Estatísticas da Wikipédia ligurian

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Articles per size range / Records per namespace / Most edited articles / Zeitgeist

Metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.
See also metrics definitions


 
Monthly counts & Quarterly rankings: março 2013
 
DataWikipedistasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
mar 2013+2%   0%      +103%      +1%
fev 20130%   0%      -29%      +3%
jan 20130%   0%      +14%      +2%
dez 2012+4%   +1%      +10%      +7%
nov 2012+2%   +1%      +22%      +5%
out 20120%   0%      -11%      +2%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P____Q____R____S__
mar 20134812 3,1 k  39,1   3,1 k      617
fev 201347 2 3,1 k  38,3   1,5 k      608
jan 201347 113,1 k  37,9   2,2 k      589
dez 2012472413,1 k 137,3   1,9 k      575
nov 20124513 3,0 k 137,2   1,7 k      538
out 201244 1 3,0 k  37,1   1,4 k      510
set 20124413 3,0 k 136,7   1,6 k      498
ago 20124314 3,0 k 236,6   2,0 k      457
jul 201242 2 2,9 k  36,7   1,5 k      456
jun 2012422512,9 k  36,2   1,7 k      454
mai 2012401312,9 k 135,8   1,7 k      425
abr 201239   2,8 k  35,8   1,3 k      412
mar 201239 1 2,8 k  35,4   1,3 k      412
fev 20123911 2,8 k  35   1,4 k      411
jan 201238 1 2,8 k  34,6   1,5 k      411
dez 201138   2,8 k  34,2   1,3 k      411
nov 201138 1 2,8 k  33,7   1,5 k      409
out 201138 1 2,8 k 133,3   1,7 k      408
set 201138 1 2,8 k  32,9   1,5 k      407
ago 201138   2,8 k  32,4   1,2 k      399
jul 201138 4 2,8 k  32   1,6 k      398
jun 20113812 2,8 k  31,5   1,7 k      397
mai 20113724 2,8 k  30,9   1,9 k      397
abr 201135 1 2,8 k  30,3   1,5 k      397
mar 201135   2,7 k  29,8   2,4 k      395
fev 201135   2,7 k  29   1,3 k      395
jan 201135 2 2,7 k  28,5   2,3 k      395
dez 201035 2 2,7 k  27,7   1,4 k      395
nov 20103512 2,7 k  27,2   1,4 k      395
out 201034 2 2,7 k1,4 k 26,75692851,3 k5,2 Mb261 k11 k148 k562707395
set 20103412 2,7 k1,4 k 26,35542851,5 k5,2 Mb254 k11 k147 k531690394
ago 201033 1 2,7 k1,3 k 25,95542852,2 k5,1 Mb253 k11 k146 k541692394
jul 201033 2 2,7 k1,3 k 25,25522851,4 k5,1 Mb251 k11 k144 k544690394
jun 2010331212,7 k1,3 k 24,75462842,2 k5,0 Mb248 k11 k144 k554690394
mai 201032   2,7 k1,3 k 23,95452741,6 k4,9 Mb247 k11 k140 k557691384
abr 20103223 2,7 k1,3 k 23,35432742,1 k4,9 Mb246 k11 k139 k561689384
mar 20103024 2,7 k1,3 k 22,65422741,8 k4,9 Mb245 k11 k138 k576682382
fev 20102812 2,7 k1,3 k1225412741,7 k4,8 Mb243 k11 k137 k616681380
jan 20102712 2,6 k1,3 k 21,65402741,4 k4,8 Mb240 k11 k135 k638675377
dez 20092614 2,6 k1,3 k221,25362741,6 k4,7 Mb237 k11 k135 k674668376
nov 200925 1 2,6 k1,3 k 21,25412741,4 k4,6 Mb232 k10 k133 k712659366
out 200925 1 2,6 k1,2 k 20,75382741,7 k4,6 Mb230 k10 k132 k760658365
set 200925 2 2,5 k1,2 k 205352641,9 k4,5 Mb228 k10 k127 k809652361
ago 200925 2 2,5 k1,2 k 19,45322642,4 k4,4 Mb226 k10 k126 k926655361
jul 20092511 2,5 k1,2 k 18,55302642,4 k4,3 Mb224 k10 k123 k1,1 k645361
jun 200924 1 2,5 k1,2 k 17,65282641,5 k4,3 Mb222 k10 k121 k1,3 k643355
mai 200924 1 2,5 k1,2 k 175222642,2 k4,2 Mb219 k10 k120 k1,5 k639353
abr 200924 1 2,5 k1,2 k 16,25162641,5 k4,0 Mb216 k10 k110 k1,7 k636351
mar 2009241412,5 k1,2 k115,65112542,0 k4,0 Mb213 k10 k109 k2,0 k637347
fev 20092311 2,5 k1,2 k1155012441,5 k3,9 Mb206 k10 k108 k2,0 k631334
jan 200922 1 2,4 k1,1 k 14,54932441,8 k3,8 Mb200 k10,0 k107 k2,0 k625331
dez 200822   2,4 k1,1 k 13,84932441,1 k3,8 Mb199 k10,0 k105 k2,0 k625331
nov 200822   2,4 k1,1 k 13,44932441,1 k3,7 Mb199 k9,9 k104 k2,0 k624331
out 20082211 2,4 k1,1 k 12,94912441,3 k3,7 Mb198 k9,9 k104 k2,0 k623329
set 200821 2 2,4 k1,1 k 12,44912441,5 k3,7 Mb198 k9,9 k102 k2,0 k618329
ago 200821 1 2,4 k1,1 k 11,84892441,9 k3,6 Mb197 k9,9 k101 k2,0 k618328
jul 200821 3 2,4 k1,1 k111,14872331,6 k3,6 Mb195 k9,8 k99 k1,9 k616313
jun 20082115 2,4 k1,1 k110,64922441,9 k3,5 Mb194 k9,8 k96 k1,9 k607303
mai 20082013 2,4 k1,1 k 9,94862332,1 k3,4 Mb190 k9,6 k92 k1,9 k574288
abr 200819 1 2,4 k1,1 k194852331,4 k3,3 Mb189 k9,6 k88 k1,9 k570288
mar 20081914 2,3 k1,1 k18,54852331,7 k3,2 Mb188 k9,5 k86 k1,9 k557284
