Estatísticas da Wikipédia mirandese

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Articles per size range / Records per namespace / Most edited articles / Zeitgeist

Most metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.

New Some metrics have been collected from the full archive dump which runs on lower frequency than the usual monthly cycle.
These metrics are columns F,I,J,K,M,N,O,P,Q,R from the first table.


See also metrics definitions


 
Monthly counts & Quarterly rankings: fevereiro 2014
 
DataWikipedistasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
fev 20140%   0%0%     +28%0%0%0%0%+4%0%+2%
jan 20140%   0%-0%     -37%0%0%0%-11%+5%0%0%
dez 2013+2%   0%0%     +4%0%0%0%0%0%0%+1%
nov 2013+2%   +1%+1%     +25%0%0%+1%0%0%0%+1%
out 2013+4%   0%0%     -95%0%0%0%+7%+1%0%+1%
set 2013+4%   +55%+59%     +1441%+31%+29%+27%+18%+1%+51%0%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P____Q____R____S__
fev 201453   2,7 k2,6 k 17,3685484%50%4622 Mb3,1 M148 k4472099,8 k370
jan 201453 1 2,7 k2,5 k 17,3687484%51%3622 Mb3,1 M148 k4462019,8 k364
dez 20135312 2,7 k2,5 k 17,3687684%51%5722 Mb3,1 M148 k5001919,8 k363
nov 20135212 2,7 k2,5 k 17,3688984%51%5522 Mb3,1 M148 k5001919,8 k359
out 20135123 2,7 k2,5 k 17,4691684%50%4422 Mb3,1 M147 k5001919,8 k354
set 2013492222,7 k2,5 k3217,4692584%51%97122 Mb3,1 M147 k4661899,8 k352
ago 20134712 1,7 k1,6 k126,4811981%57%6317 Mb2,4 M115 k3941876,5 k352
jul 201346 1 1,7 k1,6 k 26,9812083%58%3317 Mb2,4 M115 k6551856,4 k352
jun 201346 1 1,7 k1,6 k126,9813383%58%10517 Mb2,4 M115 k6771826,4 k350
mai 201346 311,7 k1,6 k427,4828083%58%32617 Mb2,4 M115 k7061826,4 k341
abr 20134623 1,6 k1,4 k129,3822382%57%17115 Mb2,2 M109 k6981816,0 k314
mar 201344 111,5 k1,4 k129,5828682%58%2,0 k15 Mb2,2 M109 k2,9 k1795,9 k314
fev 201344 2 1,5 k1,4 k 29844083%59%74818 Mb2,2 M108 k90 k1495,8 k313
jan 2013442411,5 k1,4 k128,5844583%59%1,2 k18 Mb2,2 M108 k90 k1495,8 k310
dez 2012421311,5 k1,4 k428,1850684%60%1,1 k18 Mb2,2 M108 k88 k1495,8 k309
nov 20124111 1,3 k1,3 k230,1860384%58%88716 Mb2,0 M99 k83 k1374,8 k294
out 201240 2 1,3 k1,2 k 30,6854883%57%81015 Mb1,9 M95 k79 k904,4 k286
set 201240 1 1,3 k1,2 k 30,2856683%57%65315 Mb1,9 M95 k79 k934,4 k286
ago 201240   1,3 k1,2 k 29,9861683%57%65715 Mb1,9 M95 k78 k944,3 k286
jul 20124023 1,3 k1,2 k 29,4862184%57%83315 Mb1,9 M95 k78 k954,3 k286
jun 201238 1 1,3 k1,2 k 29867883%57%80915 Mb1,9 M95 k77 k974,3 k286
mai 201238   1,3 k1,2 k 28,4869684%58%77215 Mb1,9 M95 k76 k924,3 k285
abr 201238 2 1,3 k1,2 k 27,9870684%58%86115 Mb1,9 M95 k76 k914,3 k285
mar 201238 3 1,2 k1,2 k127,4899384%58%95016 Mb2,0 M95 k75 k924,3 k285
fev 20123812 1,2 k1,1 k127,2916185%59%82815 Mb2,0 M95 k73 k954,3 k284
jan 201237   1,2 k1,1 k 27,5943288%61%61215 Mb2,0 M95 k71 k934,2 k283
dez 20113712 1,2 k1,1 k 27,1945988%61%85015 Mb2,0 M95 k71 k914,2 k283
nov 20113614 1,2 k1,1 k126,6951288%61%92215 Mb2,0 M94 k70 k914,2 k283
out 20113514 1,1 k1,1 k 26,2958989%62%80515 Mb1,9 M94 k69 k884,2 k278
set 201134   1,1 k1,1 k 25,8967189%62%58815 Mb1,9 M94 k68 k854,1 k276
ago 201134 4 1,1 k1,1 k 25,3968889%62%71515 Mb1,9 M93 k68 k874,1 k274
jul 20113423 1,1 k1,1 k124,8972189%62%88915 Mb1,9 M93 k68 k874,1 k274
jun 2011321  1,1 k1,1 k 24,7994490%64%89915 Mb1,9 M93 k66 k864,0 k273
mai 201131 2 1,1 k1,0 k 24,1995390%64%76715 Mb1,9 M93 k65 k944,0 k272
abr 20113116 1,1 k1,0 k123,4996190%64%82715 Mb1,9 M93 k65 k923,9 k271
mar 201130 2 1,1 k1,0 k 23,1996991%64%96215 Mb1,9 M91 k63 k923,8 k270
fev 201130 1 1,1 k1,0 k 22,31001191%64%69814 Mb1,9 M91 k62 k883,8 k270
jan 2011301511,0 k1,0 k121,81008491%64%1,3 k14 Mb1,9 M91 k61 k913,8 k268
dez 201029 1 1,0 k987 211033391%65%75314 Mb1,9 M91 k60 k903,8 k244
nov 201029 1 1,0 k978 20,51039191%66%64514 Mb1,9 M90 k59 k913,8 k243
out 20102915 1,0 k975119,91042491%66%70214 Mb1,9 M90 k59 k963,8 k241
set 20102824 992959 19,51055791%66%71914 Mb1,9 M90 k57 k973,8 k239
ago 201026 1 977951 19,11061592%67%98014 Mb1,9 M89 k56 k973,7 k236
jul 20102613 967941 18,31068492%67%70914 Mb1,9 M89 k55 k1023,7 k235
jun 20102511 952925 17,81083692%68%73014 Mb1,8 M89 k54 k1083,7 k233
mai 201024 3 947918 17,11079891%67%72814 Mb1,8 M88 k53 k1093,6 k233
