Estatísticas da Wikipédia lezgian

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Articles per size range / Records per namespace / Most edited articles / Zeitgeist

Most metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.

Some metrics have been collected from the full archive dump which runs on lower frequency than the usual monthly cycle.
These metrics are columns F,I,J,K,M,N,O,P,Q,R from the first table.


See also metrics definitions


 
Monthly counts & Quarterly rankings: agosto 2014
 
DataWikipedistasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
Aug 20140%   +2%      +63%      +1%
Jul 20140%   +1%      -23%      +1%
Jun 2014+4%   +2%      -18%      +1%
May 2014+2%   +1%      +77%      +4%
Apr 20140%   0%      +16%      +1%
Mar 20140%   0%      +61%      +1%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P____Q____R____S__
Aug 201457 412,1 k 216,4   288      559
Jul 201457 212,0 k 116,7   177      552
Jun 20145726 2,0 k 116,8   230      549
May 20145516 2,0 k 116,9   281      541
Apr 201454 4 2,0 k  17   159      519
Mar 201454 4 1,9 k  17   137      512
Feb 201454 2 1,9 k1,7 k 17233179%38%858,5 Mb587 k36 k2402,3 k5,4 k507
Jan 2014542611,9 k1,7 k 16,9233379%38%3548,5 Mb584 k36 k2402,2 k5,4 k504
Dec 201352 3 1,9 k1,7 k 16,9233079%38%1448,5 Mb581 k35 k2402,2 k5,4 k501
Nov 201352 4 1,9 k1,7 k116,9232879%38%1728,4 Mb578 k35 k2402,2 k5,4 k500
Oct 2013521311,9 k1,7 k316,9233279%38%5298,4 Mb574 k35 k2432,2 k5,3 k494
Sep 201351 311,8 k1,6 k217,5226578%36%5717,7 Mb533 k32 k3552,2 k4,9 k490
Aug 201351 211,8 k1,6 k517,7218577%33%9047,3 Mb500 k31 k3552,2 k4,6 k484
Jul 201351 2 1,6 k1,4 k118,8207075%29%1586,3 Mb433 k27 k5312,1 k3,9 k449
Jun 201351 311,6 k1,4 k218,9205774%29%6366,1 Mb426 k26 k5342,1 k3,9 k446
May 201351 211,5 k1,3 k219,4199273%27%4125,7 Mb395 k24 k4862,1 k3,5 k434
Apr 201351 521,4 k1,2 k120194272%24%6665,3 Mb370 k23 k4892,1 k3,2 k433
Mar 2013511511,4 k1,2 k 20,1187171%23%2,1 k4,9 Mb346 k22 k1,1 k2,1 k3,0 k418
Feb 201350 321,4 k1,2 k318,7183472%23%1,3 k6,5 Mb337 k21 k67 k2,1 k2,9 k410
Jan 201350 421,3 k1,1 k218,8182570%23%1,7 k6,2 Mb318 k21 k66 k2,1 k2,8 k404
Dec 201250 511,2 k1,1 k218,5180971%22%1,2 k5,9 Mb301 k20 k64 k2,1 k2,6 k393
Nov 2012501711,2 k1,0 k418,5174870%18%1,1 k5,5 Mb276 k18 k63 k2,1 k2,4 k381
Oct 2012492521,1 k946619,3175768%18%1,2 k5,1 Mb254 k17 k61 k1,9 k2,2 k373
Sep 201247 51877746122,3185160%21%1,3 k4,5 Mb220 k15 k58 k1,5 k1,9 k357
Aug 201247162845711121,6178860%20%9794,3 Mb204 k15 k56 k1,5 k1,7 k351
Jul 2012461123823689121167358%18%1,3 k3,9 Mb186 k13 k54 k1,2 k1,6 k329
Jun 2012451133784637220,4145454%17%1,7 k3,4 Mb154 k11 k50 k1,1 k1,4 k304
May 201244193723564219,7123749%15%2,2 k2,9 Mb121 k8,2 k47 k1,0 k1,1 k261
Apr 201243317567050031898444%11%3,1 k2,4 Mb89 k6,2 k42 k790727189
Mar 2012408206568393115,781139%8%2,4 k1,8 Mb61 k3,4 k34 k70834892
Feb 201232141540388 12,180040%8%7091,6 Mb59 k3,2 k28 k68830787
Jan 201231121536386 10,978040%8%2331,4 Mb57 k3,3 k23 k68730683
Dec 201130 41532383110,577239%8%3011,4 Mb56 k3,2 k23 k68430483
Nov 201130371509370110,478941%8%4381,3 Mb55 k3,1 k21 k66430376
Oct 201127 4 489348 9,978440%8%3491,3 Mb52 k2,8 k21 k65029758
Sep 201127410248434549,378740%8%7701,1 Mb52 k2,8 k14 k64931356
Aug 201123610237726959,987643%10%1,1 k954 kb45 k2,4 k12 k53331139
Jul 201117181220166111,973245%8%361537 kb23 k8298,7 k35918713
Jun 201116 51179131212,680451%10%1,2 k487 kb21 k6528,0 k28016412
May 2011163811125719,860327%12%436322 kb9,9 k2967,3 k106299
Apr 20111325 794018,451125%11%157210 kb5,8 k1484,9 k8817
Mar 20111123 613418,360230%15%141201 kb5,3 k1284,9 k7517
Feb 20119   4131 8,983641%22%3169 kb4,9 k1223,7 k56 7
Jan 20119   4031 9,183642%22%3167 kb4,9 k1223,7 k56 7
Dec 2010912 4031 983642%22%77167 kb4,9 k1223,7 k56 7
Nov 20108   4023 7131138%22% 130 kb7,8 k1219195922
Oct 2010812 4023 7131138%22%36130 kb7,8 k1219195922
Sep 2010711 372216,6145741%19%113128 kb7,6 k1219186322
Aug 2010622 1918 7103163%26%5866 kb2,9 k12089457 1
Jul 20104   65 12,585750%33%415 kb956151334 1
Jun 20104   65 11,885750%33% 15 kb956151334 1
May 20104   65 11,885750%33%415 kb956151334 1
Apr 20104   65 11,285750%33% 15 kb956151334 1
Mar 20104   65 11,285750%33% 15 kb956151334 1
Feb 20104   65 11,285750%33% 15 kb956151334 1
Jan 20104   65 11,285750%33%315 kb956151334 1
Dec 20094   65 10,785750%33% 15 kb956151294 1
Nov 20094   65 10,785750%33% 15 kb956151294 1
Oct 20094   65 10,785750%33% 15 kb956151294 1
Sep 20094   65 10,785750%33% 15 kb956151294 1
Aug 20094   65 10,785750%33% 15 kb956151294 1
Jul 20094   65 10,785750%33%115 kb956151294 1
Jun 20094   65 10,585750%33% 14 kb95615184 1
May 20094   65 10,585750%33% 14 kb95615184 1
Apr 20094   65 10,585750%33% 14 kb95615184 1
Mar 20094   65 10,585750%33% 14 kb95615184 1
Feb 20094   65 10,585750%33% 14 kb95615184 1
Jan 20094   65 10,585750%33% 14 kb95615184 1
Dec 2008411 65 10,585750%33%1114 kb95615184 1
Nov 20083   65 8,782650%33%112 kb9261183 1
Oct 20083   65 8,582550%33% 12 kb9231183 1
Sep 20083   65 8,582550%33% 12 kb9231183 1
Aug 20083   65 8,582550%33% 12 kb9231183 1
Jul 20083   65 8,582550%33% 12 kb9231183 1
Jun 20083   65 8,582550%33% 12 kb9231183 1
May 20083   65 8,582550%33%712 kb9231183 1
Apr 20083   65 7,382550%33%412 kb9231183 1
Mar 20083   65 6,781350%33%712 kb9071183 1
Feb 20083   44 8,21615100%75% 19 kb1,3 k6921111
Jan 2008311 44 8,21615100%75%719 kb1,3 k6921111
Dec 2007211 42 6,5145450%50%1818 kb7626629 1
Nov 20071   11 82920100%100%65,9 kb3476328  
Oct 200711  1  242  2104 6     
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
The following table ranks this project in relation to projects in other languages with 1000+ articles
Jul 2014156 171137196 154166   156      251
Apr 2014163 138 195  162   164      251
Jan 2014160114120144194179161166506927141146160155206138133251
Oct 2013161147158128194179104168486827109147158155213137133251
Jul 2013158140173135204184156157617751158154171169190136139251
Apr 2013158148128107204184159149708664141161175174199136143251
Jan 2013157149137103205184120158728669154181179173201139142251
Oct 201215710812210221118985149789490171189184178203139150251
Jul 20121581378892215200153212211211210165199191181205153159251
Apr 2012156877875218206106210209209207109211211208214167184251
Jan 2012181148175137220213152209208208206228225224223225176207251
Oct 2011187148142142222214159208207207205222223223228225175206251
Jul 201121914599138235228161205204204202223235231234238195214251
Apr 201122799128132247240156201200200198232244244246244230249251
Jan 2011235151223136250243158200199199197250247246246246241249251
Oct 2010238147172129250245154194193193191247246238246249234248251
Jul 2010249161223142250249160188187187185250249249249249248249251
Apr 2010249153211136250248159185184184183250249249249249246249251
Jan 2010246147204131249248155183183183182245250250249249246250251
Oct 2009246144209135249248159180180180179247250250249249245250251
Jul 2009244193203132248246151173173173172245247247248248246247251
Apr 2009244139202144247246148171171171170246247247248248246245251
Jan 2009243131207132247245151165165165164249247247247247246246251
Oct 2008242138200129246242145159159159158246245245245246245246250
Jul 2008239153205133243239149153153153151244242242242244241245249
Apr 2008236150209131242239153148148147145243241239242244240243249
Jan 2008234141201134239236155143143142141237238234229240228238246
Oct 2007239137199132242240148141141139139237243241241237233234244
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
 WikipedistasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikipedistas (usuários registrados)
A = Wikipedistas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikipedistas que editaram pelo menos dez vezes desde que chegaram
C = Wikipedistas que contribuíram cinco vezes ou mais este mês
D = Wikipedistas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Artigos que contêm pelo menos uma ligação interna e 200 caracteres de texto legível, não contando códigos wiki e html,
      ligações ocultas, etc.; títulos também não contam (outras colunas são baseadas no método oficial de contagem)
G = Novos artigos por dia no mês passado
H = Número médio de revisões por artigo
I = Tamanho médio dos artigos em bytes
J = Porcentagem de artigos com pelo menos 0,5 kb de texto legível (veja F)
K = Porcentagem de artigos com pelo menos 2 kb de texto legível (veja F)