fev 200818 2 2,3 k1,0 k37,84762231,5 k3,1 Mb184 k9,3 k84 k1,8 k554274
jan 2008182512,2 k1,0 k37,54852341,6 k3,0 Mb180 k9,1 k78 k1,8 k542271
dez 2007161412,1 k1,0 k27,14912341,8 k2,8 Mb175 k9,0 k69 k1,8 k521264
nov 200715 212,1 k92056,44582132,3 k2,6 Mb159 k8,4 k66 k1,7 k432247
out 2007151221,9 k85435,84532132,2 k2,4 Mb144 k8,1 k63 k1,5 k404214
set 200714 1 1,8 k78614,94572031,2 k2,1 Mb133 k7,7 k48 k1,4 k315189
ago 20071436 1,8 k76764,24522032,0 k2,1 Mb130 k7,6 k46 k1,4 k271189
jul 200711 2 1,6 k67213,54141831811,4 Mb115 k7,2 k20 k1,4 k195184
jun 20071113 1,6 k636 3,43981632471,3 Mb107 k6,9 k18 k1,4 k100179
mai 2007102211,6 k63123,33891635041,2 Mb105 k6,5 k17 k1,4 k100178
abr 20078   1,5 k588 3,13591531171,1 Mb91 k5,9 k15 k1,4 k97156
mar 20078   1,5 k586 33581533091,1 Mb90 k5,9 k15 k1,4 k95156
fev 20078   1,5 k582 2,83561531621,0 Mb90 k5,8 k10 k1,4 k93155
jan 20078 311,5 k58112,73541535731,0 Mb89 k5,8 k10 k1,4 k93155
dez 200682311,5 k55152,4345143456931 kb85 k5,6 k6,2 k1,3 k71152
nov 20066 111,3 k42392,3323143924754 kb69 k4,6 k4,4 k87268138
out 200662111,1 k2591422411021,1 k463 kb39 k3,3 k2,0 k6161666
set 20064   61953 1,71676363222 kb21 k9681,2 k2151634
ago 2006412 61452 1,71676323217 kb21 k9639102151634
jul 20063   61251191,616763825214 kb21 k9637362151633
jun 2006312 372514,61749513514091 kb11 k21427451610
mai 200621  43 7,212075025613 kb70144224 162
abr 2006111 32 7,773833 238,0 kb275 117 152
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
The following table ranks this project in relation to projects in other languages with 1000+ articles
jan 2013159 199139168  27   143      271
out 2012165 192 167  29   164      271
jul 2012167 174 167  29   156      271
abr 2012166   166  29   160      271
jan 2012164 202 165  30   154      271
out 2011158 208 163 14935   156      271
jul 2011153 137 157  39   154      271
abr 2011159 202 150  46   147      271
jan 2011155 176 148  49   143      271
out 20101541571721321454415754595152154485155286558271
jul 20101531701831421435016158615254147545657296962271
abr 201014810115713914314916467151144146142154155158129162156271
jan 201015914317313214214915870152145147139154155161131153157271
out 200915814620013714114916274154145147135155157164132149159271
jul 200915318018813214014515383151141143138154157160130129157271
abr 200914814219014413514214990150141142140152155156131112152271
jan 200915013419013212613915210414814213813814614914912699149270
out 200814412818613212613414711414413413413214214414612498142268
jul 200814215814413512413313711713812813313114014114412498137267
abr 200814215219213312513014612213512512912613913514012495137267
jan 200814010612812912512910712512811911710913813413912192135263
out 200714313216310112813110912512711912212213913813912196141262
jul 200715214715412612613013212612411911615714513914013692152257
abr 200716114519212512013114212412311911317014413813914188161253
jan 200715412512612011612113511811611110813614013213113785158250
out 2006158921691151131246511511311111010814514013516293186246
jul 20061811321691091141524910510410410397153143150175116170234
abr 200620311715710921120512393929291167202212221191206165229
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
 WikipedistasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikipedistas (usuários registrados)
A = Wikipedistas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikipedistas que editaram pelo menos dez vezes desde que chegaram
C = Wikipedistas que contribuíram cinco vezes ou mais este mês
D = Wikipedistas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Artigos que contêm pelo menos uma ligação interna e 200 caracteres de texto legível, não contando códigos wiki e html,
      ligações ocultas, etc.; títulos também não contam (outras colunas são baseadas no método oficial de contagem)
G = Novos artigos por dia no mês passado
H = Número médio de revisões por artigo
I = Tamanho médio dos artigos em bytes
J = Porcentagem de artigos com pelo menos 0,5 kb de texto legível (veja F)
K = Porcentagem de artigos com pelo menos 2 kb de texto legível (veja F)