abr 201024 52935908116,61091191%68%1,1 k14 Mb1,8 M88 k52 k1083,6 k232
mar 201024281907880315,81121692%68%1,3 k14 Mb1,8 M87 k51 k1463,6 k220
fev 201022 9 8178011161188393%69%85213 Mb1,7 M81 k46 k1573,4 k188
jan 201022362791775115,51211193%70%2,3 k13 Mb1,7 M79 k45 k1663,3 k171
dez 200919241754737 13,21275892%70%83812 Mb1,7 M77 k42 k2763,3 k120
nov 200917141750733 12,11275892%69%1,2 k12 Mb1,6 M76 k41 k6173,3 k117
out 200916 42742723110,71329992%70%1,1 k12 Mb1,6 M76 k40 k1,3 k3,2 k96
set 200916571716699 9,51383292%71%99312 Mb1,6 M75 k32 k1,6 k3,1 k80
ago 20091115170668618,31446292%71%2,3 k12 Mb1,6 M75 k25 k2,8 k3,1 k62
jul 200910 1 678662 5,21532593%73%4112 Mb1,6 M74 k13 k2,8 k3,1 k60
jun 20091012167566155,11533793%74%51412 Mb1,6 M74 k13 k2,8 k3,1 k60
mai 20099 2152250615,61384891%70%1538,1 Mb1,1 M52 k12 k2,2 k2,0 k51
abr 2009926247946475,81286891%70%5836,9 Mb945 k47 k12 k2,0 k1,6 k47
mar 2009713126725218,31050284%59%2913,3 Mb428 k21 k11 k91284633
fev 2009625222520938,5870981%55%7252,4 Mb295 k16 k10 k72462729
jan 20094 2114213018,4528274%39%305972 kb118 k5,7 k5,0 k27316018
dez 20084 511058828,5229962%21%452316 kb38 k1,7 k1,8 k1267414
nov 20084 2 5740 7,769249%4%4353 kb6,3 k20120715294
out 20084   5438 7,365448%4%749 kb5,8 k15919216264
set 20084   5338 7,366349%4%149 kb5,7 k15719216254
ago 20084   5338 7,366349%4% 49 kb5,7 k15719216254
jul 2008422 5338 7,366349%4%3749 kb5,7 k15719216254
jun 20082   5137 6,963649%2%1441 kb5,5 k1246510244
mai 20082 1 493516,962047%2%9839 kb5,1 k1156110174
abr 20082   2620 9,259446% 8321 kb2,6 k73261092
mar 20082   1813 8,656650% 2814 kb1,7 k6410912
fev 2008222 149 9,158250% 12711 kb1,3 k563912
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
The following table ranks this project in relation to projects in other languages with 1000+ articles
jan 2014161164192146179150164156142620410798100179206109236
out 2013161106151131177150152159242619110897100181205110236
jul 2013168139187134198172159871433197114100103171205117236
abr 201316797154150201172149651453184117101104175205118236
jan 2013168104134134197170147651392177126100104180209118236
out 2012169144162139201171153521342190132101106182213125236
jul 2012169100154144198171157611302192128101106182212124236
abr 201217013516514819716915066128119112698104180213117236
jan 201216715121013919916915365115119212398102179212115236
out 20111671311381401971671597019119112095100177211113236
jul 2011164106149143195163151791811861159599175208112236
abr 2011167128111131194159142851611821119095175205110236
jan 2011167134126126193155145961511781128994173208109236
out 20101641311191261891541351071511801108894169202103236
jul 20101651371561391851521561841761761741841098593167200103236
abr 2010164148117981821531441811751751741661088693165203105236
jan 201016684118971811571411801761761751191108795165193106236
out 2009187140124971831581491761751751741581128997167121104236
jul 2009208187181132180160150172171171170223108879620093104236
abr 2009206961121011881678317016916916817012699104197104119236
jan 2009227129160123209196140164163163162193190162163206180181236
out 2008225135191128215210142158157157155229226216218227222206236
jul 2008222101165133213206147152151151148219222212213226218201235
abr 2008226147202129221212148147146145143205224218219227221212235
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
 WikipedistasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikipedistas (usuários registrados)
A = Wikipedistas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikipedistas que editaram pelo menos dez vezes desde que chegaram
C = Wikipedistas que contribuíram cinco vezes ou mais este mês
D = Wikipedistas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Artigos que contêm pelo menos uma ligação interna e 200 caracteres de texto legível, não contando códigos wiki e html,
      ligações ocultas, etc.; títulos também não contam (outras colunas são baseadas no método oficial de contagem)
G = Novos artigos por dia no mês passado
H = Número médio de revisões por artigo
I = Tamanho médio dos artigos em bytes
J = Porcentagem de artigos com pelo menos 0,5 kb de texto legível (veja F)
K = Porcentagem de artigos com pelo menos 2 kb de texto legível (veja F)

