Estatísticas da Wikipédia mirandese

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Articles per size range / Records per namespace / Most edited articles / Zeitgeist

Most metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.

Some metrics have been collected from the full archive dump which runs on lower frequency than the usual monthly cycle.
These metrics are columns F,I,J,K,M,N,O,P,Q,R from the first table.


See also metrics definitions


 
Monthly counts & Quarterly rankings: outubro 2014
 
DataWikipedistasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
Oct 20140%   0%             +1%
Sep 2014+2%   0%      +3%      0%
Jun 20140%   0%      -19%      0%
May 20140%   0%      +3%      0%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P____Q____R____S__
Oct 201455   2,8 k  17,1   19      372
Sep 20145512 2,8 k  17,1   31      370
Aug 201454 1 2,8 k  17,1   30      370
Jul 201454   2,8 k  17,1   15      370
Jun 201454   2,8 k  17,1   30      370
May 201454   2,8 k  17,1   37      370
Apr 201454 1 2,8 k 117,1   36      370
Mar 20145412 2,7 k  17,2   45      369
Feb 201453   2,7 k2,6 k 17,3685484%50%4622 Mb3,1 M148 k4472099,8 k369
Jan 201453 1 2,7 k2,5 k 17,3687484%51%3622 Mb3,1 M148 k4462019,8 k363
Dec 20135312 2,7 k2,5 k 17,3687684%51%5722 Mb3,1 M148 k5001919,8 k362
Nov 20135212 2,7 k2,5 k 17,3688984%51%5522 Mb3,1 M148 k5001919,8 k358
Oct 20135123 2,7 k2,5 k 17,4691684%50%4322 Mb3,1 M147 k5001919,8 k353
Sep 2013492222,7 k2,5 k3217,4692584%51%97122 Mb3,1 M147 k4661899,8 k352
Aug 20134712 1,7 k1,6 k126,4811981%57%6317 Mb2,4 M115 k3941876,5 k352
Jul 201346 1 1,7 k1,6 k 26,9812083%58%3317 Mb2,4 M115 k6551856,4 k352
Jun 201346 1 1,7 k1,6 k126,9813383%58%10517 Mb2,4 M115 k6771826,4 k350
May 201346 311,7 k1,6 k427,4828083%58%32617 Mb2,4 M115 k7061826,4 k341
Apr 20134623 1,6 k1,4 k129,2822382%57%17115 Mb2,2 M109 k6981816,0 k314
Mar 201344 111,5 k1,4 k129,5828682%58%2,0 k15 Mb2,2 M109 k2,9 k1795,9 k314
Feb 201344 2 1,5 k1,4 k 29844083%59%74118 Mb2,2 M108 k90 k1495,8 k313
Jan 2013442411,5 k1,4 k128,5844583%59%1,2 k18 Mb2,2 M108 k90 k1495,8 k310
Dec 2012421311,5 k1,4 k428,1850684%60%1,0 k18 Mb2,2 M108 k88 k1495,8 k309
Nov 20124111 1,3 k1,3 k230,1860384%58%86816 Mb2,0 M99 k83 k1374,8 k294
Oct 201240 2 1,3 k1,2 k 30,6854883%57%81015 Mb1,9 M95 k79 k904,4 k286
Sep 201240 1 1,3 k1,2 k 30,2856683%57%65315 Mb1,9 M95 k79 k934,4 k286
Aug 201240   1,3 k1,2 k 29,9861683%57%65715 Mb1,9 M95 k78 k944,3 k286
Jul 20124023 1,3 k1,2 k 29,4862184%57%83315 Mb1,9 M95 k78 k954,3 k286
Jun 201238 1 1,3 k1,2 k 29867883%57%80915 Mb1,9 M95 k77 k974,3 k286
May 201238   1,3 k1,2 k 28,4869684%58%77215 Mb1,9 M95 k76 k924,3 k285
Apr 201238 2 1,3 k1,2 k 27,9870684%58%86115 Mb1,9 M95 k76 k914,3 k285
Mar 201238 3 1,2 k1,2 k127,4899384%58%95016 Mb2,0 M95 k75 k924,3 k285
Feb 20123812 1,2 k1,1 k127,2916185%59%82815 Mb2,0 M95 k73 k954,3 k284
Jan 201237   1,2 k1,1 k 27,5943288%61%61215 Mb2,0 M95 k71 k934,2 k283
Dec 20113712 1,2 k1,1 k 27,1945988%61%85015 Mb2,0 M95 k71 k914,2 k283
Nov 20113614 1,2 k1,1 k126,6951288%61%92215 Mb2,0 M94 k70 k914,2 k283
Oct 20113514 1,1 k1,1 k 26,2958989%62%80515 Mb1,9 M94 k69 k884,2 k278
Sep 201134   1,1 k1,1 k 25,8967189%62%58815 Mb1,9 M94 k68 k854,1 k276
Aug 201134 4 1,1 k1,1 k 25,3968889%62%71515 Mb1,9 M93 k68 k874,1 k274
Jul 20113423 1,1 k1,1 k124,8972189%62%88915 Mb1,9 M93 k68 k874,1 k274
Jun 2011321  1,1 k1,1 k 24,7994490%64%89915 Mb1,9 M93 k66 k864,0 k273
May 201131 2 1,1 k1,0 k 24,1995390%64%76715 Mb1,9 M93 k65 k944,0 k272
Apr 20113116 1,1 k1,0 k123,4996190%64%82715 Mb1,9 M93 k65 k923,9 k271
Mar 201130 2 1,1 k1,0 k 23,1996991%64%96215 Mb1,9 M91 k63 k923,8 k270
Feb 201130 1 1,1 k1,0 k 22,31001191%64%69814 Mb1,9 M91 k62 k883,8 k270
Jan 2011301511,0 k1,0 k121,81008491%64%1,3 k14 Mb1,9 M91 k61 k913,8 k268
Dec 201029 1 1,0 k987 211033391%65%75314 Mb1,9 M91 k60 k903,8 k244
Nov 201029 1 1,0 k978 20,51039191%66%64514 Mb1,9 M90 k59 k913,8 k243
Oct 20102915 1,0 k975119,91042491%66%70214 Mb1,9 M90 k59 k963,8 k241
Sep 20102824 992959 19,51055791%66%71914 Mb1,9 M90 k57 k973,8 k239
Aug 201026 1 977951 19,11061592%67%98014 Mb1,9 M89 k56 k973,7 k236
Jul 20102613 967941 18,31068492%67%70914 Mb1,9 M89 k55 k1023,7 k235
Jun 20102511 952925 17,81083692%68%73014 Mb1,8 M89 k54 k1083,7 k233
May 201024 3 947918 17,11079891%67%72814 Mb1,8 M88 k53 k1093,6 k233
Apr 201024 52935908116,61091191%68%1,1 k14 Mb1,8 M88 k52 k1083,6 k232
Mar 201024281907880315,81121692%68%1,3 k14 Mb1,8 M87 k51 k1463,6 k220