Base de dados
L = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
M = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
N = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
O = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
P = Total de ligações para outras wikipédias
Q = Total de imagens apresentadas
R = Total de ligações para outros sítios
S = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  5  10  100  1000  1  3  5  10  25  100  1  3  5  10  25  100  250  5  10  100 
mar 20138422  1073152111  1531    332
fev 2013113211 21174 422111 1032    33 
jan 20131351111 25185 211111 61     54 
dez 20121474311 21175 32111  921    62 
nov 2012144322 21174 31111  7      44 
out 20129111  23134 21111  51     54 
set 201213331  18144 31111  711    62 
ago 2012125422 19123 61111  611    32 
jul 20126321  20124 41111  1021    75 
jun 20121555211 16145 52111  1332    94 
mai 20121153111 17136 61111  103221  85 
abr 2012122   19163 41111  711    83 
mar 201262111 24145 41111  721    72 
fev 20124211  20183 51111  10311   74 
jan 20121221   18145 42111  12321   6  
dez 201174   19112 11111  82     42 
nov 2011621   28245 42111  9111   114 
out 20111321   26217 31111  1533    11101
set 201110311  25184 31111  10321   84 
ago 201151   26202 81111  141     107 
jul 2011944   26205 41111  1022    71 
jun 2011632   21175 42111  921    75 
mai 201113642  20135 2111   411    62 
abr 2011831   15124 6111   6111   95 
mar 201162   21186131111  4      52 
fev 2011122   18174 21111  5111   97 
jan 20111032   22165 42111  41     96 
jan 20131351111 25185 211111 61     54 
out 20129111  23134 21111  51     54 
jul 20126321  20124 41111  1021    75 
abr 2012122   19163 41111  711    83 
jan 20121221   18145 42111  12321   6  
out 20111321   26217 31111  1533    11101
jul 2011944   26205 41111  1022    71 
abr 2011831   15124 6111   6111   95 
jan 20111032   22165 42111  41     96 
out 201016421  16134 51111  12222   96 
jul 20107421  23204 41111  711    83 
abr 20109531  22184 721111 1241    74 
jan 2010102211 21124 1222111 12321   22 
out 2009112111 20176 72211  1121    63 
jul 200981111 21164 41111  141     32 
abr 2009111111 21175 4111   722    64 
jan 2009821   995 32     11321   42 
out 200813411  1183 2      1521    31 
jul 2008123331 1295 3      1511    31 
abr 200842111 1195 2      6      3  
jan 2008755421 10104 31     93111  1  
out 2007732222 1094 31     9652111   
jul 200753211 53  2      6211   1  
abr 20072    43  2      1111   11 
jan 2007653221 431 311    533221 21 
out 20065311111    62     642211 1  
jul 20061               2      1  
abr 2006311       4      82        

 

Distribuição de edições de artigos por wikipedistas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikipedistasEdições total
1359100.0%8,686100.0%
39927.6%8,32695.9%
104713.1%8,04392.6%
32226.1%7,58787.3%
100102.8%6,82978.6%
31651.4%5,91368.1%
100020.6%4,11647.4%

 

8 wikipedistas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdições 
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
 agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
Giromin CangiaxoUC2 01,0752246-mai 10, 201232449---
MarebUC3 0788163-fev 06, 20091513140---
Carlo PoggiUC18+2503374mai 13, 20123219---
DragonòtUC22 03613,72978jun 15, 200624802---
G.MussoUC45...1111--mar 24, 201361010--
Daniel MietchenUC119...33--mar 26, 20134----
פארוקUC166+15821--abr 02, 2012362----
Pan BrerusUC359...11--mar 18, 201312----

 

