Estatísticas da Wikipédia lezgian

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Articles per size range / Records per namespace / Most edited articles / Zeitgeist

Most metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.

Some metrics have been collected from the full archive dump which runs on lower frequency than the usual monthly cycle.
These metrics are columns F,I,J,K,M,N,O,P,Q,R from the first table.


See also metrics definitions


 
Monthly counts & Quarterly rankings: julho 2015
 
DataWikipedistasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
jul 20150%   +3%      +37%      +2%
jun 20150%   +4%      -65%      +1%
mai 20150%   +11%      +127%      +1%
abr 2015+2%   +3%      -0%      +2%
mar 2015+2%   0%      +250%      +1%
fev 20150%   +1%      +77%      +1%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P____Q____R____S__
jul 201559 412,6 k 214,5   595      603
jun 201559 412,5 k 314,7   434      589
mai 201559 312,5 k 815   1,3 k      581
abr 2015591412,2 k 216,1   554      578
mar 2015581512,2 k  16,3   556      564
fev 201557 4 2,1 k 116,1   159      556
jan 201557 3 2,1 k 116,2   90      550
dez 201457 3 2,1 k  16,3   46      548
nov 201457 2 2,1 k  16,2   65      546
out 20145713 2,1 k  16,3   110      545
set 20145613 2,1 k 116,3   70      542
ago 201455 412,1 k 216,4   287      540
jul 201455 212,0 k 116,7   177      533
jun 20145526 2,0 k 116,8   230      530
mai 20145316 2,0 k 116,9   279      522
abr 201452 4 1,9 k  17   159      500
mar 201452 4 1,9 k  17   137      493
fev 201452 2 1,9 k1,7 k 17233180%38%858,5 Mb587 k36 k2402,3 k5,4 k487
jan 2014522611,9 k1,7 k 17233379%38%3548,5 Mb584 k36 k2402,2 k5,4 k484
dez 201350 3 1,9 k1,7 k 16,9233079%38%1448,5 Mb581 k35 k2402,2 k5,4 k481
nov 201350 4 1,9 k1,7 k116,9232879%38%1728,4 Mb578 k35 k2402,2 k5,4 k480
out 2013501311,9 k1,7 k317233279%38%5298,4 Mb574 k35 k2432,2 k5,3 k474
set 201349 311,8 k1,6 k217,5226578%36%5707,7 Mb533 k32 k3552,2 k4,9 k470
ago 201349 211,7 k1,6 k517,7218577%34%9037,3 Mb500 k31 k3552,2 k4,6 k465
jul 201349 2 1,6 k1,4 k118,8207075%29%1576,3 Mb433 k27 k5312,1 k3,9 k430
jun 201349 311,6 k1,4 k218,9205775%29%6356,1 Mb426 k26 k5342,1 k3,9 k428
mai 201349 211,5 k1,3 k219,4199274%27%4115,7 Mb395 k24 k4862,1 k3,5 k416
abr 201349 521,4 k1,2 k120194273%25%6655,3 Mb370 k23 k4892,1 k3,2 k415
mar 2013491511,4 k1,2 k 20,1187171%23%2,1 k4,9 Mb346 k22 k1,1 k2,1 k3,0 k400
fev 201348 321,4 k1,2 k318,7183472%23%1,3 k6,5 Mb337 k21 k67 k2,1 k2,9 k392
jan 201348 421,3 k1,1 k218,9182571%23%1,6 k6,2 Mb318 k21 k66 k2,1 k2,8 k386
dez 201248 511,2 k1,1 k218,5180971%22%1,2 k5,9 Mb301 k20 k64 k2,1 k2,6 k375
nov 2012481711,2 k1,0 k418,5174870%19%1,1 k5,5 Mb276 k18 k63 k2,1 k2,4 k364
out 2012472521,1 k946619,3175768%18%1,2 k5,1 Mb254 k17 k61 k1,9 k2,2 k356
set 201245 51871746122,4185161%21%1,3 k4,5 Mb220 k15 k58 k1,5 k1,9 k339
ago 201245162841711121,6178860%20%9784,3 Mb204 k15 k56 k1,5 k1,7 k334
jul 2012441123819689121167359%19%1,3 k3,9 Mb186 k13 k54 k1,2 k1,6 k313
jun 2012431133780637220,4145454%17%1,7 k3,4 Mb154 k11 k50 k1,1 k1,4 k290
mai 201242193721564219,7123750%15%2,2 k2,9 Mb121 k8,2 k47 k1,0 k1,1 k247
abr 201241317566850031898444%12%3,1 k2,4 Mb89 k6,2 k42 k790727184
mar 2012388206564393115,881139%9%2,4 k1,8 Mb61 k3,4 k34 k70834890
fev 201230141536388 12,180040%8%7061,6 Mb59 k3,2 k28 k68830785
jan 201229121532386 10,978040%8%2331,4 Mb57 k3,3 k23 k68730681
dez 201128 41528383110,577240%8%2911,4 Mb56 k3,2 k23 k68430481
nov 201128371506370110,478941%8%4341,3 Mb55 k3,1 k21 k66430374
out 201125 4 487348 9,978440%8%3491,3 Mb52 k2,8 k21 k65029757
set 201125410248234549,378740%8%7691,1 Mb52 k2,8 k14 k64931355
ago 201121610237526959,987643%10%1,1 k954 kb45 k2,4 k12 k53331138
jul 201115181220166111,973245%8%361537 kb23 k8298,7 k35918712
jun 201114 51179131212,680451%10%1,2 k487 kb21 k6528,0 k28016411
mai 2011143811125719,760327%12%436322 kb9,9 k2967,3 k106298
abr 20111125 794018,351125%11%157210 kb5,8 k1484,9 k8816
mar 2011923 613418,160230%15%141201 kb5,3 k1284,9 k7516
fev 20117   4131 8,783641%22%3169 kb4,9 k1223,7 k56 6
jan 20117   4031 8,883642%22%3167 kb4,9 k1223,7 k56 6
dez 2010712 4031 8,783642%22%75167 kb4,9 k1223,7 k56 6
nov 20106   3923 7131138%23% 130 kb7,8 k1219195922
out 2010612 3923 7131138%23%36130 kb7,8 k1219195922
set 2010511 362216,6145742%19%113128 kb7,6 k1219186322
ago 2010422 1818 6,9103167%28%5766 kb2,9 k12089457 1
jul 20102   55 13,685760%40%415 kb956151334 1
jun 20102   55 12,885760%40% 15 kb956151334 1
mai 20102   55 12,885760%40%315 kb956151334 1
abr 20102   55 12,285760%40% 15 kb956151334 1
mar 20102   55 12,285760%40% 15 kb956151334 1
fev 20102   55 12,285760%40% 15 kb956151334 1
jan 20102   55 12,285760%40%315 kb956151334 1
dez 20092   55 11,685760%40% 15 kb956151294 1
nov 20092   55 11,685760%40% 15 kb956151294 1
out 20092   55 11,685760%40% 15 kb956151294 1
set 20092   55 11,685760%40% 15 kb956151294 1
ago 20092   55 11,685760%40% 15 kb956151294 1
jul 20092   55 11,685760%40%115 kb956151294 1
jun 20092   55 11,485760%40% 14 kb95615184 1
mai 20092   55 11,485760%40% 14 kb95615184 1
abr 20092   55 11,485760%40% 14 kb95615184 1
mar 20092   55 11,485760%40% 14 kb95615184 1
fev 20092   55 11,485760%40% 14 kb95615184 1
jan 20092   55 11,485760%40% 14 kb95615184 1
dez 20082 1 55 11,485760%40%914 kb95615184 1
nov 20082   55 9,682660%40%112 kb9261183 1
out 20082   55 9,482560%40% 12 kb9231183 1
set 20082   55 9,482560%40% 12 kb9231183 1
ago 20082   55 9,482560%40% 12 kb9231183 1
jul 20082   55 9,482560%40% 12 kb9231183 1
jun 20082   55 9,482560%40% 12 kb9231183 1
mai 20082   55 9,482560%40%612 kb9231183 1
abr 20082   55 8,282560%40%412 kb9231183 1
mar 20082   55 7,481360%40%712 kb9071183 1
fev 20082   34 101615100%100% 19 kb1,3 k6921111
jan 20082   34 101615100%100%519 kb1,3 k6921111
dez 2007211 32 8,3145467%67%1718 kb7626629 1
nov 20071   11 82920100%100%65,9 kb3476328  
out 200711  1  242  2104 6     
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
The following table ranks this project in relation to projects in other languages with 1000+ articles
abr 2015163151138147198 125167   124      242
jan 2015165 151 196 157165   177      242
out 2014162138149 197  164   157      242
jul 2014164 167132197 148161   156      242
abr 2014166 139 198  159   163      242
jan 2014164114119143195180160161507028140147161156205140133242
out 2013164142155128195180104162476827109148159156211139133242
jul 2013163138169135204185151152597951158156171169187138139242
abr 2013161148129107204184157144698459140163175174196138144242
jan 2013156145136102204184119151718669153182179173199140143242
out 201215710912210220918885145779488171188183177201141151242
jul 20121611308892213199151210209209208165197188180203155160242
abr 2012161877875216203109208207207205109208207205212168183242
jan 2012185142168135218210149207206206204224221220220222175205242
out 2011194148140143220211159206205205203220219220224221174205242
jul 201121813899136228223160203202202200216229227228231191212242
abr 201122597129132237233154198197197195227236236236235222240242
jan 2011238150217136241234158196195195193241237236236236232240242
out 2010238143171130241235151191190190188237236232236240225240242
jul 2010241160221140242240158185184184182241240240240240239240242
abr 2010240152210133242240160183182182181241240240240240237240242
jan 2010239142202130241240154181181181180237241240240240236240242
out 2009239142204135241240158178178178177239241240240240235240242
jul 2009237187198132240238152172172172171236237237239239236237242
abr 2009236140200144238237147170170170169238238237239238236235242
jan 2009236132205130237236149164164164163239236236237237236236241
out 2008233136198127236232143158158158157236234234235236235235240
jul 2008231145197131233229147152152152150234231231232234231234239
abr 2008230145203131232229151147147146144233230229232234230232239
jan 2008227149207133230226154142142141140227227224220229219228236
out 2007230133195132232231148140140138138227233231231228224226234
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
 WikipedistasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikipedistas (usuários registrados)
A = Wikipedistas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikipedistas que editaram pelo menos dez vezes desde que chegaram
C = Wikipedistas que contribuíram cinco vezes ou mais este mês
D = Wikipedistas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Artigos que contêm pelo menos uma ligação interna e 200 caracteres de texto legível, não contando códigos wiki e html,
      ligações ocultas, etc.; títulos também não contam (outras colunas são baseadas no método oficial de contagem)
G = Novos artigos por dia no mês passado
H = Número médio de revisões por artigo
I = Tamanho médio dos artigos em bytes
J = Porcentagem de artigos com pelo menos 0,5 kb de texto legível (veja F)
K = Porcentagem de artigos com pelo menos 2 kb de texto legível (veja F)