Base de dados
L = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
M = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
N = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
O = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
P = Total de ligações para outras wikipédias
Q = Total de imagens apresentadas
R = Total de ligações para outros sítios
S = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  5  10  100  1000  1  3  5  10  25  100  1  3  5  10  25  100  250  5  10  100 
Monthly counts for recent history of wiki
Aug 2014944421  11  41     94433  22 
Jul 2014922211      1      43221  22 
Jun 201496652  11  32     42111  22 
May 2014176663      3221   95322  22 
Apr 2014115432  1   221    92221  21 
Mar 2014134442  11  421    6111   22 
Feb 201415222       321    8211   22 
Jan 20141286431  11  321    7322   32 
Dec 2013114332  11  622    82111  11 
Nov 2013115433  11  5211   132221  11 
Oct 20139432111 21  62     733211111 
Sep 20139332211     53     933321 22 
Aug 20134322211 2   53211  8222221431
Jul 201342222      31     932211 33 
Jun 20137332211 1   8521   833222 32 
May 20136222111 11  531    112222  21 
Apr 201313555321 33  4443   1133322 541
Mar 201314652211 7611102211  2064221 541
Feb 2013933222  1063 6221   843221 971
Jan 201315543221 1363 6322   1133321 961
Dec 201211554211 1282 9443   1364221 86 
Nov 201213777211 10102 108541  2398431 86 
Oct 201211655321 862 74321  1254321 851
Sep 201212554211 983 95321  14732211761
Aug 201219146522  862 103222  2175222 631
Jul 2012181212853  872 1711842  2414141031 771
Jun 201224151311631 1171 11119641 21996511641
May 2012211298633 971 1698442 251195421641
Apr 201232211710754 971 341914853 582413774143 
Mar 2012292020141062 661 34171495  6126221694 22 
Feb 20121144411  111 1      2      11 
Jan 2012742221      1      1         
Quarterly counts for entire history of wiki
Jul 2014922211      1      43221  22 
Apr 2014115432  1   221    92221  21 
Jan 20141286431  11  321    7322   32 
Oct 20139432111 21  62     733211111 
Jul 201342222      31     932211 33 
Apr 201313555321 33  4443   1133322 541
Jan 201315543221 1363 6322   1133321 961
Oct 201211655321 862 74321  1254321 851
Jul 2012181212853  872 1711842  2414141031 771
Apr 201232211710754 971 341914853 582413774143 
Jan 2012742221      1      1         
Oct 201185441  111        11111  11 
Jul 201110884111     322    421111    
Apr 201165551      1      1         
Jan 2011                           
Oct 20103221              2111      
Jul 2010                           
Apr 2010                 2         
Jan 2010                           
Oct 2009                           
Jul 20091                          
Apr 2009                           
Jan 2009                 1         
Oct 2008                           
Jul 2008                 2         
Apr 200811                         
Jan 2008111                         
Oct 20072                          