20 wikipedistas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
  Primeira ediçãoúltima edição
 posiçãototaldatadias
atrás
datadias
atrás
DedeeUC13,041out 08, 20062365mar 27, 20081829
ZeneizeForestoUC4687mai 26, 20072135dez 17, 2011469
FeffoUC5322ago 08, 20072061out 09, 2010903
Thorin IIIUC6224dez 29, 20062283jan 23, 20072258
KmoksyUC7201jun 05, 20101029ago 07, 2010966
Dario FerroUC8196mai 04, 20072157ago 08, 2010965
D'ohBotUC9181jul 02, 20091367set 11, 2010931
JenemeUC10114dez 09, 20071938jul 29, 20081705
ClamenghUC1187jun 26, 20062469jul 01, 20062464
CandolecciaUC1284mar 12, 20091479nov 27, 2012123
AndreasUC1383mai 21, 20081774fev 19, 2011770
SavoneseUC1477out 21, 20091256fev 01, 201357
Andre86UC1573set 26, 20072012dez 31, 20091185
CheepnisAromaUC1670abr 03, 2012361dez 06, 2012114
PurodhaUC1762jun 15, 20072115jan 15, 20081901
SuperzenUC1949mar 11, 20081845out 20, 2011527
F.nocetiUC2048abr 25, 20062531jun 10, 20081754
Mint JulepUC2139ago 30, 20081673ago 26, 2012216
Spl908455UC2331dez 13, 20062299set 04, 2010938
GilliamJFUC2431jul 30, 20072070ago 25, 20091313

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 3.966 edições foram feitas por usuários anônimos, de um total de 121.585 edições ( 3e %)
  


50 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições 
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
 datadias
atrás
datadias
atrás
SieBotUC113,195ago 05, 20072064jan 25, 2011795--
XqbotUC210,787abr 01, 20091459mar 07, 201323--
EmausBotUC38,098jun 26, 20101008mar 07, 201323--
TXiKiBoTUC47,855dez 27, 20062285jan 09, 201380--
Luckas-botUC56,342nov 30, 20081581mai 20, 2012314--
VolkovBotUC66,205abr 26, 20072165fev 27, 201331--
JAnDbotUC75,354jan 22, 20072259mar 01, 201329--
WikitanvirBotUC84,802out 17, 2010895abr 24, 2012340--
MerlIwBotUC94,315abr 26, 2011704mar 31, 2013---
MelancholieBotUC103,502abr 02, 20081823nov 28, 20091218--
AlleborgoBotUC113,016out 08, 20072000dez 16, 20081565--
ArthurBotUC122,815mar 15, 20091476nov 17, 2011499--
EscarbotUC132,596out 18, 20062355fev 05, 201353--
AddbotUC142,504mar 07, 201323mar 31, 2013---
ZéroBotUC152,153nov 03, 2010878mar 06, 201324--
Thijs!botUC161,840nov 30, 20062312jul 30, 2012243--
FoxBotUC171,392out 01, 20091276fev 05, 2012419--
PipepBotUC181,212ago 01, 20072068set 20, 20081652--
MjbmrbotUC19953out 15, 2010897mar 28, 2011733--
Ripchip BotUC20892mar 06, 2011755fev 18, 2012406--
TjBotUC21852nov 21, 2010860mar 06, 201324--
KamikazeBotUC22829jul 04, 20101000jan 26, 201363--
PtbotgourouUC23790set 26, 20081646mar 04, 201326--
BotMultichillUC24789set 07, 20072031set 28, 2010914--
AlexbotUC25723jan 30, 20081886ago 29, 2011579--
SynthebotUC26717nov 30, 20081581jan 20, 201369--
HRoestBotUC27678jun 19, 20101015fev 14, 201344--
RubinbotUC28607abr 08, 20091452mar 02, 201328--
LaaknorBotUC29601abr 16, 20091444mar 04, 201326--
RedBotUC30578set 06, 2010936ago 21, 2012221--
AvocatoBotUC31569out 20, 2011527mai 18, 2012316--
CarsracBotUC32522mar 15, 20091476fev 17, 201341--
JackieBotUC33518jul 29, 2010975fev 25, 201333--
Idioma-botUC34512mar 22, 20091469mar 04, 201326--
Movses-botUC35494dez 18, 2010833mar 18, 2012377--
GerakibotUC36446jan 10, 20101175mar 06, 201324--
RobbotUC37440ago 15, 20062419jan 13, 201376--
Dinamik-botUC38426fev 11, 20101143dez 22, 201298--
Purbo TUC39400fev 25, 20081860ago 17, 20091321--
Makecat-botUC40386out 25, 2012156mar 05, 201325--
YFdyh-botUC41385jun 17, 2012286fev 18, 201340--
JotterbotUC42380jul 26, 20091343jan 26, 201363--
HerculeBotUC43374ago 31, 20081672jul 14, 2012259--
AmirobotUC44344mai 05, 20101060nov 24, 2011492--
MastiBotUC45330dez 06, 20091210fev 21, 201337--
TechBotUC46321mar 18, 20091473abr 16, 20091444--
AlmabotUC47312abr 26, 20091434nov 21, 2010860--
AvicBotUC48292jun 20, 2011649dez 09, 2012111--
SilvonenBotUC49288mar 31, 20091460dez 09, 2012111--
LegobotUC50285mar 11, 201319mar 11, 201319--

 

Artigos que contêm pelo menos uma ligação interna e .. caracteres de texto legível, não contando códigos wiki e html,
ligações ocultas, etc.; títulos também não contam  (excluindo páginas de redirecionamento)