Base de dados
L = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
M = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
N = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
O = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
P = Total de ligações para outras wikipédias
Q = Total de imagens apresentadas
R = Total de ligações para outros sítios
S = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  5  10  100  1000  1  3  5  10  25  100  250  1  3  5  10  25  100  250  1000  5  10  100  1000 
fev 20147         2       822         
jan 2014921    11  1       8211        
dez 2013104211      41      91          
nov 201313321       2       14211        
out 20131833        1       611         
set 20136322222     11      53111       
ago 201372211  2           622     21  
jul 20131021        1       41          
jun 201381111      421     51111   1   
mai 201316331111 1   41      10211111 21  
abr 201313332   43  1       11211    552 
mar 20138211111 972 522111  14542211 9411
fev 2013162211  1182 22954111 24632211 1081 
jan 20131254211  18123 62111   14532111 11113 
dez 20121043211  18123 211     104322   1091 
nov 2012162111  18132 1       8211    1081 
out 2012942    1483 1       1121     11103 
set 2012721    1382         911     982 
ago 20125     1072 4       711     961 
jul 201213431   1783 1       13211    12102 
jun 20121511    14122         1011     13102 
mai 2012142    17104 211     111      17132 
abr 201214321   16153 31      1111     1292 
mar 2012135322  16122 7111    146      13102 
fev 2012144211  20162 2       15421    12101 
jan 201292    15111 1       1011     12111 
jan 2014921    11  1       8211        
out 20131833        1       611         
jul 20131021        1       41          
abr 201313332   43  1       11211    552 
jan 20131254211  18123 62111   14532111 11113 
out 2012942    1483 1       1121     11103 
jul 201213431   1783 1       13211    12102 
abr 201214321   16153 31      1111     1292 
jan 201292    15111 1       1011     12111 
out 20111764    23161         1243     15123 
jul 2011123321  22132 3       94411   1191 
abr 201114763   14124 1       12541    121121
jan 20111055321  20143 41      175221   16144 
out 2010136531  17111 3       172211   1392 
jul 20101153    18121 3       103111   1182 
abr 20101065442  1581 1042     138533   1092 
jan 20101276652111592 9332    1610975211431 
out 20091244422  16121 84211   11532    43  
jul 200921111              1111        
abr 20096666421     3111    33322       
jan 2009322221      3111    54221       
out 2008                              
jul 20082222       1       41          
abr 20081                 21          

 

Distribuição de edições de artigos por wikipedistas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikipedistasEdições total
1389100.0%12,763100.0%
39524.4%12,33296.6%
105313.6%12,08194.7%
32287.2%11,62091.0%
100184.6%11,11687.1%
316102.6%9,45074.0%
100030.8%5,88746.1%

 

8 wikipedistas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdições 
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
 agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
Breogan2008UC122+6531--fev 02, 2013390----
DennissUC124+6631--jul 31, 2013211----
Marcus CyronUC126+25232--nov 13, 2013106----
Midnight GamblerUC127+6831--nov 19, 2013100----
KnochenUC199...22--jan 30, 201428----
Ralf RoletschekUC387...11--fev 05, 201422----
PauliJCUC388...11--fev 08, 201419----
Andrea Ortiz de DupuyUC389...11--fev 19, 20148----

 

20 wikipedistas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
  Primeira ediçãoúltima edição
 posiçãototaldatadias
atrás
datadias
atrás
PisonesUC12,092dez 06, 20091544mai 03, 2013300
CecílioUC22,071jul 29, 20082039fev 09, 20101479
ChabiUC31,724fev 24, 20082195jul 05, 2012602
SPQRobinUC4755fev 23, 20091830jun 03, 20111000
ZeEstevesUC5565set 14, 2013166set 16, 2013164
Manuel de SousaUC6553jan 24, 20101495mar 08, 2013356
GarsdUC7531jan 15, 2013408mar 24, 2013340
AmaralUC8395set 18, 2013162set 18, 2013162
HexadecimalUC9385abr 15, 2013318jun 03, 2013269
NaviaTVUC10379jan 25, 20101494mai 14, 20101385
El estremeñuUC11307set 20, 20091621jan 04, 20101515
CarnelianSuthUC12307nov 18, 2012466dez 12, 2012442
AlchimistaUC13271ago 13, 20091659mai 14, 2013289
EspadeiroUC14231set 08, 20091633abr 12, 2012686
Midnight GreenUC15159nov 16, 2011834ago 11, 2012565
MiguelcrUC16137fev 15, 20082204dez 30, 2011790
Isaac MansurUC17128nov 05, 20091575jan 16, 20101503
Bruno IshiaiUC18126mai 29, 20101370dez 01, 201388
Lodewijk VadacchinoUC1973nov 10, 20101205dez 30, 201359
D'ohBotUC2059set 07, 20091634set 06, 20101270

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 1.365 edições foram feitas por usuários anônimos, de um total de 47.253 edições ( 2e %)
  