Feb 201022 9 8178011161188393%69%85213 Mb1,7 M81 k46 k1573,4 k188
Jan 201022362791775115,51211193%70%2,3 k13 Mb1,7 M79 k45 k1663,3 k171
Dec 200919241754737 13,21275892%70%83812 Mb1,7 M77 k42 k2763,3 k120
Nov 200917141750733 12,11275892%69%1,2 k12 Mb1,6 M76 k41 k6173,3 k117
Oct 200916 42742723110,71329992%70%1,1 k12 Mb1,6 M76 k40 k1,3 k3,2 k96
Sep 200916571716699 9,51383292%71%99312 Mb1,6 M75 k32 k1,6 k3,1 k80
Aug 20091115170668618,31446292%71%2,3 k12 Mb1,6 M75 k25 k2,8 k3,1 k62
Jul 200910 1 678662 5,21532593%73%4112 Mb1,6 M74 k13 k2,8 k3,1 k60
Jun 20091012167566155,11533793%74%51412 Mb1,6 M74 k13 k2,8 k3,1 k60
May 20099 2152250615,61384891%70%1538,1 Mb1,1 M52 k12 k2,2 k2,0 k51
Apr 2009926247946475,81286891%70%5836,9 Mb945 k47 k12 k2,0 k1,6 k47
Mar 2009713126725218,31050284%59%2913,3 Mb428 k21 k11 k91284633
Feb 2009625222520938,5870981%55%7252,4 Mb295 k16 k10 k72462729
Jan 20094 2114213018,4528274%39%305972 kb118 k5,7 k5,0 k27316018
Dec 20084 511058828,5229962%21%452316 kb38 k1,7 k1,8 k1267414
Nov 20084 2 5740 7,769249%4%4353 kb6,3 k20120715294
Oct 20084   5438 7,365448%4%749 kb5,8 k15919216264
Sep 20084   5338 7,366349%4%149 kb5,7 k15719216254
Aug 20084   5338 7,366349%4% 49 kb5,7 k15719216254
Jul 2008422 5338 7,366349%4%3749 kb5,7 k15719216254
Jun 20082   5137 6,963649%2%1441 kb5,5 k1246510244
May 20082 1 493516,962047%2%9839 kb5,1 k1156110174
Apr 20082   2620 9,259446% 8321 kb2,6 k73261092
Mar 20082   1813 8,656650% 2814 kb1,7 k6410912
Feb 2008222 149 9,158250% 12711 kb1,3 k563912
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
The following table ranks this project in relation to projects in other languages with 1000+ articles
Note: data for month(s) after Sep 2014 for one or more large projects are not yet known.
As a temporary approximation missing data for a project are substituted by the highest historic value for that project.
Once those missing data are available final rankings for recent months can shift one or more positions.
Jul 2014164   184  156   220      239
Apr 2014162 199 180 145159   210      239
Jan 201416216318614518015915916015310202114105107188218116239
Oct 201316110415112917815915016325210189115104107193218117239
Jul 2013167140187135198182160911533197121107110183218124239
Apr 201316699153150201182149701554185124108111185218125239
Jan 2013167105132133198180146691492178133107111191222125239
Oct 2012170143160140204181153581442193139108113193225132239
Jul 2012170100155144200182155651402193135108113193224131239
Apr 2012169135165147197179151701381193133105111191226124239
Jan 2012168153216139201179150691221197130105109191225122239
Oct 2011167130137143200178157741151196127102107189224120239
Jul 2011165108148144198175151831151189122102106186222119239
Apr 201116913011113219716914290111118511897102185220117239
Jan 201116613312512619516314210018118111996101183223116239
Oct 201016513612213219116214011118118711795101179217110239
Jul 201016713615614018716015618618518418218711692100177216110239
Apr 2010168151118971831591441831821811801671139198173217110239
Jan 201017083118971851621401811811801791191149199172205110239
Oct 2009190143123971861601491781781771761591139098171122105239
Jul 2009209190182132183162150172172171170225109889720494105239
Apr 20092069611210319116983170170169168173128100105201105120239
Jan 2009225132161124215202139164164163162197193166166214181185238
Oct 2008222134195128222216144158158157156229228220223228225212236
Jul 2008220100163132220211145152152151149222225217218227222208235
Apr 2008225145201130224217149147147145143209226220223228224217235
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
 WikipedistasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikipedistas (usuários registrados)
A = Wikipedistas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikipedistas que editaram pelo menos dez vezes desde que chegaram
C = Wikipedistas que contribuíram cinco vezes ou mais este mês
D = Wikipedistas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Artigos que contêm pelo menos uma ligação interna e 200 caracteres de texto legível, não contando códigos wiki e html,
      ligações ocultas, etc.; títulos também não contam (outras colunas são baseadas no método oficial de contagem)
G = Novos artigos por dia no mês passado
H = Número médio de revisões por artigo
I = Tamanho médio dos artigos em bytes
J = Porcentagem de artigos com pelo menos 0,5 kb de texto legível (veja F)
K = Porcentagem de artigos com pelo menos 2 kb de texto legível (veja F)