DataArtigos
 < 32 ch< 64 ch< 128 ch< 256 ch< 512 ch< 1 k ch< 2 k ch< 4 k ch< 8 k ch< 16 k ch< 32 k ch< 64 k ch
out 201014.6%17.4%33.5%56.4%72.5%86.8%95.5%98.4%99.7%99.9%100.0%100.0%
set 201014.6%17.4%33.5%56.4%72.5%86.8%95.5%98.3%99.6%99.8%99.9%99.9%
ago 201014.7%17.4%33.4%56.4%72.5%86.9%95.6%98.4%99.7%99.9%100.0%100.0%
jul 201014.7%17.4%33.5%56.6%72.6%86.9%95.5%98.3%99.6%99.8%99.9%99.9%
jun 201014.7%17.4%33.5%56.6%72.7%87.0%95.5%98.3%99.6%99.8%99.9%99.9%
mai 201014.7%17.4%33.5%56.7%72.8%87.1%95.6%98.4%99.7%99.9%100.0%100.0%
abr 201014.8%17.5%33.7%56.9%73.0%87.2%95.6%98.3%99.6%99.8%99.9%99.9%
mar 201014.8%17.6%33.8%57.0%73.1%87.1%95.5%98.2%99.5%99.7%99.8%99.8%
fev 201014.9%17.7%34.0%57.2%73.3%87.2%95.6%98.3%99.6%99.8%99.9%99.9%
jan 201015.0%17.9%34.2%57.5%73.5%87.4%95.7%98.4%99.7%99.9%100.0%100.0%
dez 200915.2%18.0%34.3%57.8%73.8%87.7%95.7%98.4%99.7%99.9%100.0%100.0%
nov 200914.4%17.1%33.3%57.4%73.8%87.8%95.7%98.4%99.7%99.9%100.0%100.0%
out 200914.4%17.1%33.3%57.4%73.8%87.8%95.6%98.3%99.6%99.8%100.0%100.0%
set 200914.5%17.2%33.5%57.5%74.0%88.0%95.8%98.4%99.7%99.9%100.0%100.0%
ago 200914.5%17.2%33.6%57.6%74.1%88.1%95.7%98.3%99.6%99.8%100.0%100.0%
jul 200914.6%17.3%33.8%57.8%74.3%88.3%95.8%98.4%99.7%99.9%100.0%100.0%
jun 200914.6%17.3%33.9%57.9%74.3%88.3%95.7%98.3%99.6%99.8%100.0%100.0%
mai 200914.7%17.4%34.0%58.2%74.6%88.6%96.0%98.5%99.7%99.9%100.0%100.0%
abr 200914.7%17.4%34.0%58.3%74.7%88.7%96.0%98.3%99.5%99.7%99.9%99.9%
mar 200914.8%17.6%34.2%58.7%75.2%89.2%96.4%98.7%99.8%100.0%100.0%100.0%
fev 200915.0%17.8%34.6%59.4%75.8%89.4%96.3%98.4%99.6%99.8%100.0%100.0%
jan 200915.2%18.1%35.1%60.2%76.6%90.0%96.6%98.6%99.7%99.9%100.0%100.0%
dez 200815.3%18.2%35.1%60.3%76.6%89.9%96.5%98.5%99.6%99.8%100.0%100.0%
nov 200815.3%18.2%35.1%60.3%76.6%89.9%96.5%98.5%99.6%99.8%100.0%100.0%
out 200815.2%18.1%35.0%60.3%76.6%89.9%96.5%98.4%99.5%99.7%99.9%99.9%
set 200815.3%18.2%35.1%60.5%76.6%89.9%96.5%98.4%99.5%99.7%99.9%99.9%
ago 200815.5%18.3%35.2%60.6%76.7%90.1%96.6%98.5%99.6%99.8%100.0%100.0%
jul 200815.6%18.3%35.3%60.6%76.8%90.2%96.6%98.5%99.6%99.8%100.0%100.0%
jun 200815.9%18.7%34.6%60.3%76.6%90.2%96.7%98.6%99.8%100.0%100.0%100.0%
mai 200816.3%19.0%35.1%60.8%77.1%90.4%96.7%98.5%99.6%99.8%100.0%100.0%
abr 200816.3%19.0%35.1%60.9%77.2%90.5%96.8%98.6%99.7%99.9%100.0%100.0%
mar 200816.5%19.2%35.4%61.3%77.3%90.4%96.7%98.5%99.6%99.8%100.0%100.0%
fev 200816.5%19.2%35.4%61.7%77.9%90.9%96.6%98.3%99.4%99.6%99.8%99.8%
jan 200817.3%20.2%35.5%60.7%77.4%90.8%96.6%98.5%99.7%99.9%100.0%100.0%
dez 200718.2%21.3%37.1%60.0%77.4%90.6%96.6%98.4%99.6%99.8%100.0%100.0%
nov 200719.9%23.2%39.3%62.5%79.8%91.1%96.7%98.4%99.5%99.6%99.8%99.8%
out 200721.8%25.3%37.5%62.0%79.5%91.0%96.8%98.6%99.6%99.8%100.0%100.0%
set 200724.6%28.8%40.4%62.1%79.2%90.5%96.6%98.6%99.7%99.8%100.0%100.0%
ago 200724.9%29.2%41.0%62.8%79.7%90.8%96.6%98.6%99.7%99.8%100.0%100.0%
jul 200727.5%32.0%44.8%65.9%82.7%92.7%96.5%98.6%99.6%99.7%99.9%99.9%
jun 200728.3%32.9%45.8%67.5%84.5%93.4%96.9%98.8%99.8%99.9%100.0%100.0%
mai 200728.5%33.1%45.8%67.6%84.5%93.5%96.9%98.8%99.7%99.8%100.0%100.0%
abr 200729.3%33.8%46.6%68.6%85.7%94.3%97.2%98.9%99.7%99.8%99.9%99.9%
mar 200729.4%33.9%46.8%68.7%85.7%94.3%97.2%98.9%99.7%99.8%99.9%99.9%
fev 200729.5%33.9%46.8%68.9%85.7%94.3%97.2%98.8%99.6%99.7%99.8%99.8%
jan 200729.6%34.0%46.9%69.0%85.8%94.4%97.3%98.9%99.7%99.8%99.9%99.9%
dez 200631.6%35.5%48.1%70.1%86.3%94.6%97.4%98.9%99.8%99.9%100.0%100.0%
nov 200636.2%40.8%53.4%73.5%86.5%94.8%97.3%98.8%99.8%99.9%100.0%100.0%
out 200647.3%53.1%64.3%79.1%90.5%96.6%98.2%99.1%99.8%99.8%99.9%99.9%
set 200682.0%85.9%90.8%92.5%94.4%96.0%97.6%99.0%100.0%100.0%100.0%100.0%
ago 200682.6%86.5%90.9%92.5%94.4%96.0%97.6%99.0%100.0%100.0%100.0%100.0%
jul 200682.7%86.6%90.9%92.6%94.5%95.9%97.5%98.9%100.0%100.0%100.0%100.0%
jun 20068.6%11.5%28.6%31.5%45.8%57.2%62.9%82.9%97.2%100.0%100.0%100.0%
mai 20060.0%0.0%25.0%25.0%50.0%50.0%75.0%100.0%100.0%100.0%100.0%100.0%
abr 20060.0%0.0%33.3%33.3%66.6%66.6%99.9%99.9%99.9%99.9%99.9%99.9%