50 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições 
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
 datadias
atrás
datadias
atrás
XqbotUC14,538set 01, 20091640mar 06, 2013358--
EmausBotUC23,875jun 26, 20101342jan 17, 201441--
Luckas-botUC33,421set 03, 20091638mai 20, 2012648--
MerlIwBotUC41,855mai 07, 20111027ago 08, 2013203--
WikitanvirBotUC51,545nov 07, 20101208abr 21, 2012677--
SieBotUC61,522ago 14, 20091658jan 25, 20111129--
ZéroBotUC71,421nov 03, 20101212mar 06, 2013358--
MelancholieBotUC81,362ago 13, 20091659nov 28, 20091552--
TXiKiBoTUC91,252set 21, 20091620jan 08, 2013415--
LegobotUC10840mar 11, 2013353abr 02, 2013331--
VolkovBotUC11833ago 16, 20091656fev 28, 2013364--
AddbotUC12752mar 07, 2013357ago 16, 2013195--
FoxBotUC13660out 03, 20091608fev 05, 2012753--
EscarbotUC14619mar 07, 20101453jan 25, 2013398--
TjBotUC15552nov 17, 20101198mar 06, 2013358--
ArthurBotUC16482ago 24, 20091648nov 17, 2011833--
RedBotUC17391set 08, 20101268ago 21, 2012555--
Ripchip BotUC18380mar 06, 20111089fev 18, 2012740--
HRoestBotUC19376jun 19, 20101349fev 14, 2013378--
Idioma-botUC20366out 30, 20091581fev 10, 2013382--
KamikazeBotUC21361jul 04, 20101334jan 24, 2013399--
AvocatoBotUC22349out 20, 2011861fev 27, 2013365--
JackieBotUC23292jan 15, 20111139mar 07, 2013357--
JAnDbotUC24285ago 14, 20091658jul 03, 2013239--
AlexbotUC25281ago 17, 20091655ago 14, 2011928--
Thijs!botUC26272mai 04, 20101395jul 30, 2012577--
LaaknorBotUC27270out 02, 20091609fev 16, 2013376--
RobbotUC28252set 23, 20091618jan 02, 2013421--
MjbmrbotUC29234out 15, 20101231mar 28, 20111067--
Movses-botUC30226dez 22, 20101163mar 18, 2012711--
RubinbotUC31203set 13, 20091628mar 02, 2013362--
CommonsDelinkerUC32196dez 25, 20081890fev 24, 20143--
Dinamik-botUC33179fev 14, 20101474dez 18, 2012436--
MastiBotUC34178dez 10, 20091540mar 01, 2013363--
GerakibotUC35172jan 11, 20101508mar 04, 2013360--
AvicBotUC36169jun 18, 2011985dez 09, 2012445--
JotterbotUC37159out 05, 20091606jan 24, 2013399--
VagobotUC38158out 18, 2011863set 19, 2012526--
AmirobotUC39131mai 04, 20101395nov 19, 2011831--
MystBotUC40122jan 23, 20101496fev 05, 2012753--
Makecat-botUC41120out 28, 2012487mar 04, 2013360--
YFdyh-botUC42109jun 18, 2012619fev 13, 2013379--
JhsBotUC43103mai 18, 20101381mar 29, 2012700--
HerculeBotUC44100ago 30, 20091642jul 13, 2012594--
CocuBotUC45100jun 09, 2011994dez 26, 2012428--
CarsracBotUC4695ago 16, 20091656fev 12, 2013380--
HiW-BotUC4791set 18, 2011893out 19, 2012496--
SilvonenBotUC4886set 08, 20091633dez 19, 2012435--
DSisyphBotUC4985nov 22, 20091558ago 27, 2012549--
JYBotUC5084mai 15, 2012653fev 12, 2013380--

 

Artigos que contêm pelo menos uma ligação interna e .. caracteres de texto legível, não contando códigos wiki e html,
ligações ocultas, etc.; títulos também não contam  (excluindo páginas de redirecionamento)

DataArtigos
 < 32 ch< 64 ch< 128 ch< 256 ch< 512 ch< 1 k ch< 2 k ch< 4 k ch< 8 k ch< 16 k ch< 32 k ch< 64 k ch
out 20107.5%11.1%12.9%15.4%19.6%28.7%41.8%56.0%69.1%81.6%91.0%97.4%
set 20107.6%11.1%13.1%15.4%19.4%28.5%41.6%55.7%68.7%81.2%90.9%97.4%
ago 20107.6%11.2%12.7%15.0%19.0%28.0%41.2%55.4%68.5%81.2%90.9%97.5%
jul 20107.6%11.1%12.6%15.0%19.0%27.6%40.9%55.1%68.3%81.0%90.8%97.4%
jun 20107.8%11.2%12.9%15.2%19.1%27.3%40.3%54.4%67.8%80.7%90.7%97.4%
mai 20107.8%11.2%13.0%15.3%19.2%27.3%40.5%54.6%67.9%80.9%90.7%97.4%
abr 20107.8%11.3%13.0%15.3%19.2%27.3%40.2%54.3%67.4%80.5%90.5%97.3%
mar 20107.1%10.5%12.3%14.7%18.5%26.2%39.4%53.0%66.5%80.1%90.4%97.2%
fev 20106.8%9.8%10.7%13.3%16.9%24.6%38.2%51.3%65.1%78.8%89.7%97.1%
jan 20106.6%9.1%10.1%12.7%16.1%23.5%37.3%50.6%64.5%78.1%89.2%96.9%
dez 20095.7%7.4%8.5%11.4%14.9%22.9%35.8%48.4%62.4%76.6%88.5%96.6%
nov 20095.5%7.2%8.3%11.2%14.8%23.1%36.0%48.6%62.4%76.6%88.5%96.6%
out 20093.9%4.9%5.4%8.2%11.7%19.9%33.3%46.5%61.0%75.9%88.2%96.5%
set 20092.2%2.7%3.2%5.9%9.4%17.3%30.5%44.0%59.0%74.9%87.8%96.2%
ago 20090.3%0.6%1.0%4.0%7.4%15.2%28.5%42.1%57.4%74.0%87.3%96.1%
jul 20090.1%0.5%0.8%3.9%6.7%14.1%26.3%38.8%54.9%72.4%86.2%95.6%
jun 20090.1%0.5%0.8%3.9%6.6%14.0%26.2%38.7%54.8%72.4%86.3%95.7%
mai 20090.2%1.2%1.6%5.1%8.4%17.0%29.9%42.2%56.6%74.3%87.5%97.5%
abr 20090.2%1.2%1.6%5.2%8.8%17.4%29.7%41.6%55.6%74.0%88.2%98.0%
mar 20090.4%2.3%3.1%8.8%15.2%27.3%40.1%52.9%62.3%77.4%90.6%98.9%
fev 20090.4%2.2%3.5%10.7%17.4%30.9%44.4%58.3%66.8%82.0%91.9%99.5%
jan 20090.7%4.1%6.2%17.2%26.9%44.8%61.4%73.1%78.6%88.3%95.9%100.0%
dez 20081.0%8.6%11.5%25.8%38.2%61.1%79.2%88.7%91.6%96.4%100.0%100.0%
nov 20081.8%18.2%23.7%38.2%49.1%76.4%96.4%100.0%100.0%100.0%100.0%100.0%
out 20083.8%18.9%24.6%39.7%51.0%79.3%96.3%100.0%100.0%100.0%100.0%100.0%
set 20083.8%19.2%25.0%38.5%50.0%78.8%96.1%99.9%99.9%99.9%99.9%99.9%
ago 20083.8%19.2%25.0%38.5%50.0%78.8%96.1%99.9%99.9%99.9%99.9%99.9%
jul 20083.8%19.2%25.0%38.5%50.0%78.8%96.1%99.9%99.9%99.9%99.9%99.9%
jun 20083.9%19.6%25.5%37.3%51.0%80.4%98.0%100.0%100.0%100.0%100.0%100.0%
mai 20084.1%20.4%26.5%38.7%53.0%81.6%97.9%99.9%99.9%99.9%99.9%99.9%
abr 20080.0%11.5%15.3%34.5%53.7%84.5%99.9%99.9%99.9%99.9%99.9%99.9%
mar 20080.0%5.6%11.2%33.4%50.1%89.0%100.0%100.0%100.0%100.0%100.0%100.0%
fev 20080.0%7.7%15.4%38.5%46.2%84.7%100.0%100.0%100.0%100.0%100.0%100.0%