Base de dados
L = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
M = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
N = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
O = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
P = Total de ligações para outras wikipédias
Q = Total de imagens apresentadas
R = Total de ligações para outros sítios
S = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  5  10  100  1000  1  3  5  10  25  100  5  10  1  3  5  10  25  100  250  5  10  100 
jul 201510443311     211     54421  22 
jun 201511542211     21      75431  22 
mai 2015133332111    5331    733322 22 
abr 201511544311     5221  22533221 22 
mar 201512653211 11  311   115211   32 
fev 2015115431      31      7311   22 
jan 201584332      831     5221   22 
dez 20148331       5       711    22 
nov 201452221  11  21      63211  22 
out 2014114322      3       82111  22 
set 201493331      711     6211   22 
ago 2014844421  11  41      94433  22 
jul 2014922211      1       43221  22 
jun 201496652  11  32      42111  22 
mai 2014176663      3221    95322  22 
abr 2014115432  1   221     72221  21 
mar 2014134441  11  421     5111   22 
fev 201415222       321     7111   22 
jan 20141286431  11  321     6221   32 
dez 2013114332  11  622     42111  11 
nov 2013115433  11  5211    122221  11 
out 20139432111 21  62      633211111 
set 20139332211     53      933321 22 
ago 20134322211 2   53211   7222221431
jul 201342222      31      93221  33 
jun 20137332211 1   8521    733222 32 
mai 20136222111 11  531     112222  21 
abr 201313555321 33  4443    1133322 541
mar 201314652211 7611102211   1954221 541
fev 2013933222  1063 6221    843221 971
jan 201315543221 1363 6322    933321 961
jul 201510443311     211     54421  22 
abr 201511544311     5221  22533221 22 
jan 201584332      831     5221   22 
out 2014114322      3       82111  22 
jul 2014922211      1       43221  22 
abr 2014115432  1   221     72221  21 
jan 20141286431  11  321     6221   32 
out 20139432111 21  62      633211111 
jul 201342222      31      93221  33 
abr 201313555321 33  4443    1133322 541
jan 201315543221 1363 6322    933321 961
out 201211655321 862 74321   1254321 851
jul 2012181212853  872 1711842   2314131031 771
abr 201232211710754 971 341914853  562212774143 
jan 2012742221      1       1         
out 201185441  111         11111  11 
jul 201110884111     322     421111    
abr 201165551      1       1         
jan 2011                            
out 20103221               2111      
jul 2010                            
abr 2010                  2         
jan 2010                            
out 2009                            
jul 20091                           
abr 2009                            
jan 2009                  1         
out 2008                            
jul 2008                  2         
abr 200811                          
jan 200811                          
out 20072                           