 

Distribuição de edições de artigos por wikipedistas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikipedistasEdições total
1226100.0%22,897100.0%
38537.6%22,71699.2%
105725.2%22,55898.5%
323113.7%22,09696.5%
100177.5%21,48593.8%
316114.9%20,70290.4%
100052.2%17,43376.1%
316220.9%11,57550.6%

 

8 wikipedistas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdições 
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
 agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
Aslan4ikUC1 07,2971632,46627Jan 21, 20129521,01740--
Soul TrainUC2 04,278155,64929Mar 28, 2012885971--
MugerganetsUC9+1566626934Oct 13, 2012686776--
RotlinkUC32+172915--Aug 04, 2013391----
Faolin42UC70+15622-Feb 01, 2014210----
Dogad75UC116+10021--May 13, 2014109----
HalavarUC225...11--Aug 03, 201427----
КочубеецUC226...11--Aug 24, 2014611--

 

20 wikipedistas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
  Primeira ediçãoúltima edição
 posiçãototaldatadias
atrás
datadias
atrás
Namik555UC32,782Mar 07, 20111272Apr 21, 2012861
MigraghviUC41,573Aug 31, 20111095Jun 15, 201476
LezgistxaUC51,503Sep 20, 20111075Jun 01, 2012820
SPQRobinUC6635Mar 27, 2012886Mar 27, 2012886
Tamara UstinovaUC7590Nov 14, 20111020Dec 04, 2013269
User from DagUC8583Aug 17, 20101474Jul 11, 201450
KmoksyUC10511Aug 11, 20111115Jan 27, 2013580
Saint JohannUC11384Mar 28, 2012885Oct 15, 2012684
Cekli829UC12178Mar 10, 20111269May 17, 2014105
MaqiviUC13155Oct 07, 20111058Sep 03, 2013361
U.SteeleUC14125Aug 02, 20111124Mar 31, 2012882
LezgiUC15116Apr 27, 20111221Jun 02, 2012819
МаликумUC16106Feb 07, 2012935Mar 22, 2014161
HydrizUC17103Jan 30, 2014212Jan 30, 2014212
NessajaUC1890Apr 25, 2012857May 17, 2014105
91i79UC1954Mar 27, 2012886Apr 04, 2012878
Master ShadowUC2053Oct 12, 20101418Dec 14, 20101355
FsFUC2148Jul 26, 2012765Jul 29, 2012762
KaiyrUC2245Aug 30, 20101461Sep 02, 20111093
Midnight GreenUC2344Jul 30, 20111127Apr 22, 2012860

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 1.553 edições foram feitas por usuários anônimos, de um total de 34.103 edições ( 4e %)
  