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110Png
fev 20143,1 k8117221877362,2 k      92
jan 20143,1 k8047221877332,2 k      172
dez 20133,1 k7927221877332,2 k      502
nov 20133,1 k7887221877332,2 k      352
out 20133,1 k7777121877332,2 k      392
set 20133,1 k7697121877332,2 k      9662
ago 20132,1 k7427121877332,2 k      472
jul 20132,1 k7397121877332,2 k      202
jun 20132,1 k7337121877332,2 k      952
mai 20132,0 k7287121871232,2 k      3122
abr 20131,9 k7207121846732,2 k      462
mar 20131,9 k7087121845932,2 k      3182
fev 20131,8 k5916521845932,2 k      552
jan 20131,8 k5695621845622,2 k      2322
dez 20121,8 k5525121645622,1 k      2522
nov 20121,6 k5365111643222,1 k      1141
out 20121,6 k5345111641722,1 k      271
set 20121,6 k5295111541712,1 k      171
ago 20121,6 k5215111541712,1 k      61
jul 20121,6 k5105111541712,1 k      451
jun 20121,5 k5015111541612,1 k      261
mai 20121,5 k4865111541612,1 k      241
abr 20121,5 k4725111541612,1 k      371
mar 20121,5 k4535111541612,1 k      1061
fev 20121,5 k4455111541512,1 k      941
jan 20121,5 k4225111541512,1 k      181
dez 20111,5 k4115111541512,1 k      681
nov 20111,4 k4055111441212,1 k      661
out 20111,4 k3865111441212,1 k      461
set 20111,4 k3735111341112,1 k      121
ago 20111,4 k3605111341012,1 k      451
jul 20111,4 k3535111341012,1 k      611
jun 20111,4 k3405111140912,1 k      151
mai 20111,4 k3365111140812,0 k      351
abr 20111,4 k3255111140712,0 k      791
mar 20111,3 k3125111140612,0 k      571
fev 20111,3 k3025111038012,0 k      301
jan 20111,3 k291511738012,0 k      2631
dez 20101,3 k280491337612,0 k      171
nov 20101,3 k275491337612,0 k      161
out 20101,2 k263491237612,0 k      891
set 20101,2 k249481234412,0 k      571
ago 20101,2 k238481234412,0 k      231
jul 20101,2 k219481234312,0 k      361
jun 20101,2 k214481234112,0 k      421
mai 20101,2 k185481233912,0 k      841
abr 20101,2 k180481233512,0 k      4871
mar 20101,1 k166481230312,0 k      4641
fev 20101,0 k149441223912,0 k      2751
jan 2010962137291221111,9 k      17661
dez 200987410626122001813      1991
nov 20098679626122001797      5891
out 20098388824121911178      3491
set 20097968023121881167      4601
ago 20097684922111871166      9761
jul 2009737116  1501150      37 
jun 2009734116  1501149      507 
mai 200957214  100 127      139 
abr 200952514  97 114      570 
mar 200929914  89 77      270 
fev 200925314  74 76      668 
jan 200915513  63 66      268 
dez 200811413  50 27      369 
nov 200856 1  22 6      42 
out 200852 1  19 4        
set 200851 1  19 4        
ago 200851 1  19 4        
jul 200851 1  19 4      31 
jun 200849 1  19 3        
mai 200847 1  19 3      26 
abr 200825 1  19 1      1 
mar 200817 1  16 1      4 
fev 200814 1  16          