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.

See also Category Overview Complete
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110GifJpgPngSvg
mar 20133,7 k860361304853728387       476491
fev 20133,7 k792361274853728387       473491
jan 20133,7 k778361234853728387       469491
dez 20123,6 k772361234853728387       469491
nov 20123,6 k760361234853718387       469491
out 20123,5 k758361224853718387       468491
set 20123,5 k755361224853718387       468491
ago 20123,4 k747361224853718387       468491
jul 20123,4 k735361224853718387       468491
jun 20123,3 k726361214853708385       467491
mai 20123,3 k708361214853568382       467491
abr 20123,2 k696361144853568382       460491
mar 20123,2 k683361124853568382       458491
fev 20123,2 k677361124853568382       458491
jan 20123,2 k659361124853568382       458491
dez 20113,2 k647361124853568382       458491
nov 20113,2 k645361114853568382       457491
out 20113,2 k630361114853568381       457491
set 20113,2 k616351114853558377       457491
ago 20113,2 k608351114853548377       457491
jul 20113,2 k594351114853548376       457491
jun 20113,2 k579351104853498373       456491
mai 20113,2 k570341084853498372       456471
abr 20113,1 k561341074853498372       456461
mar 20113,1 k547341074853488371       456461
fev 20113,1 k543341074853488371       456461
jan 20113,1 k532341074853488371       456461
dez 20103,1 k526341074853488371       456461
nov 20103,1 k517341074853488368       456461
out 20103,1 k505331074843138361      42456461
set 20103,1 k492331004843137361      45456391
ago 20103,1 k483331004843137361      37456391
jul 20103,1 k46433994842987355      33456381
jun 20103,1 k45733994842987354      200456381
mai 20103,1 k42633994842967346      14456381
abr 20103,1 k41933994842967346      46456381
mar 20103,1 k40233994842957345      58456381
fev 20103,1 k39133994842946344      78456381
jan 20103,0 k37933974842876340      53454381
dez 20093,0 k35532934842876339      136451371
nov 20092,9 k34632894842775335      46451331
out 20092,9 k34032864842775335      4425133 
set 20092,9 k33332854842775334      4325033 
ago 20092,9 k32132854842765334      5325033 
jul 20092,9 k31532854842764334      4925033 
jun 20092,9 k30232854842764333      5125033 
mai 20092,9 k29832824842754333      6024733 
abr 20092,9 k29532824842753333      7924733 
mar 20092,8 k28232814842753333      23124633 
fev 20092,8 k26130754842743333      8924033 
jan 20092,8 k25230734842743333      2123833 
dez 20082,8 k24530734842743333      823833 
nov 20082,8 k23830734842743333      1123833 
out 20082,8 k21630734842743323      3423833 
set 20082,8 k20030734842733322      3023833 
ago 20082,8 k19330724842723322      7223733 
jul 20082,7 k18130704842273313      9123731 
jun 20082,7 k16430704842263313      15623731 
mai 20082,7 k14829704832263310      4823731 
abr 20082,6 k13726684832222310      4023531 
mar 20082,6 k13425674832222309      13413531 
fev 20082,6 k12425674832182303      5913531 
jan 20082,5 k12024664832102300      19713431 
dez 20072,4 k11223654831902285      22513430 
nov 20072,3 k10723374831752276      6041324 
out 20072,1 k10718374831532234      3201324 
set 20072,0 k10117372671532217      321324 
ago 20072,0 k10017372671532217      1301324 
jul 20071,8 k8893326715 194      99 303 
jun 20071,8 k8193326715 182      33 303 
mai 20071,8 k7993026715 182      202 273 
abr 20071,7 k729326715 182      2 12 
mar 20071,7 k619326715 182      12 12 
fev 20071,7 k529226714 182      1 11 
jan 20071,7 k469226713 182      288 11 
dez 20061,6 k42912309 147      377  1 
nov 20061,4 k35612269 126      686  1 
out 20061,1 k32412269 108      1035  1 
set 2006653264 2239 40      5    
ago 2006648264 2239 40      12    
jul 2006645181 1999 40      2    
jun 200647171 1936 11      90    
mai 20066151 1933 2      5    
abr 20065131 1933 2      13    