41 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições 
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
 datadias
atrás
datadias
atrás
MerlIwBotUC12,612May 27, 20111191Aug 09, 2013386--
EmausBotUC21,646Apr 16, 2012866Nov 09, 2013294--
AddbotUC31,475Mar 07, 2013541Aug 16, 2013379--
XqbotUC41,024Apr 16, 2012866Mar 06, 2013542--
JackieBotUC5890Apr 26, 2012856Aug 13, 201417--
AvocatoBotUC6446Mar 29, 2012884Jul 07, 2012784--
GerakibotUC7326May 24, 2012828Mar 06, 2013542--
RedBotUC8171Apr 22, 2012860Aug 21, 2012739--
Makecat-botUC9150Nov 01, 2012667Mar 03, 2013545--
LegobotUC10107Mar 11, 2013537Apr 02, 2013515--
Idioma-botUC1197Mar 27, 2012886Mar 04, 2013544--
Justincheng12345-botUC1289Jun 25, 2012796Jan 10, 2013597--
YFdyh-botUC1363Jul 01, 2012790Feb 18, 2013558--
LaaknorBotUC1462May 22, 2012830Mar 05, 2013543--
JhsBotUC1555Mar 28, 2012885Jul 08, 2012783--
EscarbotUC1647Apr 03, 2012879Oct 16, 2012683--
VolkovBotUC1746Apr 28, 2012854Feb 27, 2013549--
KamikazeBotUC1845Mar 29, 2012884Jan 24, 2013583--
JAnDbotUC1941Mar 29, 2012884Jul 02, 2013424--
AvicBotUC2040Jun 01, 2012820Dec 09, 2012629--
CarsracBotUC2135Mar 31, 2012882Feb 12, 2013564--
HiW-BotUC2229Apr 07, 2012875Oct 18, 2012681--
VagobotUC2322Mar 29, 2012884Apr 30, 2012852--
SantoshBotUC2422Oct 21, 2012678Jan 31, 2013576--
SynthebotUC2521Sep 20, 2012709Jan 25, 2013582--
タチコマ robotUC2614Oct 20, 2012679Oct 21, 2012678--
PixelBotUC2713Jul 20, 2012771Mar 06, 2013542--
JotterbotUC2812Jan 15, 2013592Jan 18, 2013589--
CommonsDelinkerUC298Apr 26, 20111222Mar 04, 2012909--
Crochet.david.botUC307May 07, 20082306May 07, 20082306--
RobbotUC316May 07, 2012845Jan 02, 2013605--
CocuBotUC325Aug 26, 2012734Dec 15, 2012623--
NjardarBotUC334Aug 28, 2012732Aug 31, 2012729--
OctraBotUC343May 12, 2014110May 12, 2014110--
SassoBotUC352May 29, 2012823Jan 07, 2013600--
ObersachsebotUC362Nov 24, 2012644Jan 08, 2013599--
DragonBotUC372Jan 13, 2013594Jan 14, 2013593--
MalarzBOTUC381Aug 18, 2012742Aug 18, 2012742--
GhalyBotUC391Jan 18, 2013589Jan 18, 2013589--
SAMI.BotUC401Feb 05, 2013571Feb 05, 2013571--
MastiBotUC411Mar 01, 2013547Mar 01, 2013547--

 

Artigos que contêm pelo menos uma ligação interna e .. caracteres de texto legível, não contando códigos wiki e html,
ligações ocultas, etc.; títulos também não contam  (excluindo páginas de redirecionamento)

DataArtigos
 < 32 ch< 64 ch< 128 ch< 256 ch< 512 ch< 1 k ch< 2 k ch< 4 k ch< 8 k ch< 16 k ch< 32 k ch< 64 k ch

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110JpgOggPngSvgWebm
Aug 20142,6 k401771121361,2 k 1,0 k       991741
Jul 20142,6 k396761121361,2 k 998       991741
Jun 20142,6 k395751121361,1 k 996       991741
May 20142,5 k395741121341,1 k 989       991741
Apr 20142,5 k391711111311,1 k 982       991731
Mar 20142,5 k387691111311,1 k 981       991731
Feb 20142,4 k384681101291,1 k 979      53991631
Jan 20142,4 k378671101291,1 k 976      210991631
Dec 20132,4 k367651101281,1 k 972      113991631
Nov 20132,4 k365641101161,1 k 960      138991631
Oct 20132,4 k356631101161,1 k 953      445991631
Sep 20132,3 k35062921161,1 k 934      552831431
Aug 20132,2 k32958901161,1 k 914      877811431
Jul 20132,0 k32553861071,0 k 855      13678 431
Jun 20132,0 k32252861031,0 k 837      60278 431
May 20131,9 k317506998992 778      37861 431
Apr 20131,9 k311496798983 760      59059 431
Mar 20131,8 k302484995946 728      44143 321
Feb 20131,8 k281454695934 713      39042 211
Jan 20131,7 k270434487920 687      92941 111
Dec 20121,6 k262414087888 662      58238 11 
Nov 20121,6 k250392487858 643      50622 11 
Oct 20121,5 k23537486812 638      6502 11 
Sep 20121,2 k23035482787 620      4172 11 
Aug 20121,2 k21934477722 548      4582 11 
Jul 20121,2 k20729370673 530      6512 1  
Jun 20121,1 k19428367618 493      11022 1  
May 201298416819265545 422      16072    
Apr 201285914912149293 255      25381    
Mar 2012660723 3134 91      1934     
Feb 2012627    97 69      231     
Jan 2012619    95 69      222     
Dec 2011615    95 68      275     
Nov 2011585    88 62      432     
Oct 2011547    86 50      144     
Sep 2011540    83 46      757     
Aug 2011416    77 29      1092     
Jul 2011233    66 15      351     
Jun 2011191    47 12      1135     
May 2011121    11 7      360     
Apr 201186    10 6      120     
Mar 201168    10 3      114     
Feb 201148    10 3      3     
Jan 201147    10 3            
Dec 201047    10 3      76     
Nov 201042    10 3            
Oct 201042    10 3      25     
Sep 201039    6 3      27     
Aug 201020    6 3      58     
Jul 20107    6 3            
Jun 20107    6 3            
May 20107    6 3            
Apr 20107    6 3            
Mar 20107    5 3            
Feb 20107    5 3            
Jan 20107    5 3            
Dec 20097    5 3            
Nov 20097    5 3            
Oct 20097    5 3            
Sep 20097    5 3            
Aug 20097    5 3            
Jul 20097    5 3      1     
Jun 20097    5 3            
May 20097    5 3            
Apr 20097    5 3            
Mar 20097    5 3            
Feb 20097    5 3            
Jan 20097    5 3            
Dec 20087    5 3      11     
Nov 20087    2              
Oct 20087    2              
Sep 20087    2              
Aug 20087    2              
Jul 20087    2              
Jun 20087    2              
May 20087    2              
Apr 20087    2              
Mar 20087    2              
Feb 20085    1              
Jan 20085    1              
Dec 20075    1              
Nov 20071    1              
Oct 20071    1              

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

Oct 2007: 1 2 Кьилин ччин

Nov 2007: 1 2 Кьилин ччин

Dec 2007: 1 2 Кьилин ччин

Jan 2008: 1 1 Кьилин ччин

Mar 2008: 1 2 Википедия , 2 1 Кьилин ччин

Apr 2008: 1 1 Кьилин ччин

Nov 2008: 1 1 Кьилин ччин

Dec 2008: 1 1 Кьилин ччин

Jul 2009: 1 1 Кьилин ччин

Aug 2010: 1 3 Урусат , 2 3 Кьвевар , 3 3 Дагъустан , 4 2 Кьилин ччин , 5 2 Футбол