 

Distribuição de edições de artigos por wikipedistas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikipedistasEdições total
1271100.0%26,533100.0%
39735.8%26,30699.1%
105921.8%26,08598.3%
323312.2%25,63396.6%
100186.6%24,98394.2%
316124.4%24,20191.2%
100062.2%21,05779.4%
316220.7%14,16053.4%

 

10 wikipedistas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdições 
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
 agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
Aslan4ikUC1 09,5854442,92542jan 21, 201212861,41559--
Soul TrainUC2 04,575356,05819mar 28, 20121219110---
MugerganetsUC6 01,052761145out 13, 2012102018916--
User from DagUC7 06427148-ago 17, 201018081311--
Cekli829UC13 017921508mar 10, 201116037---
ChumwaUC120+5721--set 27, 20121036----
NickispeakiUC139...222-jul 06, 201524----
Loup Solitaire 81UC140...22--jul 12, 201518----
NirmosUC270...11--jul 05, 201525----
KopiersperreUC271...11--jul 15, 201515----

 

20 wikipedistas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
  Primeira ediçãoúltima edição
 posiçãototaldatadias
atrás
datadias
atrás
Namik555UC32,774mar 07, 20111606abr 21, 20121195
MigraghviUC41,574ago 31, 20111429jun 05, 201555
LezgistxaUC51,497set 20, 20111409jun 01, 20121154
SPQRobinUC8629mar 27, 20121220mar 27, 20121220
Tamara UstinovaUC9587nov 14, 20111354dez 04, 2013603
KmoksyUC10512ago 11, 20111449fev 12, 2015168
MaxBioHazardUC11389mar 11, 2015141mar 11, 2015141
Saint JohannUC12385mar 28, 20121219out 15, 20121018
MaqiviUC14153out 07, 20111392set 03, 2013695
U.SteeleUC15125ago 02, 20111458mar 31, 20121216
LezgiUC16116abr 27, 20111555jun 02, 20121153
МаликумUC17106fev 07, 20121269mar 22, 2014495
HydrizUC18103jan 30, 2014546jan 30, 2014546
NessajaUC1990abr 25, 20121191out 05, 2014298
91i79UC2055mar 27, 20121220out 12, 2014291
Master ShadowUC2153out 12, 20101752dez 14, 20101689
FsFUC2248jul 26, 20121099jul 29, 20121096
KaiyrUC2345ago 30, 20101795set 02, 20111427
Midnight GreenUC2444jul 30, 20111461abr 22, 20121194
LezgimanUC2544mar 17, 20121230jun 06, 201554

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 1.613 edições foram feitas por usuários anônimos, de um total de 37.909 edições ( 4e %)
  


42 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições 
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
 datadias
atrás
datadias
atrás
MerlIwBotUC12,604mai 27, 20111525ago 09, 2013720--
EmausBotUC21,645abr 16, 20121200nov 09, 2013628--
AddbotUC31,468mar 07, 2013875ago 16, 2013713--
XqbotUC41,052abr 16, 20121200mar 06, 2013876--
JackieBotUC5909abr 26, 20121190dez 01, 2014241--
AvocatoBotUC6443mar 29, 20121218jul 07, 20121118--
GerakibotUC7325mai 24, 20121162mar 06, 2013876--
RedBotUC8171abr 22, 20121194ago 21, 20121073--
Makecat-botUC9149nov 01, 20121001mar 03, 2013879--
LegobotUC10107mar 11, 2013871abr 02, 2013849--
Idioma-botUC1197mar 27, 20121220mar 04, 2013878--
Justincheng12345-botUC1289jun 25, 20121130jan 10, 2013931--
MBHbotUC1367mar 11, 2015141mar 11, 2015141--
YFdyh-botUC1463jul 01, 20121124fev 18, 2013892--
LaaknorBotUC1560mai 22, 20121164mar 05, 2013877--
JhsBotUC1655mar 28, 20121219jul 08, 20121117--
EscarbotUC1747abr 03, 20121213out 16, 20121017--
VolkovBotUC1847abr 28, 20121188fev 27, 2013883--
KamikazeBotUC1945mar 29, 20121218jan 24, 2013917--
JAnDbotUC2041mar 29, 20121218jul 02, 2013758--
AvicBotUC2140jun 01, 20121154dez 09, 2012963--
CarsracBotUC2235mar 31, 20121216fev 12, 2013898--
HiW-BotUC2329abr 07, 20121209out 18, 20121015--
CommonsDelinkerUC2424abr 26, 20111556jul 15, 201515--
VagobotUC2522mar 29, 20121218abr 30, 20121186--
SantoshBotUC2622out 21, 20121012jan 31, 2013910--
SynthebotUC2721set 20, 20121043jan 25, 2013916--
PixelBotUC2813jul 20, 20121105mar 06, 2013876--
タチコマ robotUC2913out 20, 20121013out 21, 20121012--
JotterbotUC3012jan 15, 2013926jan 18, 2013923--
Crochet.david.botUC316mai 07, 20082640mai 07, 20082640--
RobbotUC326mai 07, 20121179jan 02, 2013939--
CocuBotUC335ago 26, 20121068dez 15, 2012957--
OctraBotUC345mai 12, 2014444jan 30, 2015181--
NjardarBotUC354ago 28, 20121066ago 31, 20121063--
SassoBotUC362mai 29, 20121157jan 07, 2013934--
ObersachsebotUC372nov 24, 2012978jan 08, 2013933--
DragonBotUC382jan 13, 2013928jan 14, 2013927--
MalarzBOTUC391ago 18, 20121076ago 18, 20121076--
GhalyBotUC401jan 18, 2013923jan 18, 2013923--
SAMI.BotUC411fev 05, 2013905fev 05, 2013905--
MastiBotUC421mar 01, 2013881mar 01, 2013881--