Base de dados
L = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
M = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
N = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
O = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
P = Total de ligações para outras wikipédias
Q = Total de imagens apresentadas
R = Total de ligações para outros sítios
S = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  5  10  100  1000  1  3  5  10  25  100  250  1  3  5  10  25  100  250  1000  5  10  100  1000 
Monthly counts for recent history of wiki
Oct 201410         1       3           
Sep 20148221       31      832         
Aug 20146111       1       411         
Jul 20145         1       2           
Jun 2014113    11          511         
May 2014111    11          21          
Apr 20147111       1       6           
Mar 201411221       2       7           
Feb 20147         2       821         
Jan 2014921    11  1       8211        
Dec 2013104211      41      91          
Nov 201313321       2       12211        
Oct 20131833        1       511         
Sep 20136322222     11      5311        
Aug 201362211  2           622     21  
Jul 20131021        1       41          
Jun 201381111      421     51111   1   
May 201316331111 1   41      10211111 21  
Apr 201313332   43  1       11211    552 
Mar 20138211111 972 522111  14542211 9411
Feb 2013162211  1182 22954111 22632211 1081 
Jan 20131254211  18123 62111   13532111 11113 
Dec 20121043211  18113 211     104322   1091 
Nov 2012151111  18132 1       8211    1081 
Oct 2012942    1483 1       1121     11103 
Sep 2012721    1382         91      982 
Aug 20125     1072 4       611     961 
Jul 201213431   1783 1       13211    12102 
Jun 20121511    14122         1011     13102 
May 2012142    17104 211     111      17132 
Apr 201214321   16153 31      1011     1292 
Mar 2012135322  16122 7111    146      13102 
Feb 2012144211  20162 2       1542     12101 
Jan 201292    15111 1       1011     12111 
Quarterly counts for entire history of wiki
Oct 201410         1       3           
Jul 20145         1       2           
Apr 20147111       1       6           
Jan 2014921    11  1       8211        
Oct 20131833        1       511         
Jul 20131021        1       41          
Apr 201313332   43  1       11211    552 
Jan 20131254211  18123 62111   13532111 11113 
Oct 2012942    1483 1       1121     11103 
Jul 201213431   1783 1       13211    12102 
Apr 201214321   16153 31      1011     1292 
Jan 201292    15111 1       1011     12111 
Oct 20111764    23161         1242     15123 
Jul 2011123321  22132 3       94411   1191 
Apr 201114763   14124 1       12541    121121
Jan 20111055321  20143 41      165221   16144 
Oct 2010136531  17111 3       172211   1392 
Jul 20101153    18121 3       103111   1182 
Apr 20101065442  1581 1042     137433   1092 
Jan 20101276652111592 9332    169975211431 
Oct 20091244422  16121 84211   11532    43  
Jul 200921111              1111        
Apr 20096666421     3111    33322       
Jan 2009322221      3111    54221       
Oct 2008                              
Jul 20082222       1       41          
Apr 20081                 21          

 

Distribuição de edições de artigos por wikipedistas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikipedistasEdições total
1414100.0%12,920100.0%
310625.6%12,47896.6%
105513.3%12,18794.3%
32317.5%11,76291.0%
100184.3%11,11986.1%
316102.4%9,45073.1%
100030.7%5,88745.6%

 

10 wikipedistas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdições 
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
 agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
Rei MomoUC26 048118-Jun 26, 20134919---
Hector VarandasUC55+51012-Mar 01, 20142431---
ArchaeodontosaurusUC75+12612-Mar 09, 20111331----
Per excellenceUC105+2841--Mar 26, 2014218----
J. Patrick FischerUC124+52311-Oct 11, 20111115----
Claus AbleiterUC128+6331--Jul 25, 2012827----
PauliJCUC206+18821--Feb 08, 2014264----
LeftcryUC412...11--Oct 05, 201425----
СароманUC413...1111Oct 06, 201424----
INeverCryUC414...11--Oct 14, 201416----

 

20 wikipedistas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
  Primeira ediçãoúltima edição
 posiçãototaldatadias
atrás
datadias
atrás
PisonesUC12,092Dec 06, 20091789May 03, 2013545
CecílioUC22,071Jul 29, 20082284Feb 09, 20101724
ChabiUC31,724Feb 24, 20082440Jul 05, 2012847
SPQRobinUC4755Feb 23, 20092075Jun 03, 20111245
ZeEstevesUC5565Sep 14, 2013411Sep 16, 2013409
Manuel de SousaUC6553Jan 24, 20101740Mar 08, 2013601
GarsdUC7531Jan 15, 2013653Mar 24, 2013585
AmaralUC8395Sep 18, 2013407Sep 18, 2013407
HexadecimalUC9385Apr 15, 2013563Jun 03, 2013514
NaviaTVUC10379Jan 25, 20101739May 14, 20101630
El estremeñuUC11307Sep 20, 20091866Jan 04, 20101760
CarnelianSuthUC12307Nov 18, 2012711Dec 12, 2012687
AlchimistaUC13271Aug 13, 20091904May 14, 2013534
EspadeiroUC14231Sep 08, 20091878Apr 12, 2012931
Midnight GreenUC15159Nov 16, 20111079Aug 11, 2012810
MiguelcrUC16137Feb 15, 20082449Dec 30, 20111035
Bruno IshiaiUC17129May 29, 20101615Jun 08, 2014144
Isaac MansurUC18128Nov 05, 20091820Jan 16, 20101748
Lodewijk VadacchinoUC1974Nov 10, 20101450Sep 11, 201449
D'ohBotUC2059Sep 07, 20091879Sep 06, 20101515

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 1.400 edições foram feitas por usuários anônimos, de um total de 47.452 edições ( 2e %)
  