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

fev 2008: 1 3 Páigina Percipal , 2 2 Picuote , 3 1 Bumioso

mar 2008: 1 1 Lhéngua Mirandesa

abr 2008: 1 1 Abusejo

mai 2008: 1 1 Sociadade

jul 2008: 1 1 Cumputador

nov 2008: 1 3 Páigina Percipal , 2 2 Pertual , 3 2 Lhéngua Mirandesa , 4 1 Spanha

dez 2008: 1 4 Declaraçon Ounibersal de ls Dreitos Houmanos , 2 3 Ágreda , 3 3 Zenízio , 4 2 Spanha , 5 2 Quim Barreiros , 6 2 Cumputador , 7 2 Cebadeiros , 8 2 Bumioso , 9 2 Braga , 10 2 Bernardo Fernandes Monteiro , 11 2 Auga , 12 2 António Lobo Antunes , 13 2 Almazán , 14 2 Agallas , 15 2 Abusejo , 16 2 Abejar , 17 2 Poema La Lhéngua Mirandeza , 18 2 Nuossa Alma i Nuossa Tierra , 19 2 Manuel Sardinha , 20 2 Lhéngua Mirandesa , 21 2 La Pertuesa-Hino Nacional , 22 2 João Penha , 23 2 Joaquim Araújo , 24 2 Gaspar Arce

jan 2009: 1 2 Stória de Roma , 2 2 Stados Ounidos de la América , 3 2 Religion , 4 2 Ciéncia , 5 2 Bíblia , 6 2 Berlin , 7 2 Bandeira de Pertual , 8 2 Anternete , 9 2 Angenharie , 10 2 Andústria , 11 2 Agricultura , 12 2 Ouropa , 13 2 Nuoba Iorque , 14 2 Medio Ouriente , 15 2 Londres

fev 2009: 1 3 Sociadade , 2 3 Die de ls namorados , 3 3 Çporto , 4 2 Stória de l Crestianismo , 5 2 San Balantin , 6 2 Salude , 7 2 Rússia , 8 2 Quemido , 9 2 Cristandade , 10 2 Crestianismo , 11 2 Clima , 12 2 Ciéncias Sociales , 13 2 Cidade , 14 2 Charles Darwin , 15 2 Catolicismo , 16 2 Biologie , 17 2 Astronomie , 18 2 Artes Bisuales , 19 2 Arquitetura , 20 2 Antártica , 21 2 Anternete , 22 2 Amílcar Cabral , 23 2 América de l Norte , 24 2 Portestantismo , 25 2 Política

mar 2009: 1 3 Sendin , 2 2 Riu , 3 2 Cuntinente , 4 2 Assemblé de Dius , 5 2 Arma , 6 2 Almairo , 7 2 Paíç , 8 2 Miranda de l Douro , 9 2 Ls Lusíadas , 10 2 Lhéngua Mirandesa , 11 2 Ilha , 12 1 Sun Tzu

abr 2009: 1 3 Sismo , 2 3 Ampério Romano , 3 3 Ampério Bizantino , 4 3 Ouclides , 5 3 Max Ernst , 6 3 Luna , 7 3 Houlocausto , 8 3 Eidade de la Piedra , 9 2 Suméria , 10 2 Stendhal , 11 2 Sploraçon spacial , 12 2 Sociologie , 13 2 Siddhartha Gautama , 14 2 Sexismo , 15 2 Segunda Guerra Mundial , 16 2 Saturno , 17 2 Roald Amundsen , 18 2 Renacimiento , 19 2 Reboluçon Francesa , 20 2 Cordilheira de ls Andes , 21 2 Cleópatra , 22 2 Claude Monet , 23 2 Carl Friedrich Gauss , 24 2 Capitalismo , 25 2 Blaise Pascal

mai 2009: 1 2 Batailha de Aljubarrota , 2 2 Paç , 3 2 Oucránia , 4 2 Páigina Percipal , 5 1 Stória de la Rússia

jun 2009: 1 3 Reboluçon Amaricana de 1776 , 2 3 Antoine Lavoisier , 3 2 Stória de Pertual , 4 2 Stados Cunfederados de la América , 5 2 Caçareilhos , 6 2 Campo de Bíboras , 7 2 Bal de Frailes , 8 2 Apartheid , 9 2 Albert Einstein , 10 2 Planeta , 11 2 Pinelo , 12 2 Matela (Bumioso) , 13 2 Fiódor Dostoiévski , 14 2 Eça de Queirós , 15 1 Sílex

jul 2009: 1 1 Sikhismo

ago 2009: 1 4 Lhéngua mirandesa , 2 4 Páigina Percipal , 3 3 Wikipedia , 4 3 Brigham Young , 5 3 Antigos macedónios , 6 3 Pertual , 7 3 Eisrael , 8 2 Nefita , 9 2 Templo de Curitiba , 10 2 Stória de la Oustrália , 11 2 Stória de Cabo Berde , 12 2 Storiografie , 13 2 Stados Ounidos de la América , 14 2 Santos de ls Redadeiros Dies , 15 2 Rússia , 16 2 Roma Antiga , 17 2 Riu Missouri , 18 2 Custantino I , 19 2 Crestianismo , 20 2 Cordilheira de ls Andes , 21 2 Che Guevara , 22 2 Charles de Gaulle , 23 2 Carlos I de Spanha , 24 2 Blaise Pascal , 25 2 Bernhard Riemann

set 2009: 1 9 Lhéngua lhionesa , 2 3 Monarquie , 3 3 Lhéngua mirandesa , 4 2 Lhéngua almana , 5 2 Mórmones Fundamentalistas , 6 2 Casa de Lhion , 7 2 Anielho de l CTR , 8 2 Lhista de reis de Pertual , 9 2 Stória de Eisrael , 10 2 Stados Ounidos de la América , 11 2 Cunfucionismo , 12 2 Cleópatra , 13 2 Claude Monet , 14 2 Che Guevara , 15 2 Charles de Gaulle , 16 2 Charles Darwin , 17 2 Cao Dai , 18 2 Bíblia , 19 2 Budismo , 20 2 Berlin , 21 2 Bandeira de Pertual , 22 2 Análeze Matemática , 23 2 Andependéncia de l Brasil , 24 2 América de l Sul , 25 2 Albrecht Dürer