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

abr 2006: 1 3 Pagina prinçipâ , 2 1 Broken/Template box

mai 2006: 1 1 Kurów

jun 2006: 1 3 Pagina prinçipâ , 2 1 Main Page

jul 2006: 1 1 A Compagna

ago 2006: 1 1 Broken/Illy78/Firma

set 2006: 1 1 Seistro

out 2006: 1 2 Zûgno , 2 2 Gatto , 3 2 Pagina prinçipâ , 4 1 Algebra

nov 2006: 1 1 Lengua sundaneise

dez 2006: 1 2 Sicilia , 2 2 Sardegna , 3 2 Friùli-Venessia Giulia , 4 2 Trentin-Erto Addige , 5 1 Internet

jan 2007: 1 2 Mâ Mediterraneo , 2 2 Mâ Ligure , 3 2 Liguria , 4 2 Romma , 5 2 Aruba , 6 2 Uruguay , 7 2 Ecuadòr , 8 2 Sann-a

fev 2007: 1 1 Bratislava

mar 2007: 1 1 Vëa Gexa de Gesû

abr 2007: 1 1 Pe ordinâ

mai 2007: 1 2 Xôxìa , 2 1 Madonna du Munte (Sann-a)

jun 2007: 1 1 Vuè

jul 2007: 1 1 Lunfardo

ago 2007: 1 2 Santiago do Cile , 2 2 Cile , 3 1 Dili

set 2007: 1 1 Alghero

out 2007: 1 2 Elementi chimici , 2 2 Isoa de San Paolo , 3 2 Polinesia Françeise , 4 1 Brommo

nov 2007: 1 2 Fabrizio De André , 2 2 Letimbru , 3 2 Zizzua , 4 2 Caffa , 5 2 Canis lupus , 6 2 Mosca (çittæ) , 7 2 Madrid , 8 2 Pariggi , 9 2 Çëxa , 10 1 Pòrto Rico

dez 2007: 1 2 Sinque Tere , 2 2 Almazán , 3 2 Filipu Giliu Rostan , 4 2 Rensu Villa , 5 2 Filipu Giliu ROSTAN , 6 2 Voxi de base , 7 2 Piemonte , 8 2 Romma , 9 2 Luì Notari , 10 1 Richard Wagner

jan 2008: 1 2 Galileo Galilei , 2 2 America do Sud , 3 2 Geografia , 4 2 Italia , 5 1 1493

fev 2008: 1 1 Leonardo da Vinci

mar 2008: 1 2 Voxi de base , 2 1 Repubbrica Parlamentâ

abr 2008: 1 1 Johann Gutenberg

mai 2008: 1 2 Rivêa

jun 2008: 1 2 Lengoa ligure , 2 1 Bella de Turigia

jul 2008: 1 2 Grafîa ofiçiâ , 2 1 Torreblacos

ago 2008: 1 2 Dipartimenti françeixi , 2 2 ASEAN , 3 1 Lengua ligure antiga

set 2008: 1 2 Väze , 2 1 Stadio Luigi Ferraris

out 2008: 1 2 Martin Weinek

nov 2008: 1 1 Paolo Villaggio

dez 2008: 1 1 Roian

jan 2009: 1 1 Lydnevi

fev 2009: 1 1 Auföggio

mar 2009: 1 2 Sergej Prokofiev , 2 2 Codiçe postâ , 3 1 Insufficiensa respiratoria