Sep 2010: 1 2 Кьилин ччин , 2 2 Лезги кхьинар , 3 2 Андорра

Oct 2010: 1 2 Шри-Ланка , 2 2 Африка

Dec 2010: 1 3 Баку , 2 2 Шри-Ланка , 3 2 ЦӀийи Зеландия , 4 2 Футбол , 5 2 Талибан , 6 2 СтIал Сулейман , 7 2 Урусат , 8 2 Пакистан , 9 2 Лезгистан , 10 2 Лезги , 11 2 Къазакъстан

Feb 2011: 1 1 Кьилин ччин

Mar 2011: 1 3 Эрменистан , 2 3 Азербайжан , 3 2 Чувудар , 4 2 Париж , 5 2 Нил , 6 2 Гьайванар , 7 2 Лезгияр , 8 2 Гибралтар , 9 1 НуькI

Apr 2011: 1 4 Кьилин ччин , 2 4 КцӀар , 3 3 Къазакъстан , 4 3 Ирландия , 5 2 Шри-Ланка , 6 2 Лезгистан , 7 2 Лезги чIал , 8 2 Лам

May 2011: 1 5 ЧIехибритания , 2 5 Азия , 3 4 Лезгистан , 4 3 Совет Социалист Республикайрин ГалкӀ , 5 2 Эрменистан , 6 2 Шри-Ланка , 7 2 Чувуд чӀал , 8 2 Китай чIал , 9 2 Туьрк чIал , 10 2 ТӀаратӀ , 11 2 Кьиблепатан Америка , 12 2 Къавкъаз , 13 1 Кьилин ччин

Jun 2011: 1 4 Океания , 2 3 Эрменистан , 3 3 Крокодилар , 4 2 Кьилин ччин , 5 2 Юпитер , 6 2 Китайдин Халкьдин Республика , 7 2 Уганда , 8 2 Цифраяр , 9 2 Немец чIал , 10 2 Макао , 11 2 Лезгияр , 12 2 Лезгистан , 13 2 Къарагъанда , 14 2 Канада , 15 2 Кьиблепатан Америка , 16 1 НуькI

Jul 2011: 1 4 Германия , 2 3 Европадин гьукуматар , 3 3 Греция , 4 2 Хьилер , 5 2 Саха чӀал , 6 2 Саха Республика , 7 2 Мегьарамдхуьр , 8 2 Лезгистан , 9 2 Къазакъстан , 10 1 Кьилин ччин

Aug 2011: 1 3 НуькI , 2 3 Кьилин ччин , 3 3 Чурчул , 4 3 Хуьшрекандиз ухшар маймун , 5 3 Супик чӀал , 6 3 Саваннадин фил , 7 3 Наукандин юпик чӀал , 8 3 Мирикина , 9 3 Латин чIал , 10 3 Кьвевар , 11 3 Ибериядин сувайрин чурчул , 12 3 ГъвечӀи панда , 13 3 Гну , 14 3 Садхьанвай Араб Эмиратар , 15 3 Атна чӀал , 16 3 Аляскадин юпик чӀал , 17 3 Алеут чӀал , 18 2 Яру бубал , 19 2 Юпик чӀалар , 20 2 Эяк чӀал , 21 2 Эскимос-алеут чӀалар , 22 2 Экуь вили антилопа , 23 2 Чувуд чӀал , 24 2 Чевакдин чупик чӀал , 25 2 Чапла Канададин инуит чӀал

Sep 2011: 1 4 Туьркиядин лезги хуьрер , 2 3 Кьилин ччин , 3 3 Шергир , 4 3 Чинеруг , 5 3 Химия , 6 3 Туьтуьнуькl , 7 3 Хундуз , 8 3 Ортажа , 9 3 Лезги кхьинар , 10 3 Къванцин цуцӀул , 11 3 Йайлакёй , 12 3 ЦуцӀул-балугъчи , 13 3 Дагъустан , 14 3 Гьатем ага ЧӀакарви , 15 3 Гиенадал ухшар кицӀ , 16 3 География , 17 3 Ахцегь , 18 2 НуькI , 19 2 Яру жанавур , 20 2 Юсуф ал-Лезги , 21 2 МичIи куьрен кард , 22 2 Шахин , 23 2 Шангъар , 24 2 Чалагъан , 25 2 ЧIехибритания

Oct 2011: 1 3 Кьилин ччин , 2 3 Топонимика , 3 3 Сатурн , 4 2 Чил (планета) , 5 2 Хьилер , 6 2 Хашпара дин , 7 2 Футбол , 8 2 Теннис , 9 2 Урусат , 10 2 Мегьарамдхуьруьн район

Nov 2011: 1 4 Рутул район , 2 4 Лезгистан , 3 3 Кьилин ччин , 4 3 Яру жанавур , 5 3 Финн чӀал , 6 3 Гъуьгъвезар , 7 3 Ахцегь , 8 3 Антилопа , 9 2 Цуругъ , 10 2 ЦIийи Кьуруш , 11 2 Хьилер , 12 2 Хуьшрекандиз ухшар маймун , 13 2 Хуьшрекан хьтин маймун , 14 2 УсухвацI , 15 2 Урус чIал , 16 2 Урбис , 17 2 Туьрк чIал , 18 2 Топонимика , 19 2 Смугъул , 20 2 Ситатунга , 21 2 СикӀер , 22 2 Планета , 23 2 Пирал , 24 2 Осло , 25 2 Орхидея

Dec 2011: 1 3 Франция , 2 3 Къуйсун , 3 3 Имарат Къавкъаз , 4 2 Кьилин ччин , 5 2 Туьркменистан , 6 2 Суварин цӀиргъ , 7 2 Кеферпатан МуркIарин океан , 8 2 Монако , 9 2 Марсельеза , 10 2 Люксембург , 11 2 Индиядин океан , 12 1 НуькI