50 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições 
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
 datadias
atrás
datadias
atrás
XqbotUC14,535Sep 01, 20091885Mar 06, 2013603--
EmausBotUC23,874Jun 26, 20101587Jan 17, 2014286--
Luckas-botUC33,421Sep 03, 20091883May 20, 2012893--
MerlIwBotUC41,847May 07, 20111272Aug 08, 2013448--
WikitanvirBotUC51,545Nov 07, 20101453Apr 21, 2012922--
SieBotUC61,522Aug 14, 20091903Jan 25, 20111374--
ZéroBotUC71,409Nov 03, 20101457Mar 06, 2013603--
MelancholieBotUC81,362Aug 13, 20091904Nov 28, 20091797--
TXiKiBoTUC91,252Sep 21, 20091865Jan 08, 2013660--
LegobotUC10839Mar 11, 2013598Apr 02, 2013576--
VolkovBotUC11833Aug 16, 20091901Feb 28, 2013609--
AddbotUC12752Mar 07, 2013602Aug 16, 2013440--
FoxBotUC13660Oct 03, 20091853Feb 05, 2012998--
EscarbotUC14619Mar 07, 20101698Jan 25, 2013643--
TjBotUC15544Nov 17, 20101443Mar 06, 2013603--
ArthurBotUC16482Aug 24, 20091893Nov 17, 20111078--
RedBotUC17391Sep 08, 20101513Aug 21, 2012800--
Ripchip BotUC18380Mar 06, 20111334Feb 18, 2012985--
HRoestBotUC19376Jun 19, 20101594Feb 14, 2013623--
Idioma-botUC20366Oct 30, 20091826Feb 10, 2013627--
KamikazeBotUC21361Jul 04, 20101579Jan 24, 2013644--
AvocatoBotUC22349Oct 20, 20111106Feb 27, 2013610--
JackieBotUC23289Jan 15, 20111384Mar 07, 2013602--
JAnDbotUC24285Aug 14, 20091903Jul 03, 2013484--
AlexbotUC25281Aug 17, 20091900Aug 14, 20111173--
Thijs!botUC26272May 04, 20101640Jul 30, 2012822--
LaaknorBotUC27269Oct 02, 20091854Feb 16, 2013621--
RobbotUC28252Sep 23, 20091863Jan 02, 2013666--
MjbmrbotUC29234Oct 15, 20101476Mar 28, 20111312--
Movses-botUC30226Dec 22, 20101408Mar 18, 2012956--
CommonsDelinkerUC31223Dec 25, 20082135Oct 29, 20141--
RubinbotUC32203Sep 13, 20091873Mar 02, 2013607--
Dinamik-botUC33179Feb 14, 20101719Dec 18, 2012681--
MastiBotUC34178Dec 10, 20091785Mar 01, 2013608--
GerakibotUC35171Jan 11, 20101753Mar 04, 2013605--
AvicBotUC36169Jun 18, 20111230Dec 09, 2012690--
JotterbotUC37159Oct 05, 20091851Jan 24, 2013644--
VagobotUC38158Oct 18, 20111108Sep 19, 2012771--
AmirobotUC39131May 04, 20101640Nov 19, 20111076--
MystBotUC40122Jan 23, 20101741Feb 05, 2012998--
Makecat-botUC41120Oct 28, 2012732Mar 04, 2013605--
YFdyh-botUC42109Jun 18, 2012864Feb 13, 2013624--
JhsBotUC43103May 18, 20101626Mar 29, 2012945--
HerculeBotUC44100Aug 30, 20091887Jul 13, 2012839--
CocuBotUC45100Jun 09, 20111239Dec 26, 2012673--
CarsracBotUC4695Aug 16, 20091901Feb 12, 2013625--
HiW-BotUC4791Sep 18, 20111138Oct 19, 2012741--
SilvonenBotUC4886Sep 08, 20091878Dec 19, 2012680--
DSisyphBotUC4985Nov 22, 20091803Aug 27, 2012794--
JYBotUC5084May 15, 2012898Feb 12, 2013625--

 

Artigos que contêm pelo menos uma ligação interna e .. caracteres de texto legível, não contando códigos wiki e html,
ligações ocultas, etc.; títulos também não contam  (excluindo páginas de redirecionamento)