out 2009: 1 3 Frente Nacional para la Lhibertaçon de l Bietname , 2 2 Terça-feira , 3 2 Cultura pertuesa , 4 2 Quarta-feira , 5 2 Cannibal Corpse , 6 2 Alfabeto Fonético Anternacional , 7 2 Lheite , 8 2 Alman , 9 2 Causo genitibo , 10 2 Aníbal Barca , 11 2 Biseu , 12 2 Lhéngua stremenha , 13 2 Lhéngua asturiana , 14 2 Rede Manchete , 15 2 Stória de la quelonizaçon de las Américas , 16 2 Speranto , 17 2 Reboluçon Amaricana de 1776

nov 2009: 1 3 Lhéngua rapa nui , 2 3 Machado de Assis , 3 3 Lhéngua mirandesa , 4 2 Piotr Tchaikovski , 5 2 Templo de Nauvoo , 6 2 Ludwig van Beethoven , 7 2 Moai , 8 2 Terça-feira , 9 2 Quarta-feira , 10 2 Cannibal Corpse , 11 2 Leonel Brizola , 12 2 Saturno , 13 2 Roma , 14 2 Racismo , 15 2 Cristandade , 16 2 Crestianismo , 17 2 Chamamientos crestianos , 18 2 Bikings , 19 2 Auga , 20 2 Animal , 21 2 Planta , 22 2 Paç , 23 2 Ounion Africana , 24 2 Ouniberso , 25 2 Ouceano Pacífico

dez 2009: 1 2 Cannibal Corpse , 2 2 Pertual , 3 2 Paris , 4 1 Ls Santos de ls Redadeiros Dies

jan 2010: 1 4 Brasil Quelónia , 2 4 Bergança , 3 3 Timor-Leste , 4 3 San Tomé i Príncepe , 5 3 Moçambique , 6 3 Guiné-Bissau , 7 3 Bila Nuoba de Gaia , 8 3 Cristobo Colombo , 9 3 Dreito público , 10 3 Casa de Lhion , 11 3 Cuntinente , 12 3 Cuba , 13 3 Capitalismo , 14 3 Cachones de l Niágara , 15 3 Bumioso , 16 3 Bodun , 17 3 Bie Látea , 18 3 Bahamas , 19 3 Baca , 20 3 Abicena , 21 3 Andependéncia de l Kosobo , 22 3 América , 23 3 Fé Bahá'í , 24 3 Fonso I de Pertual , 25 3 Eiboluçon

fev 2010: 1 3 Louis Pasteur , 2 3 Francis Bacon (filósofo) , 3 3 Vasco da Gama , 4 3 Mobilha , 5 2 Sistema Brasileiro de Televisão , 6 2 Disney Club , 7 2 Mar de Timor , 8 2 Cacau , 9 2 Cundado Portucalense , 10 2 René Descartes , 11 2 Francesco Redi , 12 2 Nicolau Copérnico , 13 2 René Çcartes , 14 2 Miguel Ángelo , 15 1 San Paulo

mar 2010: 1 3 Ampério pertués , 2 3 Lhista de reis de Lhion , 3 3 Afonso de Albuquerque , 4 3 Pedro Álvares Cabral , 5 3 Bartolomeu Dias , 6 3 Ramiro I de las Astúrias , 7 3 Londres , 8 3 Guerra Cebil Amaricana , 9 2 Region de Turismo de l Nordeste Trasmuntano , 10 2 Banco Ouropeu de Ambestimiento , 11 2 Comité Eiquenómico i Social Ouropeu , 12 2 Tribunal de Cuontas Ouropeu , 13 2 Tribunal de Justícia de la Ounion Ouropeia , 14 2 Comisson Ouropeia , 15 2 Carlos Ferreira , 16 2 Domingos Raposo , 17 2 Tratado de Roma , 18 2 Quemunidade Eiquenómica Ouropeia , 19 2 Quemunidade Ouropeia de l Carbon i de l Aço , 20 2 Asterix l Goulés , 21 2 San Poulo , 22 2 Península Eibérica , 23 2 Hip hop , 24 2 Rap , 25 2 José Rodrigues

abr 2010: 1 3 Barbacena , 2 3 Grande Barreira de Coral , 3 3 Montes Urales , 4 3 Jean Monnet , 5 3 Rómulo Ougusto , 6 3 Javier Solana , 7 3 Política de Defesa i de Sigurança Quemun , 8 3 Parlamiento Ouropeu , 9 3 Reino de la Galiza , 10 3 Reboluçon Russa de 1917 , 11 2 Defesa pessonal , 12 2 Hans Christian Andersen , 13 2 Reino de Kent , 14 2 Mar Cáspio , 15 2 San José (Paulínia) , 16 2 Ilhas Británicas , 17 2 Península , 18 2 Riu Ural , 19 2 Capital , 20 2 Tierra Caliente , 21 2 Tierra Frie , 22 2 Gran-ducado de la Toscana , 23 2 Tribunal de Justícia de la Ounion Ouropeia , 24 2 Comisson Ouropeia , 25 2 Ambason muçulmana de la península Eibérica

mai 2010: 1 3 Stória de Sacaben , 2 3 Lhéngua mirandesa , 3 2 Whiteberry , 4 2 Laura Pausini , 5 2 Abade de Baçal , 6 2 Mário Correia , 7 2 Cungregaçon Crestiana an Pertual , 8 1 Riu Teijo