Jan 2012: 1 4 Тай чӀал , 2 3 Мукьтадир , 3 2 Кьилин ччин , 4 2 Усугъчай , 5 2 Совет Социалист Республикайрин ГалкӀ

Feb 2012: 1 4 Кьилин ччин , 2 3 Гьажи Мегьамед Эфенди Штулви , 3 2 Мукьтадир , 4 2 Луткун , 5 2 Википедия

Mar 2012: 1 13 Кьилин ччин , 2 10 Лезгияр , 3 8 Азербайжан , 4 7 Лезгистан , 5 7 Къуба , 6 7 Ингъушар , 7 7 Баку , 8 6 Урусат , 9 6 Къазакъстан , 10 6 Ахцегь район , 11 5 Эрменистан , 12 5 Европадин гьукуматар , 13 5 Совет Социалист Республикайрин ГалкӀ , 14 5 ТӀаратӀ , 15 5 Лезгийрин тарих , 16 5 Кьиблепатан Америка , 17 5 Инглис чIал , 18 5 Заира Аминова , 19 5 Дагъустан , 20 5 Ахцегь , 21 5 Антарктида , 22 5 Али Султан , 23 4 Табасаранар , 24 4 Урусар , 25 4 ЦIийи Дуьнья

Apr 2012: 1 6 Кьилин ччин , 2 6 Лезгияр , 3 5 Христофор Колумб , 4 5 Дуьньядин кьведлагьай дяве , 5 5 Польша , 6 5 Агъул район , 7 5 Рейн , 8 5 Литва , 9 5 Сауди Арабистан , 10 5 Пакистан , 11 5 Лезги чIал , 12 5 Азербайжан , 13 4 Философия , 14 4 Боливия , 15 4 Пакистандин пайдах , 16 4 Мегьамед Мегьамедан хва Гьажиев , 17 4 Италия , 18 4 Лезги Википедия , 19 4 Сара Бернар , 20 4 ЦӀийи гафарин сиягь , 21 4 Грекрин алфавит , 22 4 Тегьран , 23 4 Урусар , 24 4 Кореядин Халкьдинни-Демократиядин Республика , 25 4 Афинаяр

May 2012: 1 5 Португалия , 2 5 Мисри , 3 5 Ахцегь , 4 4 Каир , 5 4 Puzzling World , 6 4 Владимир Владимирович Путин , 7 4 Falco vespertinus , 8 4 I Наполеон Бонапарт , 9 4 Трпиня , 10 4 Кьилин ччин , 11 4 Италия , 12 4 Дунай , 13 4 Гъед (гьайванар) , 14 3 Абдул Мажид , 15 3 Португал чIал , 16 3 Колибри , 17 3 Дуэро , 18 3 Португалиядин шегьерар , 19 3 Альберт Эйнштейн , 20 3 Кьибле-Африкадин Республика , 21 3 Улуб , 22 3 Мастурбация , 23 3 Яру улуб , 24 3 Астероид , 25 3 Динозавраяр

Jun 2012: 1 7 Мугьаммад , 2 6 Византий империя , 3 5 Исаак Ньютон , 4 5 Аллагьдин 99 тӀвар , 5 5 Алюминий , 6 5 Урусат , 7 4 Аврил Лавин , 8 4 Гелхен , 9 4 Химиядин элементрин девирдин система , 10 4 Шахматар , 11 4 Осман империя , 12 4 Византиядин императоррин сиягь , 13 4 Республика Корея , 14 4 The Macallan , 15 4 Суван Къарабагъ , 16 4 Китайдин Халкьдин Республика , 17 4 Финн чӀал , 18 4 Ахцегь , 19 4 Айдагьо , 20 3 Брест , 21 3 Вольфганг Амадеус Моцарт , 22 3 Математика , 23 3 Бубуяр , 24 3 Сятдин чӀул , 25 3 Гьукуматдин идара авунин тегьер

Jul 2012: 1 4 Санкт-Петербург , 2 4 ЧӀехи Француз инкъилаб , 3 4 Рим империя , 4 4 Куба , 5 3 Дуьньядин чими хьун , 6 3 Эсперанто , 7 3 Волга , 8 3 Эрнесто Че Гевара , 9 3 Яд , 10 3 Автомобилдин код , 11 3 Математика , 12 3 Чил (планета) , 13 3 Сев , 14 2 Лелевар , 15 2 Постессив аватвал , 16 2 Археяр , 17 2 Биология , 18 2 Дезоксирибонуклеин цуруцӀ , 19 2 Велс , 20 2 Садхьанвай миллетрин тешкилат , 21 2 Че Гевара , 22 2 Расим Загьирбег хва Тагирбеков , 23 2 Рахазвайбурун кьадардиз килигна чӀаларин сиягь , 24 2 Автомобил код , 25 2 Почтунин индекс

Aug 2012: 1 7 Лезгистан , 2 5 Олимпиядин къугъунар , 3 4 Рим , 4 3 КӀамс , 5 3 Сочи , 6 3 Биология , 7 3 Грекрин алфавит , 8 2 Экваториал Гвинея , 9 2 Чарльз Дарвин , 10 2 Искандер Македонжув , 11 2 The Beatles , 12 2 Иосиф Виссарионович Сталин , 13 2 Сингапур , 14 2 Гуржи чIал , 15 2 Хунзах район , 16 2 2012 Гатун Олимпия къугъунар , 17 2 Велс , 18 2 Эсперанто , 19 2 Куба , 20 2 Португалия , 21 2 Тегьран , 22 2 Урус чIал , 23 2 Тувалу , 24 2 Лас океан , 25 1 Никlи

