Estatísticas da Wikipédia inglês simplificado

Zoom           
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Articles per size range / Records per namespace / Most edited articles / Zeitgeist
 
Monthly counts & Quarterly rankings
 
DataWikipedistasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
out 2009+2% +14% +2%+3%+8%    0%+3%+3%+3%+2%+1%+2%+6%
set 2009+1% -5% +2%+3%0%    -8%+3%+3%+3%+2%+2%+3%+4%
ago 2009+2% -5% +2%+4%+44%    -11%+3%+3%+3%+2%+2%+3%+2%
jul 2009+2% -12% +2%+2%     +24%+2%+2%+2%+2%+1%+2%+3%
jun 2009+3% +4% +1%+1%     -19%+2%+2%+1%+2%+1%+1%+5%
mai 2009+2% -7%-5%+2%+2%-21%    +15%+3%+3%+3%+2%+1%+2%+2%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P____Q____R____S__
out 20092033341531958 k47 k4220,4147160%18%29 k133 Mb13,3 M944 k1,2 M24 k69 k22 k
set 20091999281342057 k46 k3920,3146460%18%29 k129 Mb12,9 M919 k1,2 M23 k67 k21 k
ago 20091971431411756 k44 k3920,2144559%17%32 k125 Mb12,5 M889 k1,2 M23 k66 k20 k
jul 20091928381491655 k43 k2720,1143558%17%36 k122 Mb12,1 M867 k1,1 M22 k64 k20 k
jun 20091890511691754 k42 k1919,7142658%17%29 k119 Mb11,8 M849 k1,1 M22 k63 k19 k
mai 20091839401632053 k41 k3019,4141358%17%36 k116 Mb11,6 M839 k1,1 M22 k62 k18 k
abr 20091799471762152 k41 k3819,1139857%16%31 k113 Mb11,3 M817 k1,1 M22 k60 k18 k
mar 20091752591782851 k40 k4118,9139457%16%38 k110 Mb11,0 M796 k1,1 M21 k59 k17 k
fev 20091693611942450 k38 k3718,6138556%16%34 k106 Mb10,6 M775 k1,0 M20 k57 k17 k
jan 20091632571872349 k37 k25918,3137256%16%48 k103 Mb10,3 M754 k1,0 M20 k55 k17 k
dez 20081575601841841 k35 k9420,8153963%18%41 k95 Mb9,7 M690 k917 k19 k53 k16 k
nov 20081515451632338 k34 k4421,3159565%19%34 k92 Mb9,3 M660 k887 k18 k51 k16 k
out 20092033341531958 k47 k4220,4147160%18%29 k133 Mb13,3 M944 k1,2 M24 k69 k22 k
set 20091999281342057 k46 k3920,3146460%18%29 k129 Mb12,9 M919 k1,2 M23 k67 k21 k
ago 20091971431411756 k44 k3920,2144559%17%32 k125 Mb12,5 M889 k1,2 M23 k66 k20 k
jul 20091928381491655 k43 k2720,1143558%17%36 k122 Mb12,1 M867 k1,1 M22 k64 k20 k
jun 20091890511691754 k42 k1919,7142658%17%29 k119 Mb11,8 M849 k1,1 M22 k63 k19 k
mai 20091839401632053 k41 k3019,4141358%17%36 k116 Mb11,6 M839 k1,1 M22 k62 k18 k
abr 20091799471762152 k41 k3819,1139857%16%31 k113 Mb11,3 M817 k1,1 M22 k60 k18 k
mar 20091752591782851 k40 k4118,9139457%16%38 k110 Mb11,0 M796 k1,1 M21 k59 k17 k
fev 20091693611942450 k38 k3718,6138556%16%34 k106 Mb10,6 M775 k1,0 M20 k57 k17 k
jan 20091632571872349 k37 k25918,3137256%16%48 k103 Mb10,3 M754 k1,0 M20 k55 k17 k
dez 20081575601841841 k35 k9420,8153963%18%41 k95 Mb9,7 M690 k917 k19 k53 k16 k
nov 20081515451632338 k34 k4421,3159565%19%34 k92 Mb9,3 M660 k887 k18 k51 k16 k
out 20081470421752537 k33 k5521,1159165%19%32 k88 Mb9,0 M638 k863 k17 k49 k15 k
set 20081428421422435 k31 k5521,2158565%19%31 k84 Mb8,5 M604 k830 k17 k46 k15 k
ago 20081386451532433 k30 k4621,3157465%19%31 k79 Mb8,0 M571 k803 k16 k44 k14 k
jul 20081341541532832 k29 k7221,3158065%19%37 k76 Mb7,7 M550 k776 k16 k42 k13 k
jun 20081287401472630 k27 k4521,7159367%19%33 k71 Mb7,2 M515 k734 k15 k38 k13 k
mai 20081247461332328 k26 k3521,6156566%19%31 k67 Mb6,8 M485 k705 k14 k36 k12 k
abr 20081201381182027 k25 k3221,3156666%19%26 k64 Mb6,5 M467 k679 k13 k34 k12 k
mar 20081163351292126 k24 k2821,1156266%19%25 k62 Mb6,3 M449 k658 k13 k32 k11 k
fev 20081128461351925 k23 k4120,8153766%18%29 k59 Mb6,0 M432 k640 k12 k30 k10 k