jun 2010: 1 2 Assemblé de Dius , 2 1 Diogo Cão

jul 2010: 1 2 Branco , 2 2 Recén-nacido , 3 1 Bietname

ago 2010: 1 2 Sacaben , 2 1 António Fragoso

set 2010: 1 4 Japon , 2 3 The Beatles , 3 2 Alcoron , 4 1 Tequixquiac

out 2010: 1 3 Mérida (Benezuela) , 2 2 Appert , 3 1 Riu Sado

nov 2010: 1 2 Spanha , 2 1 Vepric

dez 2010: 1 1 ETA

jan 2011: 1 3 Concepción , 2 3 Amplantaçon de la República Pertuesa , 3 2 Çtrito de Portalegre , 4 2 Çtrito de Lhisboua , 5 2 Çtrito de Lheirie , 6 2 Çtrito de la Guarda , 7 2 Çtrito de Faro , 8 1 `Abdu'l-Bahá

fev 2011: 1 3 Aritmética , 2 1 Pertual Cuntinental

mar 2011: 1 2 Asturo-lheonés , 2 1 Lech Wałęsa

abr 2011: 1 2 Mimas , 2 2 Homo sapiens , 3 2 Almanha , 4 2 Concepción , 5 2 Io , 6 2 Monarquie , 7 1 Jonh Lennon

mai 2011: 1 2 Rede Globo , 2 1 Polónia

jun 2011: 1 2 Ounibersidade de l Bío-Bío , 2 1 Talcahuano

jul 2011: 1 2 Galandum Galundaina , 2 1 KrioRus

ago 2011: 1 2 Polónia , 2 2 Maomé , 3 1 Sergey Bryukhonenko

set 2011: 1 1 Anterlhéngua

out 2011: 1 2 Paltoga , 2 2 Stória de l Brasil , 3 2 Brasil República , 4 2 Ancunfidéncia Mineira , 5 1 Ludmilla Radchenko

nov 2011: 1 2 Ouceano Atlántico , 2 1 Marie-George Buffet

dez 2011: 1 2 Riu Danúbio , 2 2 Mobelizaçon studantil ne l Chile an 2011 , 3 1 Riu Reno

jan 2012: 1 2 Frances Ruffelle , 2 2 Miro Šmajda , 3 1 Slobáquia

fev 2012: 1 3 Anastacia , 2 2 Sofia Vitória , 3 2 Tejeira , 4 2 Eva Gonzalès , 5 2 Armando Gama , 6 2 Eduardo Nascimento , 7 2 Madalena Iglésias , 8 2 Festibal Ourobison de la Cançon , 9 1 Voyage Voyage

mar 2012: 1 3 Paranaguá , 2 2 Bulgária , 3 2 Eislándia , 4 2 Grécia , 5 2 Coca-Cola , 6 2 Adelaide Ferreira , 7 2 Flor-de-Lis (banda) , 8 1 2B (duo)

abr 2012: 1 2 Buranovskiye Babushki , 2 2 Catona , 3 2 Riu Bolga , 4 1 Bomba atómica

mai 2012: 1 3 Rei Momo , 2 2 François Hollande , 3 1 Rafael Correa

jun 2012: 1 3 Avril Lavigne , 2 2 Wikipedia , 3 1 Should've Known Better

jul 2012: 1 2 Anielho de tucun

ago 2012: 1 1 Pussy Riot

set 2012: 1 2 Riu Biobío , 2 1 Guilin

out 2012: 1 2 Caselle Landi , 2 2 Semitério de Pistoia , 3 1 Lu Xun

nov 2012: 1 1 Staçon Spacial Anternacional

dez 2012: 1 2 Orlando Drummond , 2 1 Frei Betto

jan 2013: 1 2 Maccastorna , 2 2 Meleti , 3 1 Zhuang(etnia)

fev 2013: 1 2 Lhéngua mirandesa , 2 1 WP:BF

mar 2013: 1 2 Pardo de Cela , 2 2 Eislándia , 3 1 Xuxa

abr 2013: 1 1 Atentado na maratora de Boston

mai 2013: 1 1 Midlands Oucidentales

jun 2013: 1 1 Ilha de Wight

jul 2013: 1 1 Paramore

ago 2013: 1 1 Souto de Aguiar de la Beira i Balberde

set 2013: 1 2 Mobeliário , 2 1 Copa de la Ásia de 2007

out 2013: 1 1 Sung Jae-ki

nov 2013: 1 1 Paróquia de Bienville\\

dez 2013: 1 2 Coreca

jan 2014: 1 1 Monçon (Pertual)

fev 2014: 1 1 Guapo Hourizonte

No data on this page have been normalized to 30 day months (as WMF does on certain traffic reports).
Wikipedias are initially ordered by number of speakers of the language

Speakers: Number of speakers of a language is the estimated total of primary and secondary speakers, is in many cases a very rough estimation (based on the page on the English Wikipedia about that language)
Regions are parts of the world where the language is spoken in substantial amounts (compared to total number of speakers). Regions where a language gained presence only by a recent diaspora are generally not included.
Region codes: AF:Africa, AS:Asia, EU:Europe, NA:North America, OC:Oceania, SA:South America, W:World Wide, CL:Constructed Language

Estatísticas geradas em Quarta-feira, 2 de abril 2014 14:09

Dump file mwlwiki-20140303-stub-meta-history.xml.gz (edits only), size 6.1 Mb as gz -> 39 Mb
Dump processed till Feb 28, 2014, on server stat1002, ready at Fri-14/03/2014-10:48 after 35 sec.

Versão do script:2.6
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.