 

Artigos que contêm pelo menos uma ligação interna e .. caracteres de texto legível, não contando códigos wiki e html,
ligações ocultas, etc.; títulos também não contam  (excluindo páginas de redirecionamento)

DataArtigos
 < 32 ch< 64 ch< 128 ch< 256 ch< 512 ch< 1 k ch< 2 k ch< 4 k ch< 8 k ch< 16 k ch< 32 k ch< 64 k ch

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110JpgOggPngSvgWebm
jul 20153,2 k367921111001,3 k 1,1 k       991641
jun 20153,1 k366921111001,3 k 1,1 k       991641
mai 20153,0 k365921111001,3 k 1,1 k       991641
abr 20152,8 k362901111001,3 k 1,0 k       991641
mar 20152,7 k362871111001,2 k 1,0 k       991641
fev 20152,7 k35984111971,2 k 1,0 k       991641
jan 20152,7 k35584111971,2 k 1,0 k       991641
dez 20142,7 k34982111971,2 k 1,0 k       991641
nov 20142,7 k34581111971,2 k 1,0 k       991641
out 20142,6 k34180111971,2 k 1,0 k       991641
set 20142,6 k34078111971,2 k 990       991641
ago 20142,6 k33577111941,2 k 990       991641
jul 20142,6 k33076111941,2 k 985       991641
jun 20142,5 k32975111941,1 k 983       991641
mai 20142,5 k32974111921,1 k 976       991641
abr 20142,4 k32571110891,1 k 969       991631
mar 20142,4 k32369110891,1 k 968       991631
fev 20142,4 k32068109881,1 k 966      53991531
jan 20142,4 k31567109881,1 k 963      210991531
dez 20132,4 k31065109881,1 k 959      113991531
nov 20132,4 k31064109841,1 k 948      138991531
out 20132,4 k30363109841,1 k 941      445991531
set 20132,3 k2986291841,1 k 923      551831331
ago 20132,2 k2835889841,1 k 903      876811331
jul 20132,0 k2795385801,0 k 845      13578 331
jun 20132,0 k2765285781,0 k 828      60278 331
mai 20131,9 k272506873988 770      37761 331
abr 20131,9 k266496673979 754      58959 331
mar 20131,8 k257484872942 725      43943 221
fev 20131,8 k241454572930 710      38842 111
jan 20131,7 k230434465916 684      92441 111
dez 20121,6 k225414065884 659      57638 11 
nov 20121,5 k213392465854 640      50522 11 
out 20121,4 k20037464809 635      6492 11 
set 20121,2 k19635461784 617      4112 11 
ago 20121,2 k18734456719 545      4572 11 
jul 20121,1 k17729349670 527      6462 1  
jun 20121,1 k16728346616 491      10992 1  
mai 201296814519244543 420      15942    
abr 201285213212130291 253      25401    
mar 2012654653 1134 90      1924     
fev 2012621    97 69      231     
jan 2012613    95 69      222     
dez 2011609    95 68      266     
nov 2011580    88 62      428     
out 2011544    86 50      144     
set 2011537    83 46      756     
ago 2011413    77 29      1085     
jul 2011232    66 15      351     
jun 2011190    47 12      1134     
mai 2011120    11 7      360     
abr 201185    10 6      120     
mar 201167    10 3      114     
fev 201147    10 3      3     
jan 201146    10 3            
dez 201046    10 3      74     
nov 201041    10 3            
out 201041    10 3      25     
set 201038    6 3      27     
ago 201019    6 3      57     
jul 20106    6 3            
jun 20106    6 3            
mai 20106    6 3            
abr 20106    6 3            
mar 20106    5 3            
fev 20106    5 3            
jan 20106    5 3            
dez 20096    5 3            
nov 20096    5 3            
out 20096    5 3            
set 20096    5 3            
ago 20096    5 3            
jul 20096    5 3      1     
jun 20096    5 3            
mai 20096    5 3            
abr 20096    5 3            
mar 20096    5 3            
fev 20096    5 3            
jan 20096    5 3            
dez 20086    5 3      9     
nov 20086    2              
out 20086    2              
set 20086    2              
ago 20086    2              
jul 20086    2              
jun 20086    2              
mai 20086    2              
abr 20086    2              
mar 20086    2              
fev 20084    1              
jan 20084    1              
dez 20074    1              
nov 20071    1              
out 20071    1              

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

out 2007: 1 2 Кьилин ччин

nov 2007: 1 2 Кьилин ччин

dez 2007: 1 2 Кьилин ччин

jan 2008: 1 1 Кьилин ччин

mar 2008: 1 2 Википедия , 2 1 Кьилин ччин

abr 2008: 1 1 Кьилин ччин

nov 2008: 1 1 Кьилин ччин

dez 2008: 1 1 Кьилин ччин

jul 2009: 1 1 Кьилин ччин

ago 2010: 1 3 Урусат , 2 3 Кьвевар , 3 3 Дагъустан , 4 2 Кьилин ччин , 5 2 Футбол

set 2010: 1 2 Кьилин ччин , 2 2 Лезги кхьинар , 3 2 Андорра

out 2010: 1 2 Шри-Ланка , 2 2 Африка

dez 2010: 1 3 Баку , 2 2 Шри-Ланка , 3 2 ЦӀийи Зеландия , 4 2 Футбол , 5 2 Талибан , 6 2 СтIал Сулейман , 7 2 Урусат , 8 2 Пакистан , 9 2 Лезгистан , 10 2 Лезги

fev 2011: 1 1 Кьилин ччин

mar 2011: 1 3 Эрменистан , 2 3 Азербайжан , 3 2 Чувудар , 4 2 Париж , 5 2 Нил , 6 2 Гьайванар , 7 2 Лезгияр , 8 2 Гибралтар , 9 1 НуькI

abr 2011: 1 4 Кьилин ччин , 2 4 КцӀар , 3 3 Къазакъстан , 4 3 Ирландия , 5 2 Шри-Ланка , 6 2 Лезгистан , 7 2 Лезги чIал , 8 2 Лам