abr 2009: 1 1 Lezze Acerbo

mai 2009: 1 2 Jacopo Ruffini , 2 1 Jacopo ruffini

jun 2009: 1 1 Campora San Giovanni

jul 2009: 1 1 Gastrite acüta

ago 2009: 1 1 Confucio

set 2009: 1 5 Lengoa leonesa , 2 1 Peive

out 2009: 1 1 Múnegu

nov 2009: 1 2 Lauro De Bosis , 2 1 Smile Mission

dez 2009: 1 2 Ugolino e Vadino Vivaldi , 2 2 Lisciandria (Piemonte) , 3 1 Lengua Anglées

jan 2010: 1 2 Ferrovia Zena-Casella , 2 1 Cheratôxi solare

fev 2010: 1 2 Partîio Comunista Italian , 2 2 Thermodesulfobacteria , 3 2 Isoe Falkland , 4 1 Pinco

mar 2010: 1 1 Manto Neigro

abr 2010: 1 2 Catænn-a Segurann-a , 2 2 Trichinoxi , 3 2 Lengua franco-provensâ , 4 1 Nissa

mai 2010: 1 2 Predore

jun 2010: 1 2 Nietzsche a Zena , 2 2 Mantissa , 3 1 Vaccinaçion anticolerica

jul 2010: 1 1 Onfale

ago 2010: 1 1 Menestrinna coe öve

set 2010: 1 4 Giappon , 2 1 Biçicletta

out 2010: 1 2 Foresta de Nyungwe , 2 2 Giovanni da Carignano , 3 2 Biçicletta , 4 2 A.C. Entella Chiavari 1914

nov 2010: 1 2 Sigmund Freud , 2 1 Ghiandole

dez 2010: 1 2 Attacco de Pancho Villa contra Columbus

jan 2011: 1 2 Bucchero , 2 2 Maçedònia , 3 1 Concepcion

fev 2011: 1 5 Cavallo , 2 2 Cartilagine

mar 2011: 1 1 Cremma Pastiççea

abr 2011: 1 1 A vitta

mai 2011: 1 2 V millennio , 2 2 IV millennio , 3 2 Ëse uman , 4 1 Martiri de Gallaneô

jun 2011: 1 1 Audacity

jul 2011: 1 1 Perno endoradicolare

ago 2011: 1 1 London

set 2011: 1 1 Solenoide

out 2011: 1 1 San Pedro de la Paz

nov 2011: 1 1 Anestetici locali

dez 2011: 1 1 A Nuvia Neigra

jan 2012: 1 2 Sacco e Vanzetti , 2 2 Gilberto Govi

fev 2012: 1 1 Gran Concepción

mar 2012: 1 2 Rina Gaioni , 2 1 Rina Govi

abr 2012: 1 2 Dominique Dussault , 2 1 Laverda 750 SFC

mai 2012: 1 2 Siçilia , 2 2 Patagonia , 3 2 Emilio Azaretti , 4 1 Sorfo

jun 2012: 1 3 Wikipedia , 2 2 San Loenso (personna) , 3 2 Ray Bradbury , 4 2 Scolopi , 5 2 Niorche (stato) , 6 2 Vanuatu , 7 1 Eugenolo

jul 2012: 1 2 San Zorzo , 2 1 Giæ

ago 2012: 1 2 Zena , 2 1 Gilgamesh

set 2012: 1 2 Forsa elettromotrice , 2 2 Rijeka , 3 1 Scistema Solare

out 2012: 1 1 Batterio

nov 2012: 1 3 Universcitæ di Studdi Niccolò Cusano , 2 2 Carson City , 3 2 Concord (New Hampshire) , 4 2 Jefferson City (Missoùri) , 5 2 San Nichioso , 6 2 Helena (Montann-a) , 7 2 Teoria elioçentrica , 8 1 Çetron

dez 2012: 1 3 Goæra de sucescion aostriaca , 2 2 Niccolò Copernico , 3 2 Arbenga , 4 1 Cerere

jan 2013: 1 2 Nicolin Baçigalô , 2 1 Per armar galee

fev 2013: 1 2 Attila , 2 1 Çiañexi

mar 2013: 1 2 Barboutu , 2 2 Giastemma , 3 2 Battaggia da Meloia , 4 1 Noreg

Wikipedias are initially ordered by number of speakers of the language

Speakers: Number of speakers of a language is the estimated total of primary and secondary speakers, is in many cases a very rough estimation (based on the page on the English Wikipedia about that language)
Regions are parts of the world where the language is spoken in substantial amounts (compared to total number of speakers). Regions where a language gained presence only by a recent diaspora are generally not included.
Region codes: AF:Africa, AS:Asia, EU:Europe, NA:North America, OC:Oceania, SA:South America, W:World Wide, CL:Constructed Language

Estatísticas geradas em Quarta-feira, 24 de abril 2013 17:27

Dump file lijwiki-20130415-stub-meta-history.xml.gz (edits only), size 9.5 Mb as gz -> 64 Mb
Dump processed till Mar 31, 2013, on server stat1, ready at Mon-15/04/2013-22:12 after 47 sec.

Versão do script:2.6
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.