DataArtigos
 < 32 ch< 64 ch< 128 ch< 256 ch< 512 ch< 1 k ch< 2 k ch< 4 k ch< 8 k ch< 16 k ch< 32 k ch< 64 k ch
Oct 20107.5%11.1%12.9%15.4%19.6%28.7%41.8%56.0%69.1%81.6%91.0%97.4%
Sep 20107.6%11.1%13.1%15.4%19.4%28.5%41.6%55.7%68.7%81.2%90.9%97.4%
Aug 20107.6%11.2%12.7%15.0%19.0%28.0%41.2%55.4%68.5%81.2%90.9%97.5%
Jul 20107.6%11.1%12.6%15.0%19.0%27.6%40.9%55.1%68.3%81.0%90.8%97.4%
Jun 20107.8%11.2%12.9%15.2%19.1%27.3%40.3%54.4%67.8%80.7%90.7%97.4%
May 20107.8%11.2%13.0%15.3%19.2%27.3%40.5%54.6%67.9%80.9%90.7%97.4%
Apr 20107.8%11.3%13.0%15.3%19.2%27.3%40.2%54.3%67.4%80.5%90.5%97.3%
Mar 20107.1%10.5%12.3%14.7%18.5%26.2%39.4%53.0%66.5%80.1%90.4%97.2%
Feb 20106.8%9.8%10.7%13.3%16.9%24.6%38.2%51.3%65.1%78.8%89.7%97.1%
Jan 20106.6%9.1%10.1%12.7%16.1%23.5%37.3%50.6%64.5%78.1%89.2%96.9%
Dec 20095.7%7.4%8.5%11.4%14.9%22.9%35.8%48.4%62.4%76.6%88.5%96.6%
Nov 20095.5%7.2%8.3%11.2%14.8%23.1%36.0%48.6%62.4%76.6%88.5%96.6%
Oct 20093.9%4.9%5.4%8.2%11.7%19.9%33.3%46.5%61.0%75.9%88.2%96.5%
Sep 20092.2%2.7%3.2%5.9%9.4%17.3%30.5%44.0%59.0%74.9%87.8%96.2%
Aug 20090.3%0.6%1.0%4.0%7.4%15.2%28.5%42.1%57.4%74.0%87.3%96.1%
Jul 20090.1%0.5%0.8%3.9%6.7%14.1%26.3%38.8%54.9%72.4%86.2%95.6%
Jun 20090.1%0.5%0.8%3.9%6.6%14.0%26.2%38.7%54.8%72.4%86.3%95.7%
May 20090.2%1.2%1.6%5.1%8.4%17.0%29.9%42.2%56.6%74.3%87.5%97.5%
Apr 20090.2%1.2%1.6%5.2%8.8%17.4%29.7%41.6%55.6%74.0%88.2%98.0%
Mar 20090.4%2.3%3.1%8.8%15.2%27.3%40.1%52.9%62.3%77.4%90.6%98.9%
Feb 20090.4%2.2%3.5%10.7%17.4%30.9%44.4%58.3%66.8%82.0%91.9%99.5%
Jan 20090.7%4.1%6.2%17.2%26.9%44.8%61.4%73.1%78.6%88.3%95.9%100.0%
Dec 20081.0%8.6%11.5%25.8%38.2%61.1%79.2%88.7%91.6%96.4%100.0%100.0%
Nov 20081.8%18.2%23.7%38.2%49.1%76.4%96.4%100.0%100.0%100.0%100.0%100.0%
Oct 20083.8%18.9%24.6%39.7%51.0%79.3%96.3%100.0%100.0%100.0%100.0%100.0%
Sep 20083.8%19.2%25.0%38.5%50.0%78.8%96.1%99.9%99.9%99.9%99.9%99.9%
Aug 20083.8%19.2%25.0%38.5%50.0%78.8%96.1%99.9%99.9%99.9%99.9%99.9%
Jul 20083.8%19.2%25.0%38.5%50.0%78.8%96.1%99.9%99.9%99.9%99.9%99.9%
Jun 20083.9%19.6%25.5%37.3%51.0%80.4%98.0%100.0%100.0%100.0%100.0%100.0%
May 20084.1%20.4%26.5%38.7%53.0%81.6%97.9%99.9%99.9%99.9%99.9%99.9%
Apr 20080.0%11.5%15.3%34.5%53.7%84.5%99.9%99.9%99.9%99.9%99.9%99.9%
Mar 20080.0%5.6%11.2%33.4%50.1%89.0%100.0%100.0%100.0%100.0%100.0%100.0%
Feb 20080.0%7.7%15.4%38.5%46.2%84.7%100.0%100.0%100.0%100.0%100.0%100.0%

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110Png
Oct 20143,1 k7837221879972,2 k       2
Sep 20143,1 k7817221879972,2 k       2
Aug 20143,1 k7747221879972,2 k       2
Jul 20143,1 k7687221879972,2 k       2
Jun 20143,1 k7667221877572,2 k       2
May 20143,1 k7667221877362,2 k       2
Apr 20143,1 k7627221877362,2 k       2
Mar 20143,1 k7587221877362,2 k       2
Feb 20143,1 k7537221877362,2 k      92
Jan 20143,1 k7487221877332,2 k      172
Dec 20133,1 k7377221877332,2 k      502
Nov 20133,1 k7337221877332,2 k      352
Oct 20133,1 k7277121877332,2 k      382
Sep 20133,1 k7227121877332,2 k      9662
Aug 20132,1 k7017121877332,2 k      462
Jul 20132,1 k6987121877332,2 k      202
Jun 20132,1 k6937121877332,2 k      952
May 20132,0 k6907121871232,2 k      3122
Apr 20131,9 k6827121846732,2 k      462
Mar 20131,9 k6707121845932,2 k      3182
Feb 20131,8 k5546521845932,2 k      552
Jan 20131,8 k5355621845622,2 k      2322
Dec 20121,8 k5195121645622,1 k      2522
Nov 20121,6 k5045111643222,1 k      1111
Oct 20121,6 k5025111641722,1 k      271
Sep 20121,6 k4975111541712,1 k      171
Aug 20121,6 k4905111541712,1 k      61
Jul 20121,6 k4835111541712,1 k      451
Jun 20121,5 k4745111541612,1 k      261
May 20121,5 k4595111541612,1 k      241
Apr 20121,5 k4455111541612,1 k      371
Mar 20121,5 k4285111541612,1 k      1061
Feb 20121,5 k4215111541512,1 k      941
Jan 20121,5 k4015111541512,1 k      181
Dec 20111,5 k3915111541512,1 k      681
Nov 20111,4 k3855111441212,1 k      661
Oct 20111,4 k3665111441212,1 k      461
Sep 20111,4 k3555111341112,1 k      121
Aug 20111,4 k3445111341012,1 k      451
Jul 20111,4 k3375111341012,1 k      611
Jun 20111,4 k3255111140912,1 k      151
May 20111,4 k3215111140812,0 k      351
Apr 20111,4 k3125111140712,0 k      791
Mar 20111,3 k2995111140612,0 k      571
Feb 20111,3 k2895111038012,0 k      301
Jan 20111,3 k279511738012,0 k      2631
Dec 20101,3 k269491337612,0 k      171
Nov 20101,3 k264491337612,0 k      161
Oct 20101,2 k253491237612,0 k      891
Sep 20101,2 k239481234412,0 k      571
Aug 20101,2 k228481234412,0 k      231
Jul 20101,2 k209481234312,0 k      361
Jun 20101,2 k204481234112,0 k      421
May 20101,2 k180481233912,0 k      841
Apr 20101,2 k175481233512,0 k      4871
Mar 20101,1 k163481230312,0 k      4641
Feb 20101,0 k146441223912,0 k      2751
Jan 2010962134291221111,9 k      17661
Dec 200987410526122001813      1991
Nov 20098679526122001797      5891
Oct 20098388724121911178      3491
Sep 20097968023121881167      4601
Aug 20097684922111871166      9761
Jul 2009737116  1501150      37 
Jun 2009734116  1501149      507 
May 200957214  100 127      139 
Apr 200952514  97 114      570 
Mar 200929914  89 77      270 
Feb 200925314  74 76      668 
Jan 200915513  63 66      268 
Dec 200811413  50 27      369 
Nov 200856 1  22 6      42 
Oct 200852 1  19 4        
Sep 200851 1  19 4        
Aug 200851 1  19 4        
Jul 200851 1  19 4      31 
Jun 200849 1  19 3        
May 200847 1  19 3      26 
Apr 200825 1  19 1      1 
Mar 200817 1  16 1      4 
Feb 200814 1  16          