mai 2011: 1 5 ЧIехибритания , 2 5 Азия , 3 4 Лезгистан , 4 3 Советрин Социализмдин Республикайрин ГалкӀ , 5 2 Эрменистан , 6 2 Шри-Ланка , 7 2 Чувуд чӀал , 8 2 Китай чIал , 9 2 Туьрк чIал , 10 2 ТӀаратӀ , 11 2 Кьиблепатан Америка , 12 2 Къавкъаз , 13 1 Кьилин ччин

jun 2011: 1 4 Океания , 2 3 Эрменистан , 3 3 Крокодилар , 4 2 Кьилин ччин , 5 2 Юпитер , 6 2 Китайдин Халкьдин Республика , 7 2 Уганда , 8 2 Цифраяр , 9 2 Немец чIал , 10 2 Макао , 11 2 Лезгияр , 12 2 Лезгистан , 13 2 Къарагъанда , 14 2 Канада , 15 2 Кьиблепатан Америка , 16 1 НуькI

jul 2011: 1 4 Германия , 2 3 Европадин гьукуматар , 3 3 Греция , 4 2 Гьил , 5 2 Саха чӀал , 6 2 Саха Республика , 7 2 Мегьарамдхуьр , 8 2 Лезгистан , 9 2 Къазакъстан , 10 1 Кьилин ччин

ago 2011: 1 3 НуькI , 2 3 Кьилин ччин , 3 3 Чурчул , 4 3 Хуьшрекандиз ухшар маймун , 5 3 Супик чӀал , 6 3 Саваннадин фил , 7 3 Наукандин юпик чӀал , 8 3 Мирикина , 9 3 Латин чIал , 10 3 Кьвевар , 11 3 Ибериядин сувайрин чурчул , 12 3 ГъвечӀи панда , 13 3 Гну , 14 3 Арабрин Садхьанвай Эмиратар , 15 3 Атна чӀал , 16 3 Аляскадин юпик чӀал , 17 3 Алеут чӀал , 18 2 Яру бубал , 19 2 Юпик чӀалар , 20 2 Эяк чӀал , 21 2 Эскимос-алеут чӀалар , 22 2 Экуь вили антилопа , 23 2 Чувуд чӀал , 24 2 Чевакдин чупик чӀал , 25 2 Чапла Канададин инуит чӀал

set 2011: 1 4 Туьркиядин лезги хуьрер , 2 3 Кьилин ччин , 3 3 Шергир , 4 3 Чинеруг , 5 3 Химия , 6 3 Туьтуьнуькl , 7 3 Хундуз , 8 3 Ортажа , 9 3 Лезги кхьинар , 10 3 Къванцин цуцӀул , 11 3 Йайлакёй , 12 3 ЦуцӀул-балугъчи , 13 3 Дагъустан , 14 3 Гьатем ага ЧӀакарви , 15 3 Гиенадал ухшар кицӀ , 16 3 География , 17 3 Ахцегь , 18 2 НуькI , 19 2 Яру жанавур , 20 2 Юсуф ал-Лезги , 21 2 МичIи куьрен кард , 22 2 Шахин , 23 2 Шангъар , 24 2 Чалагъан , 25 2 ЧIехибритания

out 2011: 1 3 Кьилин ччин , 2 3 Топонимика , 3 3 Сатурн , 4 2 Чил (планета) , 5 2 Гьил , 6 2 Хашпара дин , 7 2 Футбол , 8 2 Теннис , 9 2 Урусат , 10 2 Мегьарамдхуьруьн район

nov 2011: 1 4 Рутул район , 2 4 Лезгистан , 3 3 Кьилин ччин , 4 3 Яру жанавур , 5 3 Финн чӀал , 6 3 Гъуьгъвезар , 7 3 Ахцегь , 8 3 Антилопа , 9 2 Цуругъ , 10 2 Гьил , 11 2 Хуьшрекандиз ухшар маймун , 12 2 Хуьшрекан хьтин маймун , 13 2 УсухвацI , 14 2 Урус чIал , 15 2 Урбис , 16 2 Туьрк чIал , 17 2 Топонимика , 18 2 Смугъулар (Ахцегь район) , 19 2 Ситатунга , 20 2 СикӀер , 21 2 Планета , 22 2 Пирал , 23 2 Осло , 24 2 Орхидея , 25 2 Муьгъверган

dez 2011: 1 3 Франция , 2 3 Къуйсун , 3 3 Имарат Къавкъаз , 4 2 Кьилин ччин , 5 2 Туьркменистан , 6 2 Суварин цӀиргъ , 7 2 Кеферпатан МуркIарин океан , 8 2 Монако , 9 2 Марсельеза , 10 2 Люксембург , 11 2 Индиядин океан , 12 1 НуькI

jan 2012: 1 4 Тай чӀал , 2 3 Мукьтадир , 3 2 Кьилин ччин , 4 2 Усугъчай , 5 2 Советрин Социализмдин Республикайрин ГалкӀ

fev 2012: 1 4 Кьилин ччин , 2 3 Гьажи Мегьамед Эфенди Штулви , 3 2 Мукьтадир , 4 2 Луткун , 5 2 Википедия

mar 2012: 1 13 Кьилин ччин , 2 10 Лезгияр , 3 8 Азербайжан , 4 7 Лезгистан , 5 7 Къуба , 6 7 Ингъушар , 7 7 Баку , 8 6 Урусат , 9 6 Къазакъстан , 10 6 Ахцегь район , 11 5 Эрменистан , 12 5 Европадин гьукуматар , 13 5 Советрин Социализмдин Республикайрин ГалкӀ , 14 5 ТӀаратӀ , 15 5 Лезгийрин тарих , 16 5 Кьиблепатан Америка , 17 5 Инглис чIал , 18 5 Заира Аминова , 19 5 Дагъустан , 20 5 Ахцегь , 21 5 Антарктида , 22 5 Али Султан , 23 4 Табасаранар , 24 4 Урусар , 25 4 ЦIийи Дуьнья

abr 2012: 1 6 Кьилин ччин , 2 6 Лезгияр , 3 5 Христофор Колумб , 4 5 Дуьньядин кьведлагьай дяве , 5 5 Польша , 6 5 Агъул район , 7 5 Рейн , 8 5 Литва , 9 5 Сауди Арабистан , 10 5 Пакистан , 11 5 Лезги чIал , 12 5 Азербайжан , 13 4 Исламабад , 14 4 Философия , 15 4 Боливия , 16 4 Пакистандин пайдах , 17 4 Мегьамед Мегьамедан хва Гьажиев , 18 4 Италия , 19 4 Лезги Википедия , 20 4 Сара Бернар , 21 4 ЦӀийи гафарин сиягь , 22 4 Грекрин алфавит , 23 4 Тегьран , 24 4 Урусар , 25 4 Кореядин Халкьдинни-Демократиядин Республика