Sep 2012: 1 3 Юлий Цезарь , 2 3 Иерусалим , 3 3 Таиланд , 4 3 Жозе Мария Эса ди Кейруш , 5 3 Ботлих , 6 3 Акуша , 7 3 Алпан , 8 3 Хошимин , 9 3 Кьулан вацI , 10 3 Париж , 11 2 Физика , 12 2 Дегь Мисри , 13 2 ПIатIар , 14 2 Сарфунъял , 15 2 Экология , 16 2 Вунгтау , 17 2 Нячанг , 18 2 Америка , 19 2 Кертагъ Давдакь , 20 2 С , 21 2 Слово (газет, Португалия) , 22 2 Эйсебио , 23 2 Маяк Португалии , 24 1 Донгхой

Oct 2012: 1 4 Мадрид , 2 4 Вена , 3 3 Хуьруьн майишат , 4 3 Кефердинни рагъакIидай Англия , 5 3 Ливерпульдин агломерация , 6 3 Неаполь , 7 3 Турин , 8 3 ЦIуру Худат , 9 3 Хурай (КцIар) , 10 3 Немец чIал , 11 2 Мирземугьаммадхъишлах , 12 2 Эрдэнэт , 13 2 Монгол чӀал , 14 2 Улан-Батор , 15 2 Чархы , 16 2 Жанахир , 17 2 ЧIал , 18 2 Карл Маркс , 19 2 Салвадор Дали , 20 2 Акбар ЧӀехи , 21 2 Гаф , 22 2 Slayer , 23 2 Пекин , 24 2 Къусарчай (Хъачмаз) , 25 2 Гуьнешли

Nov 2012: 1 4 Компьютер , 2 4 Садвал , 3 3 Чепер , 4 3 Уран (планета) , 5 3 Каракорум (шегьер) , 6 3 Куритиба , 7 3 Гилияр , 8 3 Водород , 9 3 Грар , 10 3 Магьачкъала , 11 3 Дербент район , 12 2 Людвиг ван Бетховен , 13 2 Ӄ , 14 2 Дагъустандин ЦIаяр , 15 2 Дагъустандин шегьерар , 16 2 Ухул , 17 2 1930 йис , 18 2 Мичегь , 19 2 Калук , 20 2 Приморск (Дагъустан) , 21 2 Венесуэла , 22 2 КьепIир Къазмаяр , 23 2 Хуьлуьхъ , 24 2 ПIатIар , 25 2 Рим

Dec 2012: 1 3 Кьулан СтIал , 2 3 Къайи дяве , 3 3 Вепс чӀал , 4 3 Пудлагьай рейх , 5 3 Велс , 6 3 Астероид , 7 3 Ле Корбюзье , 8 2 Камарван , 9 2 Пиперхуьр , 10 2 КIахцугъ , 11 2 Герейханован совхоздин 2-лагьай отделение , 12 2 Зари , 13 2 Алкьвадар , 14 2 Усур , 15 2 Хашпересрин финар , 16 2 Вьетнамдин дяве , 17 2 1930 йис , 18 2 Сарфунъял , 19 2 Усугъчай , 20 2 Туьркер-Месхетинар , 21 2 ТӀиб , 22 2 Марс , 23 2 Кьасумхуьр , 24 1 Пак тир Рим империя

Jan 2013: 1 3 Индуизм , 2 3 Лезгияр , 3 2 Вашингтон (кьилин шегьер) , 4 2 Ахвах район , 5 2 Акуша район , 6 2 1812 йис , 7 2 1866 йис , 8 2 1878 йис , 9 2 1969 йис , 10 2 Вини СтIал , 11 2 , 12 2 Пак тир Рим империя , 13 2 Компьютер , 14 2 Велиханрин Къудрат Кибечханан хва , 15 2 Волга , 16 2 Мугьаммад , 17 2 ЧӀулав тӀеквен , 18 2 Сампи , 19 2 Промышленность , 20 2 2012 йис , 21 2 Рейн , 22 2 Пси (гьарф) , 23 2 Фи , 24 2 Ипсилон , 25 2 Тау

Feb 2013: 1 2 Фридрих Ницше , 2 2 Бум , 3 2 Къарасу , 4 2 Къарадейн , 5 2 Кичик ПIирали , 6 2 Курд (Кьвепеле) , 7 2 Кветуьклуь , 8 2 Имамлы , 9 2 Зергерли , 10 2 Зараган , 11 2 Залам , 12 2 Жигъателли , 13 2 Жорлу , 14 2 Енгиже

Mar 2013: 1 3 1949 йис , 2 3 1969 йис , 3 3 Турция , 4 3 Айдагьо , 5 3 Абхазия , 6 2 Дегь Греция , 7 2 Валенсия (мана) , 8 2 Илим , 9 2 АСШ-дин граждан дяве , 10 2 Гарринча , 11 2 ЧӀулав хъалхъам , 12 2 Элвис Пресли , 13 2 Байуба , 14 2 Дунчэн (Пекин) , 15 2 Садхьанвай миллетрин тешкилат , 16 2 Каир , 17 2 ЧӀулав тӀеквен , 18 2 Лекь (анатомия) , 19 2 Яру жанавур , 20 2 Эхен , 21 2 Китайдин Халкьдин Республика , 22 2 Чиле , 23 2 Лас океан , 24 2 Пахун , 25 2 Некхъвадайбур

Apr 2013: 1 5 Амстердам , 2 3 Гонконг , 3 3 Октавиан Август , 4 3 Плазма , 5 3 Ракь , 6 3 Рио-де-Жанейро , 7 3 Метр , 8 3 Буэнос-Айрес , 9 3 Иерусалим , 10 3 Дагъустан , 11 2 Умар Хайям , 12 2 Сувар (ансамбль) , 13 2 Керимрин Седакъет Къайинбеган руш , 14 2 Метаболизм , 15 2 Кизилюрт , 16 2 Михаил Лезгинцев , 17 2 Атом , 18 2 Гьуьсейнов Абдусалам Абдулкериман хва , 19 2 Барселона (мана) , 20 2 Агъдам район , 21 2 Нежефхуьр , 22 2 Ахцегьрин гьамамар , 23 2 Грар , 24 2 Юсуф ал-Лезги , 25 2 Эфиопидин чъакъал