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

Feb 2008: 1 3 Páigina Percipal , 2 2 Picuote , 3 1 Bumioso

Mar 2008: 1 1 Lhéngua Mirandesa

Apr 2008: 1 1 Abusejo

May 2008: 1 1 Sociadade

Jul 2008: 1 1 Cumputador

Nov 2008: 1 3 Páigina Percipal , 2 2 Pertual , 3 2 Lhéngua Mirandesa , 4 1 Spanha

Dec 2008: 1 4 Declaraçon Ounibersal de ls Dreitos Houmanos , 2 3 Ágreda , 3 3 Zenízio , 4 2 Spanha , 5 2 Quim Barreiros , 6 2 Cumputador , 7 2 Cebadeiros , 8 2 Bumioso , 9 2 Braga , 10 2 Bernardo Fernandes Monteiro , 11 2 Auga , 12 2 António Lobo Antunes , 13 2 Almazán , 14 2 Agallas , 15 2 Abusejo , 16 2 Abejar , 17 2 Poema La Lhéngua Mirandeza , 18 2 Nuossa Alma i Nuossa Tierra , 19 2 Manuel Sardinha , 20 2 Lhéngua Mirandesa , 21 2 La Pertuesa-Hino Nacional , 22 2 João Penha , 23 2 Joaquim Araújo , 24 2 Gaspar Arce

Jan 2009: 1 2 Stória de Roma , 2 2 Stados Ounidos de la América , 3 2 Religion , 4 2 Ciéncia , 5 2 Bíblia , 6 2 Berlin , 7 2 Bandeira de Pertual , 8 2 Anternete , 9 2 Angenharie , 10 2 Andústria , 11 2 Agricultura , 12 2 Ouropa , 13 2 Nuoba Iorque , 14 2 Medio Ouriente , 15 2 Londres

Feb 2009: 1 3 Sociadade , 2 3 Die de ls namorados , 3 3 Çporto , 4 2 Stória de l Crestianismo , 5 2 San Balantin , 6 2 Salude , 7 2 Rússia , 8 2 Quemido , 9 2 Cristandade , 10 2 Crestianismo , 11 2 Clima , 12 2 Ciéncias Sociales , 13 2 Cidade , 14 2 Charles Darwin , 15 2 Catolicismo , 16 2 Biologie , 17 2 Astronomie , 18 2 Artes Bisuales , 19 2 Arquitetura , 20 2 Antártica , 21 2 Anternete , 22 2 Amílcar Cabral , 23 2 América de l Norte , 24 2 Portestantismo , 25 2 Política

Mar 2009: 1 3 Sendin , 2 2 Riu , 3 2 Cuntinente , 4 2 Assemblé de Dius , 5 2 Arma , 6 2 Almairo , 7 2 Paíç , 8 2 Miranda de l Douro , 9 2 Ls Lusíadas , 10 2 Lhéngua Mirandesa , 11 2 Ilha , 12 1 Sun Tzu

Apr 2009: 1 3 Sismo , 2 3 Ampério Romano , 3 3 Ampério Bizantino , 4 3 Ouclides , 5 3 Max Ernst , 6 3 Luna , 7 3 Houlocausto , 8 3 Eidade de la Piedra , 9 2 Suméria , 10 2 Stendhal , 11 2 Sploraçon spacial , 12 2 Sociologie , 13 2 Siddhartha Gautama , 14 2 Sexismo , 15 2 Segunda Guerra Mundial , 16 2 Saturno , 17 2 Roald Amundsen , 18 2 Renacimiento , 19 2 Reboluçon Francesa , 20 2 Cordilheira de ls Andes , 21 2 Cleópatra , 22 2 Claude Monet , 23 2 Carl Friedrich Gauss , 24 2 Capitalismo , 25 2 Blaise Pascal

May 2009: 1 2 Batailha de Aljubarrota , 2 2 Paç , 3 2 Oucránia , 4 2 Páigina Percipal , 5 1 Stória de la Rússia

Jun 2009: 1 3 Reboluçon Amaricana de 1776 , 2 3 Antoine Lavoisier , 3 2 Stória de Pertual , 4 2 Stados Cunfederados de la América , 5 2 Caçareilhos , 6 2 Campo de Bíboras , 7 2 Bal de Frailes , 8 2 Apartheid , 9 2 Albert Einstein , 10 2 Planeta , 11 2 Pinelo , 12 2 Matela (Bumioso) , 13 2 Fiódor Dostoiévski , 14 2 Eça de Queirós , 15 1 Sílex

Jul 2009: 1 1 Sikhismo

Aug 2009: 1 4 Lhéngua mirandesa , 2 4 Páigina Percipal , 3 3 Wikipedia , 4 3 Brigham Young , 5 3 Antigos macedónios , 6 3 Pertual , 7 3 Eisrael , 8 2 Nefita , 9 2 Templo de Curitiba , 10 2 Stória de la Oustrália , 11 2 Stória de Cabo Berde , 12 2 Storiografie , 13 2 Stados Ounidos de la América , 14 2 Santos de ls Redadeiros Dies , 15 2 Rússia , 16 2 Roma Antiga , 17 2 Riu Missouri , 18 2 Custantino I , 19 2 Crestianismo , 20 2 Cordilheira de ls Andes , 21 2 Che Guevara , 22 2 Charles de Gaulle , 23 2 Carlos I de Spanha , 24 2 Blaise Pascal , 25 2 Bernhard Riemann