mai 2012: 1 5 Португалия , 2 5 Мисри , 3 5 Ахцегь , 4 4 Каир , 5 4 Puzzling World , 6 4 Владимир Владимирович Путин , 7 4 Falco vespertinus , 8 4 I Наполеон Бонапарт , 9 4 Трпиня , 10 4 Кьилин ччин , 11 4 Италия , 12 4 Дунай , 13 4 Гъед (гьайванар) , 14 3 Абдул Мажид , 15 3 Португал чIал , 16 3 Колибри , 17 3 Дуэро , 18 3 Португалиядин шегьерар , 19 3 Альберт Эйнштейн , 20 3 Кьибле-Африкадин Республика , 21 3 Улуб , 22 3 Мастурбация , 23 3 Яру улуб , 24 3 Астероид , 25 3 Динозавраяр

jun 2012: 1 7 Мугьаммад , 2 6 Византий империя , 3 5 Исаак Ньютон , 4 5 Аллагьдин 99 тӀвар , 5 5 Алюминий , 6 5 Урусат , 7 4 Аврил Лавин , 8 4 Гелхен , 9 4 Химиядин элементрин девирдин система , 10 4 Шахматар , 11 4 Осман империя , 12 4 Византиядин императоррин сиягь , 13 4 Республика Корея , 14 4 The Macallan , 15 4 Суван Къарабагъ , 16 4 Китайдин Халкьдин Республика , 17 4 Финн чӀал , 18 4 Ахцегь , 19 4 Айдагьо , 20 3 Брест , 21 3 Вольфганг Амадеус Моцарт , 22 3 Математика , 23 3 Бубуяр , 24 3 Сятдин чӀул , 25 3 Гьукуматдин идара авунин тегьер

jul 2012: 1 4 Санкт-Петербург , 2 4 ЧӀехи Француз инкъилаб , 3 4 Рим империя , 4 4 Куба , 5 3 Дуьньядин чими хьун , 6 3 Эсперанто , 7 3 Волга , 8 3 Эрнесто Че Гевара , 9 3 Яд , 10 3 Автомобилдин код , 11 3 Математика , 12 3 Чил (планета) , 13 3 Сев , 14 2 Лелевар , 15 2 Постессив аватвал , 16 2 Археяр , 17 2 Биология , 18 2 Дезоксирибонуклеин цуруцӀ , 19 2 Велс , 20 2 Садхьанвай миллетрин тешкилат , 21 2 Че Гевара , 22 2 Расим Загьирбег хва Тагирбеков , 23 2 Рахазвайбурун кьадардиз килигна чӀаларин сиягь , 24 2 Автомобил код , 25 2 Почтунин индекс

ago 2012: 1 7 Лезгистан , 2 5 Олимпиядин къугъунар , 3 4 Рим , 4 3 КӀамс , 5 3 Сочи , 6 3 Биология , 7 3 Грекрин алфавит , 8 2 Экваториал Гвинея , 9 2 Чарльз Дарвин , 10 2 Искандер Македонжув , 11 2 The Beatles , 12 2 Иосиф Виссарионович Сталин , 13 2 Сингапур , 14 2 Гуржи чIал , 15 2 Хунзах район , 16 2 2012 Гатун Олимпия къугъунар , 17 2 Велс , 18 2 Эсперанто , 19 2 Куба , 20 2 Португалия , 21 2 Тегьран , 22 2 Урус чIал , 23 2 Тувалу , 24 2 Лас океан , 25 1 Никlи

set 2012: 1 3 Юлий Цезарь , 2 3 Иерусалим , 3 3 Таиланд , 4 3 Жозе Мария Эса ди Кейруш , 5 3 Ботлих , 6 3 Акуша , 7 3 Алпан , 8 3 Хошимин , 9 3 Кьулан вацI , 10 3 Париж , 11 2 Физика , 12 2 Дегь Мисри , 13 2 ПIатIар , 14 2 Сарфунъял , 15 2 Экология , 16 2 Вунгтау , 17 2 Нячанг , 18 2 Америка , 19 2 Кертагъ Давдакь , 20 2 С , 21 2 Слово (газет, Португалия) , 22 2 Эйсебио , 23 1 Исламабад

out 2012: 1 4 Мадрид , 2 4 Вена , 3 3 Хуьруьн майишат , 4 3 Кефердинни рагъакIидай Англия , 5 3 Ливерпульдин агломерация , 6 3 Неаполь , 7 3 Турин , 8 3 ЦIуру Худат , 9 3 Хурай (КцIар район) , 10 3 Немец чIал , 11 2 Мирземугьаммадхъишлах , 12 2 Эрдэнэт , 13 2 Монгол чӀал , 14 2 Улан-Батор , 15 2 Чархы , 16 2 Жанахир , 17 2 ЧIал , 18 2 Карл Маркс , 19 2 Салвадор Дали , 20 2 Акбар ЧӀехи , 21 2 Гаф , 22 2 Slayer , 23 2 Пекин , 24 2 Къусарчай (Хъачмаз) , 25 2 Гуьнешли

nov 2012: 1 4 Компьютер , 2 4 Садвал , 3 3 Чепер , 4 3 Уран (планета) , 5 3 Каракорум (шегьер) , 6 3 Куритиба , 7 3 Гилияр , 8 3 Водород , 9 3 Грар , 10 3 Магьачкъала , 11 3 Дербент район , 12 2 Людвиг ван Бетховен , 13 2 Ӄ , 14 2 Дагъустандин ЦIаяр , 15 2 Дагъустандин шегьерар , 16 2 Ыгыл , 17 2 1930 йис , 18 2 Мичегь , 19 2 Калук , 20 2 Приморск (Дагъустан) , 21 2 Венесуэла , 22 2 КьепIир Къазмаяр , 23 2 Хуьлуьхъ , 24 2 ПIатIар , 25 2 Рим