jan 20081082331102024 k22 k3620,6152365%18%31 k56 Mb5,6 M407 k618 k11 k28 k10,0 k
dez 20071049411131823 k21 k6220,3149264%18%32 k53 Mb5,3 M379 k588 k11 k26 k9,5 k
nov 2007100835981821 k19 k2820,6144262%18%25 k47 Mb4,7 M334 k554 k10 k22 k9,0 k
out 2007973331031620 k18 k2020,2143362%17%25 k45 Mb4,5 M319 k530 k9,5 k21 k8,7 k
set 200794026951720 k17 k2119,6140461%17%21 k43 Mb4,3 M304 k509 k9,2 k19 k8,4 k
ago 2007914341181919 k17 k3819,1138760%17%21 k41 Mb4,1 M292 k492 k8,8 k18 k8,0 k
jul 2007880321131918 k16 k3119,2135258%16%17 k37 Mb3,8 M269 k460 k8,1 k15 k7,3 k
jun 2007848421201617 k15 k2119,2135458%16%18 k35 Mb3,6 M255 k441 k7,6 k13 k7,0 k
mai 2007806411151616 k14 k1918,8133158%16%27 k34 Mb3,4 M243 k423 k7,2 k12 k6,7 k
abr 200776531921716 k13 k2217,8130757%15%19 k32 Mb3,2 M231 k402 k6,8 k11 k6,4 k
mar 200773424951415 k13 k1917,3128356%15%22 k30 Mb3,0 M217 k384 k6,3 k9,6 k6,1 k
fev 2007710361141314 k12 k2216,5124154%14%16 k28 Mb2,8 M200 k365 k5,8 k8,3 k5,8 k
jan 2007674471241214 k12 k2616,1119553%14%19 k26 Mb2,6 M185 k346 k5,1 k7,3 k5,5 k
dez 2006627481131413 k11 k2515,6116351%13%20 k24 Mb2,4 M170 k325 k4,6 k5,9 k5,2 k
nov 2006579461111512 k10,0 k2215,0114350%13%19 k22 Mb2,2 M155 k300 k4,2 k4,8 k4,9 k
out 200653334981412 k9,3 k1914,1115150%13%15 k20 Mb2,1 M144 k274 k3,8 k4,5 k4,7 k
set 200649931771611 k8,8 k1513,6114249%13%11 k19 Mb1,9 M135 k245 k3,4 k4,1 k4,2 k
ago 200646845981211 k8,4 k1913,1112848%13%13 k18 Mb1,8 M127 k236 k3,0 k3,7 k3,9 k
jul 2006423267069,9 k7,9 k2012,6111748%13%11 k17 Mb1,7 M119 k209 k2,8 k3,2 k3,5 k
jun 2006397114789,3 k7,4 k1812,3112248%13%11 k16 Mb1,6 M111 k195 k2,5 k3,1 k3,1 k
mai 2006386407178,8 k6,9 k1811,8111947%13%11 k15 Mb1,5 M104 k184 k2,2 k3,0 k2,8 k
abr 2006346275588,2 k6,5 k1611,3112347%13%9,5 k14 Mb1,4 M97 k169 k2,0 k2,7 k2,5 k
mar 2006319215377,8 k6,1 k1210,7111946%13%9,1 k13 Mb1,3 M90 k158 k1,8 k2,3 k2,2 k
fev 2006298113767,4 k5,7 k2210,0111746%13%8,0 k12 Mb1,3 M85 k136 k1,6 k2,0 k1,9 k
jan 2006287205196,8 k5,2 k299,8113846%13%10 k11 Mb1,2 M79 k127 k1,3 k1,8 k1,6 k
dez 2005267276275,9 k4,5 k159,5117746%14%6,5 k9,8 Mb1,0 M69 k106 k1,1 k1,4 k1,3 k
nov 2005240173955,4 k4,1 k109,2118145%14%5,3 k9,1 Mb968 k63 k100 k9871,3 k1,2 k
out 2005223163545,1 k3,8 k98,7119746%14%3,5 k8,6 Mb926 k61 k93 k9121,2 k1,1 k
set 2005207103034,8 k3,6 k48,5116945%14%3,4 k8,0 Mb856 k57 k89 k7941,2 k963
ago 2005197133854,7 k3,5 k137,9115445%14%3,9 k7,6 Mb825 k55 k76 k7451,2 k931
jul 2005184194564,3 k3,1 k107,8114444%14%4,6 k6,9 Mb741 k50 k70 k5111,0 k849
jun 2005165163454,0 k2,8 k147,2110243%13%4,0 k5,8 Mb664 k46 k42 k439883778
mai 2005149112443,6 k2,5 k166,9100342%11%2,6 k4,8 Mb555 k41 k32 k379876698
abr 2005138112423,1 k2,3 k67,2105044%11%1,6 k4,3 Mb505 k38 k28 k332787616
mar 200512772812,9 k2,2 k77,1104944%11%1,4 k4,1 Mb479 k36 k26 k299745598
fev 200512062242,7 k2,0 k97,2106346%11%2,1 k3,8 Mb446 k34 k25 k249701562
jan 200511471922,4 k1,9 k87,0110247%11%1,3 k3,5 Mb418 k33 k21 k223682521
dez 200410771722,2 k1,7 k47,2113948%12%1,3 k3,3 Mb387 k30 k20 k201671491
nov 2004100101912,1 k1,6 k47,0113747%12%1,2 k3,1 Mb364 k28 k20 k184588445
out 20049031511,9 k1,5 k26,8111045%11%9312,9 Mb334 k26 k18 k168556395
set 20048791931,9 k1,4 k66,6106843%10%1,1 k2,6 Mb306 k24 k17 k146481381
ago 20047851431,7 k1,3 k46,6112546%11%1,3 k2,5 Mb292 k23 k15 k132461318