Sep 2009: 1 9 Lhéngua lhionesa , 2 3 Monarquie , 3 3 Lhéngua mirandesa , 4 2 Lhéngua almana , 5 2 Mórmones Fundamentalistas , 6 2 Casa de Lhion , 7 2 Anielho de l CTR , 8 2 Lhista de reis de Pertual , 9 2 Stória de Eisrael , 10 2 Stados Ounidos de la América , 11 2 Cunfucionismo , 12 2 Cleópatra , 13 2 Claude Monet , 14 2 Che Guevara , 15 2 Charles de Gaulle , 16 2 Charles Darwin , 17 2 Cao Dai , 18 2 Bíblia , 19 2 Budismo , 20 2 Berlin , 21 2 Bandeira de Pertual , 22 2 Análeze Matemática , 23 2 Andependéncia de l Brasil , 24 2 América de l Sul , 25 2 Albrecht Dürer

Oct 2009: 1 3 Frente Nacional para la Lhibertaçon de l Bietname , 2 2 Terça-feira , 3 2 Cultura pertuesa , 4 2 Quarta-feira , 5 2 Cannibal Corpse , 6 2 Alfabeto Fonético Anternacional , 7 2 Lheite , 8 2 Alman , 9 2 Causo genitibo , 10 2 Aníbal Barca , 11 2 Biseu , 12 2 Lhéngua stremenha , 13 2 Lhéngua asturiana , 14 2 Rede Manchete , 15 2 Stória de la quelonizaçon de las Américas , 16 2 Speranto , 17 2 Reboluçon Amaricana de 1776

Nov 2009: 1 3 Lhéngua rapa nui , 2 3 Machado de Assis , 3 3 Lhéngua mirandesa , 4 2 Piotr Tchaikovski , 5 2 Templo de Nauvoo , 6 2 Ludwig van Beethoven , 7 2 Moai , 8 2 Terça-feira , 9 2 Quarta-feira , 10 2 Cannibal Corpse , 11 2 Leonel Brizola , 12 2 Saturno , 13 2 Roma , 14 2 Racismo , 15 2 Cristandade , 16 2 Crestianismo , 17 2 Chamamientos crestianos , 18 2 Bikings , 19 2 Auga , 20 2 Animal , 21 2 Planta , 22 2 Paç , 23 2 Ounion Africana , 24 2 Ouniberso , 25 2 Ouceano Pacífico

Dec 2009: 1 2 Cannibal Corpse , 2 2 Pertual , 3 2 Paris , 4 1 Ls Santos de ls Redadeiros Dies

Jan 2010: 1 4 Brasil Quelónia , 2 4 Bergança , 3 3 Timor-Leste , 4 3 San Tomé i Príncepe , 5 3 Moçambique , 6 3 Guiné-Bissau , 7 3 Bila Nuoba de Gaia , 8 3 Cristobo Colombo , 9 3 Dreito público , 10 3 Casa de Lhion , 11 3 Cuntinente , 12 3 Cuba , 13 3 Capitalismo , 14 3 Cachones de l Niágara , 15 3 Bumioso , 16 3 Bodun , 17 3 Bie Látea , 18 3 Bahamas , 19 3 Baca , 20 3 Abicena , 21 3 Andependéncia de l Kosobo , 22 3 América , 23 3 Fé Bahá'í , 24 3 Fonso I de Pertual , 25 3 Eiboluçon

Feb 2010: 1 3 Louis Pasteur , 2 3 Francis Bacon (filósofo) , 3 3 Vasco da Gama , 4 3 Mobilha , 5 2 Sistema Brasileiro de Televisão , 6 2 Disney Club , 7 2 Mar de Timor , 8 2 Cacau , 9 2 Cundado Portucalense , 10 2 René Descartes , 11 2 Francesco Redi , 12 2 Nicolau Copérnico , 13 2 René Çcartes , 14 2 Miguel Ángelo , 15 1 San Paulo

Mar 2010: 1 3 Ampério pertués , 2 3 Lhista de reis de Lhion , 3 3 Afonso de Albuquerque , 4 3 Pedro Álvares Cabral , 5 3 Bartolomeu Dias , 6 3 Ramiro I de las Astúrias , 7 3 Londres , 8 3 Guerra Cebil Amaricana , 9 2 Region de Turismo de l Nordeste Trasmuntano , 10 2 Banco Ouropeu de Ambestimiento , 11 2 Comité Eiquenómico i Social Ouropeu , 12 2 Tribunal de Cuontas Ouropeu , 13 2 Tribunal de Justícia de la Ounion Ouropeia , 14 2 Comisson Ouropeia , 15 2 Carlos Ferreira , 16 2 Domingos Raposo , 17 2 Tratado de Roma , 18 2 Quemunidade Eiquenómica Ouropeia , 19 2 Quemunidade Ouropeia de l Carbon i de l Aço , 20 2 Asterix l Goulés , 21 2 San Poulo , 22 2 Península Eibérica , 23 2 Hip hop , 24 2 Rap , 25 2 José Rodrigues

Apr 2010: 1 3 Barbacena , 2 3 Grande Barreira de Coral , 3 3 Montes Urales , 4 3 Jean Monnet , 5 3 Rómulo Ougusto , 6 3 Javier Solana , 7 3 Política de Defesa i de Sigurança Quemun , 8 3 Parlamiento Ouropeu , 9 3 Reino de la Galiza , 10 3 Reboluçon Russa de 1917 , 11 2 Defesa pessonal , 12 2 Hans Christian Andersen , 13 2 Reino de Kent , 14 2 Mar Cáspio , 15 2 San José (Paulínia) , 16 2 Ilhas Británicas , 17 2 Península , 18 2 Riu Ural , 19 2 Capital , 20 2 Tierra Caliente , 21 2 Tierra Frie , 22 2 Gran-ducado de la Toscana , 23 2 Tribunal de Justícia de la Ounion Ouropeia , 24 2 Comisson Ouropeia , 25 2 Ambason muçulmana de la península Eibérica

May 2010: 1 3 Stória de Sacaben , 2 3 Lhéngua mirandesa , 3 2 Whiteberry , 4 2 Laura Pausini , 5 2 Abade de Baçal , 6 2 Mário Correia , 7 2 Cungregaçon Crestiana an Pertual , 8 1 Riu Teijo