dez 2012: 1 3 Кьулан СтIал , 2 3 Къайи дяве , 3 3 Вепс чӀал , 4 3 Пудлагьай рейх , 5 3 Велс , 6 3 Астероид , 7 3 Ле Корбюзье , 8 2 Камарван , 9 2 Пиперхуьр , 10 2 КIахцугъ , 11 2 Герейханован совхоздин 2-лагьай отделение , 12 2 Зари , 13 2 Алкьвадар , 14 2 Усур , 15 2 Хашпересрин финар , 16 2 Вьетнамдин дяве , 17 2 1930 йис , 18 2 Сарфунъял , 19 2 Усугъчай , 20 2 Туьркер-Месхетинар , 21 2 ТӀиб , 22 2 Марс , 23 2 Кьасумхуьр , 24 1 Пак тир Рим империя

jan 2013: 1 3 Индуизм , 2 3 Лезгияр , 3 2 Вашингтон (кьилин шегьер) , 4 2 Ахвах район , 5 2 Акуша район , 6 2 1812 йис , 7 2 1866 йис , 8 2 1878 йис , 9 2 1969 йис , 10 2 Вини СтIал , 11 2 , 12 2 Пак тир Рим империя , 13 2 Компьютер , 14 2 Велиханрин Къудрат Кибечханан хва , 15 2 Волга , 16 2 Мугьаммад , 17 2 ЧӀулав тӀеквен , 18 2 Сампи , 19 2 Промышленность , 20 2 2012 йис , 21 2 Рейн , 22 2 Пси (гьарф) , 23 2 Фи , 24 2 Ипсилон , 25 2 Тау

fev 2013: 1 2 Фридрих Ницше , 2 2 Бум , 3 2 Къарасу , 4 2 Къарадейн , 5 2 Кичик ПIирали , 6 2 Курд (Кьвепеле) , 7 2 Кветуьклуь , 8 2 Имамлы , 9 2 Зергерли , 10 2 Зараган , 11 2 Залам , 12 2 Жигъателли , 13 2 Жорлу , 14 2 Енгиже

mar 2013: 1 3 1949 йис , 2 3 1969 йис , 3 3 Турция , 4 3 Айдагьо , 5 3 Абхазия , 6 2 Дегь Греция , 7 2 Валенсия (мана) , 8 2 Илим , 9 2 АСШ-дин граждан дяве , 10 2 Гарринча , 11 2 ЧӀулав хъалхъам , 12 2 Элвис Пресли , 13 2 Байуба , 14 2 Дунчэн (Пекин) , 15 2 Садхьанвай миллетрин тешкилат , 16 2 Каир , 17 2 ЧӀулав тӀеквен , 18 2 Лекь (анатомия) , 19 2 Яру жанавур , 20 2 Февраль , 21 2 Китайдин Халкьдин Республика , 22 2 Июль , 23 2 Лас океан , 24 2 Август , 25 2 Некхъвадайбур

abr 2013: 1 5 Амстердам , 2 3 Гонконг , 3 3 Октавиан Август , 4 3 Плазма , 5 3 Ракь , 6 3 Рио-де-Жанейро , 7 3 Метр , 8 3 Буэнос-Айрес , 9 3 Иерусалим , 10 3 Дагъустан , 11 2 Умар Хайям , 12 2 Сувар (ансамбль) , 13 2 Керимрин Седакъет Къайинбеган руш , 14 2 Метаболизм , 15 2 Кизилюрт , 16 2 Михаил Лезгинцев , 17 2 Атом , 18 2 Гьуьсейнов Абдусалам Абдулкериман хва , 19 2 Барселона (мана) , 20 2 Агъдам район , 21 2 Нежефхуьр , 22 2 Ахцегьрин гьамамар , 23 2 Грар , 24 2 Юсуф ал-Лезги , 25 2 Эфиопидин чъакъал

mai 2013: 1 3 Франция , 2 2 Москва вилаят , 3 2 Альгеро , 4 2 Алпан (манаяр) , 5 2 Алпан (астрономия)

jun 2013: 1 3 Марко Поло , 2 3 Демократия , 3 3 Фу , 4 2 Мидгьед Ширинбегов , 5 2 Иисусан гьакъикъи клиса , 6 2 Александр Ильич Рыбников , 7 2 Кьавал , 8 2 Агъул чIал , 9 2 Хвереж (Кьурагь район) , 10 2 Усугъ , 11 2 Вулкан (геология) , 12 2 Абилов Магьмуд Абдулрзадин хва , 13 2 Митаги хуьруьнсовет , 14 2 Хазар хуьруьнсовет , 15 1 Кьилерин хуьруьнсовет

jul 2013: 1 2 Хъачмаз район , 2 1 Зигмунд Фрейд

ago 2013: 1 3 Католицизм , 2 3 Чингисхан , 3 3 Винстон Черчилль , 4 2 Урусатдин тӀаратӀ , 5 2 Табасаран чIал , 6 2 Дагъустандин тIаратI , 7 2 Гоа (Дагъустан) , 8 2 Мыгра (Дагъустан) , 9 2 Кина (Дагъустан) , 10 2 Британиядин империя , 11 2 Вини Катрух , 12 2 Автомобиль , 13 2 Марко Поло , 14 2 Агъул чIал , 15 2 ЧIал , 16 2 Вини ЦIийихуьр , 17 2 Христофор Колумб , 18 2 ТӀаратӀ , 19 2 Лезги чIал , 20 2 Кьвевар , 21 1 Будугъ чIал

set 2013: 1 3 Авраам Линкольн , 2 3 КъирицI чIал , 3 2 Чилин зурзунар , 4 2 Хинелугъ чIал , 5 2 Нидерландар , 6 2 Китайдин Халкьдин Республика , 7 2 Саха Республика , 8 1 ЦIуру Киркар

out 2013: 1 3 Лезгияр , 2 2 Холокост , 3 2 Хамаматюрт , 4 2 Адиль-Янгиюрт , 5 2 Бабаюрт , 6 2 Чилин зурзунар , 7 2 Табасаранар , 8 1 ЧӀутрацуьк

nov 2013: 1 3 Аристотель , 2 3 Бактерияр , 3 2 Ингушетия , 4 2 UTC+4 , 5 2 Терек , 6 2 Хуьр , 7 2 Шегьер , 8 2 АхцегьвацӀ , 9 2 Мустафа Камал Ататуьрк , 10 1 Муниципал район

dez 2013: 1 3 КуртӀухъан , 2 3 Атлантик океан , 3 3 Харахуба , 4 2 Пепеяр , 5 2 Малярия , 6 1 Тарих

jan 2014: 1 3 Мирослава Вавринец , 2 3 Роджер Федерер , 3 3 Валентина Васильевна Толкунова , 4 3 Кьвепеле , 5 2 Затор , 6 2 Бойнице , 7 2 Куколивка

