 Лас океан , 24 2 Пахун , 25 2 Некхъвадайбур

abr 2013: 1 5 Амстердам , 2 3 Гонконг , 3 3 Октавиан Август , 4 3 Плазма , 5 3 Ракь , 6 3 Рио-де-Жанейро , 7 3 Метр , 8 3 Буэнос-Айрес , 9 3 Иерусалим , 10 3 Дагъустан , 11 2 Умар Хайям , 12 2 Сувар (ансамбль) , 13 2 Керимрин Седакъет Къайинбеган руш , 14 2 Аугусто Де Лука , 15 2 Метаболизм , 16 2 Кизилюрт , 17 2 Михаил Лезгинцев , 18 2 Атом , 19 2 Гьуьсейнов Абдусалам Абдулкериман хва , 20 2 Барселона (мана) , 21 2 Агъдам район , 22 2 Нежефхуьр , 23 2 Ахцегьрин гьамамар , 24 2 Грар , 25 2 Юсуф ал-Лезги

mai 2013: 1 3 Франция , 2 2 Москва вилаят , 3 2 Альгеро , 4 2 Алпан (манаяр) , 5 2 Алпан (астрономия) , 6 2 Алпан

jun 2013: 1 3 Марко Поло , 2 3 Демократия , 3 3 Фу , 4 2 Мидгьед Ширинбегов , 5 2 Иисусан гьакъикъи клиса , 6 2 Александр Ильич Рыбников , 7 2 Кьавал , 8 2 Агъул чIал , 9 2 Хвереж (Кьурагь район) , 10 2 Усугъ , 11 2 Вулкан (геология) , 12 2 Абилов Магьмуд Абдулрзадин хва , 13 2 Митаги хуьруьнсовет , 14 2 Хазар хуьруьнсовет , 15 1 Кьилерин хуьруьнсовет

jul 2013: 1 2 Хъачмаз район , 2 1 Зигмунд Фрейд

ago 2013: 1 3 Католицизм , 2 3 Чингисхан , 3 3 Винстон Черчилль , 4 2 Урусатдин тӀаратӀ , 5 2 Табасаран чIал , 6 2 Дагъустандин тIаратI , 7 2 Гоа (Дагъустан) , 8 2 Мыгра (Дагъустан) , 9 2 Кина (Дагъустан) , 10 2 Британиядин империя , 11 2 Вини Катрух , 12 2 Автомобиль , 13 2 Марко Поло , 14 2 Агъул чIал , 15 2 ЧIал , 16 2 ЦIийихуьр , 17 2 Христофор Колумб , 18 2 ТӀаратӀ , 19 2 Лезги чIал , 20 2 Кьвевар , 21 1 Будугъ чIал

set 2013: 1 3 Авраам Линкольн , 2 3 КъирицI чIал , 3 2 Чилин зурзунар , 4 2 Хинелугъ чIал , 5 2 Нидерландар , 6 2 Китайдин Халкьдин Республика , 7 2 Саха Республика , 8 1 ЦIуру Киркар

out 2013: 1 3 Лезгияр , 2 2 Холокост , 3 2 Хамаматюрт , 4 2 Адиль-Янгиюрт , 5 2 Бабаюрт , 6 2 Чилин зурзунар , 7 2 Табасаранар , 8 1 ЧӀутрацуьк

nov 2013: 1 3 Аристотель , 2 3 Бактерияр , 3 2 Ингушетия , 4 2 UTC+4 , 5 2 Терек , 6 2 Хуьр , 7 2 Шегьер , 8 2 АхцегьвацӀ , 9 2 Мустафа Камал Ататуьрк , 10 1 Муниципал район

dez 2013: 1 3 КуртӀухъан , 2 3 Атлантик океан , 3 3 Харахуба , 4 2 Пепеяр , 5 2 Малярия , 6 1 Тарих

jan 2014: 1 3 Мирослава Вавринец , 2 3 Роджер Федерер , 3 3 Валентина Васильевна Толкунова , 4 3 Кьвепеле , 5 2 Затор , 6 2 Бойнице , 7 2 Куколивка

fev 2014: 1 3 Шахматар , 2 2 Сан-Паулу , 3 2 Гуржистан , 4 2 Абхазия , 5 1 Славян чIалар

No data on this page have been normalized to 30 day months (as WMF does on certain traffic reports).
Wikipedias are initially ordered by number of speakers of the language

Speakers: Number of speakers of a language is the estimated total of primary and secondary speakers, is in many cases a very rough estimation (based on the page on the English Wikipedia about that language)
Regions are parts of the world where the language is spoken in substantial amounts (compared to total number of speakers). Regions where a language gained presence only by a recent diaspora are generally not included.
Region codes: AF:Africa, AS:Asia, EU:Europe, NA:North America, OC:Oceania, SA:South America, W:World Wide, CL:Constructed Language

Estatísticas geradas em Quarta-feira, 2 de abril 2014 14:10

Dump file lezwiki-20140303-stub-meta-history.xml.gz (edits only), size 3.4 Mb as gz -> 24 Mb
Dump processed till Feb 28, 2014, on server stat1002, ready at Fri-14/03/2014-10:41 after 25 sec.

Versão do script:2.6
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.