May 2013: 1 3 Франция , 2 2 Москва вилаят , 3 2 Альгеро , 4 2 Алпан (манаяр) , 5 2 Алпан (астрономия) , 6 2 Алпан

Jun 2013: 1 3 Марко Поло , 2 3 Демократия , 3 3 Фу , 4 2 Мидгьед Ширинбегов , 5 2 Иисусан гьакъикъи клиса , 6 2 Александр Ильич Рыбников , 7 2 Кьавал , 8 2 Агъул чIал , 9 2 Хвереж (Кьурагь район) , 10 2 Усугъ , 11 2 Вулкан (геология) , 12 2 Абилов Магьмуд Абдулрзадин хва , 13 2 Митаги хуьруьнсовет , 14 2 Хазар хуьруьнсовет , 15 1 Кьилерин хуьруьнсовет

Jul 2013: 1 2 Хъачмаз район , 2 1 Зигмунд Фрейд

Aug 2013: 1 3 Католицизм , 2 3 Чингисхан , 3 3 Винстон Черчилль , 4 2 Урусатдин тӀаратӀ , 5 2 Табасаран чIал , 6 2 Дагъустандин тIаратI , 7 2 Гоа (Дагъустан) , 8 2 Мыгра (Дагъустан) , 9 2 Кина (Дагъустан) , 10 2 Британиядин империя , 11 2 Вини Катрух , 12 2 Автомобиль , 13 2 Марко Поло , 14 2 Агъул чIал , 15 2 ЧIал , 16 2 ЦIийихуьр , 17 2 Христофор Колумб , 18 2 ТӀаратӀ , 19 2 Лезги чIал , 20 2 Кьвевар , 21 1 Будугъ чIал

Sep 2013: 1 3 Авраам Линкольн , 2 3 КъирицI чIал , 3 2 Чилин зурзунар , 4 2 Хинелугъ чIал , 5 2 Нидерландар , 6 2 Китайдин Халкьдин Республика , 7 2 Саха Республика , 8 1 ЦIуру Киркар

Oct 2013: 1 3 Лезгияр , 2 2 Холокост , 3 2 Хамаматюрт , 4 2 Адиль-Янгиюрт , 5 2 Бабаюрт , 6 2 Чилин зурзунар , 7 2 Табасаранар , 8 1 ЧӀутрацуьк

Nov 2013: 1 3 Аристотель , 2 3 Бактерияр , 3 2 Ингушетия , 4 2 UTC+4 , 5 2 Терек , 6 2 Хуьр , 7 2 Шегьер , 8 2 АхцегьвацӀ , 9 2 Мустафа Камал Ататуьрк , 10 1 Муниципал район

Dec 2013: 1 3 КуртӀухъан , 2 3 Атлантик океан , 3 3 Харахуба , 4 2 Пепеяр , 5 2 Малярия , 6 1 Тарих

Jan 2014: 1 3 Мирослава Вавринец , 2 3 Роджер Федерер , 3 3 Валентина Васильевна Толкунова , 4 3 Кьвепеле , 5 2 Затор , 6 2 Бойнице , 7 2 Куколивка

Feb 2014: 1 3 Шахматар , 2 2 Сан-Паулу , 3 2 Гуржистан , 4 2 Абхазия , 5 1 Славян чIалар

Mar 2014: 1 3 Поляк чIал , 2 3 Словак чIал , 3 3 Чех чIал , 4 2 Кашуб чIал , 5 1 НАТО

Apr 2014: 1 3 Алискерово (посёлок) , 2 2 Тито Виланова , 3 2 Баламирзоев Абдул Гьажибаладин хва , 4 2 Поречье хуьруьнсовет (Тула вилаят) , 5 2 Дубна (Тула вилаят) , 6 2 Фотосинтез , 7 1 Синусоида

May 2014: 1 3 Грек чӀал , 2 3 Сидней , 3 3 Вичи-вич кьин , 4 3 Сеул , 5 3 Салигьов Эсед Бабастанан хва , 6 3 Верем , 7 2 Metallica , 8 2 Пурни , 9 2 Мумбаи , 10 2 ТӀач , 11 2 Бебелук , 12 2 2014 ХъуьтӀуьн Олимпия къугъунар , 13 2 ЧӀулавкьал , 14 2 ЦӀегьрекарч , 15 2 Словак чIал , 16 1 Лезги литература

Jun 2014: 1 2 Фернан Магеллан , 2 2 Цур , 3 2 Геология , 4 2 Етим Эмин , 5 2 Храхуба , 6 2 Гуржи чIал , 7 2 Далдам , 8 1 Инд океан

Jul 2014: 1 2 Джяравица , 2 2 Европадин таж , 3 2 Квеста , 4 2 Париж бассейн , 5 1 Ботсвана

Aug 2014: 1 3 Робин Уильямс , 2 2 Джульярд мектеб , 3 2 ЦIуьлуьк , 4 2 Хъутур-Куьредин наибвал , 5 1 Кочубей

No data on this page have been normalized to 30 day months (as WMF does on certain traffic reports).
Wikipedias are initially ordered by number of speakers of the language

Speakers: Number of speakers of a language is the estimated total of primary and secondary speakers, is in many cases a very rough estimation (based on the page on the English Wikipedia about that language)
Regions are parts of the world where the language is spoken in substantial amounts (compared to total number of speakers). Regions where a language gained presence only by a recent diaspora are generally not included.
Region codes: AF:Africa, AS:Asia, EU:Europe, NA:North America, OC:Oceania, SA:South America, W:World Wide, CL:Constructed Language

Estatísticas geradas em Sunday September 28, 2014 20:21

Dump file lezwiki-20140912-stub-meta-history.xml.gz (edits only), size 3.5 Mb as gz -> 25 Mb
Dump processed till Aug 31, 2014, on server stat1002, ready at Fri-12/09/2014-11:04 after 24 sec.

Versão do script:2.6
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.