Jun 2010: 1 2 Assemblé de Dius , 2 1 Diogo Cão

Jul 2010: 1 2 Branco , 2 2 Recén-nacido , 3 1 Bietname

Aug 2010: 1 2 Sacaben , 2 1 António Fragoso

Sep 2010: 1 4 Japon , 2 3 The Beatles , 3 2 Alcoron , 4 1 Tequixquiac

Oct 2010: 1 3 Mérida (Benezuela) , 2 2 Appert , 3 1 Riu Sado

Nov 2010: 1 2 Spanha , 2 1 Vepric

Dec 2010: 1 1 ETA

Jan 2011: 1 3 Concepción , 2 3 Amplantaçon de la República Pertuesa , 3 2 Çtrito de Portalegre , 4 2 Çtrito de Lhisboua , 5 2 Çtrito de Lheirie , 6 2 Çtrito de la Guarda , 7 2 Çtrito de Faro , 8 1 `Abdu'l-Bahá

Feb 2011: 1 3 Aritmética , 2 1 Pertual Cuntinental

Mar 2011: 1 2 Asturo-lheonés , 2 1 Lech Wałęsa

Apr 2011: 1 2 Mimas , 2 2 Homo sapiens , 3 2 Almanha , 4 2 Concepción , 5 2 Io , 6 2 Monarquie , 7 1 Jonh Lennon

May 2011: 1 2 Rede Globo , 2 1 Polónia

Jun 2011: 1 2 Ounibersidade de l Bío-Bío , 2 1 Talcahuano

Jul 2011: 1 2 Galandum Galundaina , 2 1 KrioRus

Aug 2011: 1 2 Polónia , 2 2 Maomé , 3 1 Sergey Bryukhonenko

Sep 2011: 1 1 Anterlhéngua

Oct 2011: 1 2 Paltoga , 2 2 Stória de l Brasil , 3 2 Brasil República , 4 2 Ancunfidéncia Mineira , 5 1 Ludmilla Radchenko

Nov 2011: 1 2 Ouceano Atlántico , 2 1 Marie-George Buffet

Dec 2011: 1 2 Riu Danúbio , 2 2 Mobelizaçon studantil ne l Chile an 2011 , 3 1 Riu Reno

Jan 2012: 1 2 Frances Ruffelle , 2 2 Miro Šmajda , 3 1 Slobáquia

Feb 2012: 1 3 Anastacia , 2 2 Sofia Vitória , 3 2 Tejeira , 4 2 Eva Gonzalès , 5 2 Armando Gama , 6 2 Eduardo Nascimento , 7 2 Madalena Iglésias , 8 2 Festibal Ourobison de la Cançon , 9 1 Voyage Voyage

Mar 2012: 1 3 Paranaguá , 2 2 Bulgária , 3 2 Eislándia , 4 2 Grécia , 5 2 Coca-Cola , 6 2 Adelaide Ferreira , 7 2 Flor-de-Lis (banda) , 8 1 2B (duo)

Apr 2012: 1 2 Buranovskiye Babushki , 2 2 Catona , 3 2 Riu Bolga , 4 1 Bomba atómica

May 2012: 1 3 Rei Momo , 2 2 François Hollande , 3 1 Rafael Correa

Jun 2012: 1 3 Avril Lavigne , 2 2 Wikipedia , 3 1 Should've Known Better

Jul 2012: 1 2 Anielho de tucun

Aug 2012: 1 1 Pussy Riot

Sep 2012: 1 2 Riu Biobío , 2 1 Guilin

Oct 2012: 1 2 Caselle Landi , 2 2 Semitério de Pistoia , 3 1 Lu Xun

Nov 2012: 1 1 Staçon Spacial Anternacional

Dec 2012: 1 2 Orlando Drummond , 2 1 Frei Betto

Jan 2013: 1 2 Maccastorna , 2 2 Meleti , 3 1 Zhuang(etnia)

Feb 2013: 1 2 Lhéngua mirandesa , 2 1 WP:BF

Mar 2013: 1 2 Pardo de Cela , 2 2 Eislándia , 3 1 Xuxa

Apr 2013: 1 1 Atentado na maratora de Boston

May 2013: 1 1 Midlands Oucidentales

Jun 2013: 1 1 Ilha de Wight

Jul 2013: 1 1 Paramore

Aug 2013: 1 1 Souto de Aguiar de la Beira i Balberde

Sep 2013: 1 2 Mobeliário , 2 1 Copa de la Ásia de 2007

Oct 2013: 1 1 Sung Jae-ki

Nov 2013: 1 1 Paróquia de Bienville\\

Dec 2013: 1 2 Coreca

Jan 2014: 1 1 Monçon (Pertual)

Feb 2014: 1 1 Guapo Hourizonte

Mar 2014: 1 2 Taurino Araújo , 2 1 Yun Hyon-seok

Apr 2014: 1 2 Vladimir Putin , 2 1 Club Social y Deportivo Colo-Colo

May 2014: 1 1 Iksu

Jun 2014: 1 2 Lila Tretikov , 2 2 Ronald Reagan , 3 1 Riu Andalién

Jul 2014: 1 1 Srinivasa Ramanujan

Aug 2014: 1 1 Andonésia

Sep 2014: 1 1 Papa Francisco

Oct 2014: 1 1 Maurício Malvestiti

No data on this page have been normalized to 30 day months (as WMF does on certain traffic reports).
Wikipedias are initially ordered by number of speakers of the language

Speakers: Number of speakers of a language is the estimated total of primary and secondary speakers, is in many cases a very rough estimation (based on the page on the English Wikipedia about that language)
Regions are parts of the world where the language is spoken in substantial amounts (compared to total number of speakers). Regions where a language gained presence only by a recent diaspora are generally not included.
Region codes: AF:Africa, AS:Asia, EU:Europe, NA:North America, OC:Oceania, SA:South America, W:World Wide, CL:Constructed Language

Estatísticas geradas em Monday December 1, 2014 02:14

Dump file mwlwiki-20141104-stub-meta-history.xml.gz (edits only), size 6.2 Mb as gz -> 40 Mb
Dump processed till Oct 31, 2014, on server stat1002, ready at Wed-05/11/2014-22:20 after 35 sec.

Versão do script:2.6
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.