fev 2014: 1 3 Шахматар , 2 2 Сан-Паулу , 3 2 Гуржистан , 4 2 Абхазия , 5 1 Славян чIалар

mar 2014: 1 3 Поляк чIал , 2 3 Словак чIал , 3 3 Чех чIал , 4 2 Кашуб чIал , 5 1 НАТО

abr 2014: 1 3 Алискерово (посёлок) , 2 2 Тито Виланова , 3 2 Баламирзоев Абдул Гьажибаладин хва , 4 2 Поречье хуьруьнсовет (Тула вилаят) , 5 2 Дубна (Тула вилаят) , 6 2 Фотосинтез , 7 1 Синусоида

mai 2014: 1 3 Грек чӀал , 2 3 Сидней , 3 3 Вичи-вич кьин , 4 3 Сеул , 5 3 Салигьов Эсед Бабастанан хва , 6 3 Верем , 7 2 Metallica , 8 2 Пурни , 9 2 Мумбаи , 10 2 ТӀач , 11 2 Бебелук , 12 2 2014 ХъуьтӀуьн Олимпия къугъунар , 13 2 ЧӀулавкьал , 14 2 ЦӀегьрекарч , 15 2 Словак чIал , 16 1 Лезги литература

jun 2014: 1 2 Фернан Магеллан , 2 2 Цур , 3 2 Геология , 4 2 Етим Эмин , 5 2 Храхуба , 6 2 Гуржи чIал , 7 2 Далдам , 8 1 Инд океан

jul 2014: 1 2 Джяравица , 2 2 Европадин таж , 3 2 Квеста , 4 2 Париж бассейн , 5 1 Ботсвана

ago 2014: 1 3 Робин Уильямс , 2 2 Джульярд мектеб , 3 2 ЦIуьлуьк , 4 2 Хъутур-Куьредин наибвал , 5 1 Аль-Муайдар

set 2014: 1 3 Ио , 2 2 Вилиам Хьайд Волластон , 3 2 Владимир Владимирович Путин , 4 2 Юрий Алексеевич Гагарин , 5 1 Черногориядин шегьерар

out 2014: 1 2 Чай , 2 2 Балтик гьуьлуьн пешекарвилин галкIрин чил , 3 2 Латвия , 4 2 Эстония , 5 2 Братислава , 6 2 Прагьа , 7 1 Кения

nov 2014: 1 2 Анархизм , 2 2 Аргентина , 3 2 Нью-Йорк , 4 1 Амадора

dez 2014: 1 2 Дакка , 2 2 Гьукумат Палестина , 3 1 Къеди

jan 2015: 1 2 Сокольническая цӀар , 2 2 ТупӀалдин цӀар (Москва) , 3 1 Эседуллагь Эмирагъайрин

fev 2015: 1 2 Яргъал тир рагъэкъечӀдайпатан федерал округ , 2 2 Абдусамад Гьамидов , 3 2 Гьарйяна , 4 2 Никола Тесла , 5 2 Халилов Юсиф Мевлуьдан хва , 6 2 Экономика , 7 2 Чингисхан , 8 1 Кьилин мефтӀ

mar 2015: 1 3 Пудлагьай рейх , 2 2 Украинадин вилаятар: абурун ибарат , 3 2 Украинадин административ паюн , 4 2 I Фарнаваз , 5 2 Асалийрин Асали Мугьаммадалидин хва , 6 2 Братислава , 7 2 ЧӀулав гьуьл , 8 2 Украина , 9 2 Уругвай , 10 2 Пакистан , 11 2 Немец чIал , 12 1 Фарнаваз I

abr 2015: 1 3 Грац , 2 3 Лас океан , 3 2 Линц , 4 2 Альфредо Ди Стефано , 5 2 Орёл вилаят , 6 2 Орёл (шегьер) , 7 2 Республика Крым , 8 2 Амстердам , 9 2 Мадрид , 10 2 Лионель Месси , 11 2 Испания , 12 2 Урусат , 13 2 Каспи гьуьл

mai 2015: 1 3 Ингилис Премьер-лига , 2 2 Бути (Чечня) , 3 2 Сократес , 4 2 Церхимахи , 5 2 Линц , 6 2 Кочубей (Дагъустан) , 7 2 Танк , 8 2 Нилтон Сантос , 9 2 Испания , 10 2 Науру , 11 2 Кьасумхуьр , 12 2 Истамбул , 13 2 Инглис чIал , 14 2 Америкадин Садхьанвай Штатар , 15 1 Македония Республикадин шегьерар

jun 2015: 1 2 Инсбрук , 2 2 Ямал-Ненец АО-дин шегьерар , 3 2 Валерий Яковлевич Леонтьев , 4 2 Ханты-Манси АО-дин шегьерар , 5 2 Карелия Республикадин шегьерар , 6 2 Урусатдин шегьеррин сиягь , 7 2 Икрам Сабиран хва Алискеррин , 8 1 СССГ-дин илимрин академия

jul 2015: 1 3 Инсбрук , 2 3 Германиядин империя , 3 2 Александр Сергеян хва Пушкин , 4 2 Стивен Джеррард , 5 2 Гьаштархан вилаятдин шегьерар , 6 2 Исайрин Радик Велединан хва , 7 2 Камчатка крайдин шегьерар , 8 2 Грац , 9 2 Воскресенское (Дубна район) , 10 1 Абдул Мукьтедир Айдинбекан хва

No data on this page have been normalized to 30 day months (as WMF does on certain traffic reports).
Wikipedias are initially ordered by number of speakers of the language

Speakers: Number of speakers of a language is the estimated total of primary and secondary speakers, is in many cases a very rough estimation (based on the page on the English Wikipedia about that language)
Regions are parts of the world where the language is spoken in substantial amounts (compared to total number of speakers). Regions where a language gained presence only by a recent diaspora are generally not included.
Region codes: AF:Africa, AS:Asia, EU:Europe, NA:North America, OC:Oceania, SA:South America, W:World Wide, CL:Constructed Language

Estatísticas geradas em Segunda-feira, 24 de agosto 2015 11:58

Dump file lezwiki-20150805-stub-meta-history.xml.gz (edits only), size 3.9 Mb as gz -> 27 Mb
Dump processed till Jul 31, 2015, on server stat1002, ready at Sat-22/08/2015-02:25 after 24 sec.

Versão do script:2.6
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.