jul 20047392121,6 k1,2 k36,3116847%11%9462,4 Mb279 k22 k14 k116422308
jun 200464102341,5 k1,1 k56,1109045%11%2,4 k2,1 Mb247 k20 k13 k105416299
mai 20045472121,3 k1,0 k105,0102045%10%1,5 k1,8 Mb211 k17 k10 k94272278
abr 200447132531,0 k78875,090048%9%1,2 k1,1 Mb149 k13 k7,1 k75215265
mar 2004341116282364654,790750%9%925916 kb121 k10 k4,9 k29157237
fev 200423714 67755534,394453%9%557757 kb104 k8,8 k2,9 k16227220
jan 20041638 59148824,097453%10%422650 kb94 k8,1 k1,2 k7208212
dez 200313311154245033,694954%10%678573 kb84 k7,5 k6793194190
nov 20031036 45137442,8101559%11%391489 kb75 k6,7 k194314770
out 2003724 32326952,7107363%11%482372 kb57 k5,0 k14639060
set 2003515 15913022,590560%8%136158 kb24 k1,9 k9935116
ago 2003412 1058012,577450%7%8992 kb13 k1,1 k8422613
jul 2003312 664612,664741%6%6150 kb6,7 k664591115
jun 20032   4333 2,672149%7%1037 kb4,8 k480591111
mai 20032   3930 2,676351%8%1436 kb4,6 k464591101
abr 20032   3628 2,479756%8%634 kb4,4 k42048181
mar 2003211 332512,578255%9%3431 kb4,0 k36435151
fev 20031   109 4,7129980%20%1416 kb2,1 k974151
jan 20031   99 3,7130089%11%114 kb1,9 k751 5 
dez 20021   88 4,097188% 410 kb1,2 k711 5 
nov 20021   66 4,71059100%  8,7 kb966531 5 
out 20021   66 4,71059100% 48,7 kb966531 5 
set 20021   55 4,8100780% 47,4 kb76923115 
ago 20021   55 4,0100180% 47,3 kb76223 15 
jul 20021   44 4,080375% 15,4 kb50220 15 
jun 20021   44 3,880175%  5,4 kb50120  5 
mai 20021   44 3,880175%  5,4 kb50120  5 
abr 20021   44 3,880175% 15,4 kb50120  5 
mar 20021   44 3,577475%  5,3 kb48320  5 
fev 20021   44 3,577475% 35,3 kb48320  5 
jan 20021   33 3,760367%  3,9 kb28915  3 
dez 20011   33 3,760367%  3,9 kb28915  3 
nov 20011   33 3,760367% 13,9 kb28915  3 
out 20011 1 33 3,360367% 93,9 kb28915  3 
set 200111  11 1,0290  1308 519    
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
The following table ranks this project in relation to projects in other languages with 1000+ articles
Note: data for month(s) after Sep 2009 for one or more large projects are not yet known.
As a temporary approximation missing data for a project are substituted by the highest historic value for that project.
Once those missing data are available final rankings for recent months can shift one or more positions.
set 2009323435373741367581796736423937324436269
ago 2009322935403840397480797139423937324436269
jul 2009323234413841476978837036413938324436269
jun 2009322934383841547276806636413938324336269
mai 2009323435363841447376806636413938324335269
abr 2009313232363841417376837039413938324235269
mar 2009312934333841347175807034413938324234269
fev 2009312930363841417174866836413938314234269
jan 2009312832373841107174846830413938314234269
dez 2008312730394342224956655629423939344335269
nov 2008312933364442314155585131433939344334269
out 2008323032354443254255575136433939334335269
set 2008312834334543243954534934434039334335269
ago 2008302933364543323654534839434039344335269
jul 2008312633334442233451524833434039344334269
jun 2008313335344442313148474535444139354535268
mai 2008313036364543342648484540454139354635268
abr 2008323036344543382648484436454139364636268
mar 2008313436374543402248484138454139364637266
fev 2008313036384543342348474438454139364637266
jan 2008313638384543352250484438454140364539265
dez 2007313436384643252349504534454140364540265
nov 2007303437384744441754564540484441364642265
out 2007303537394844511553544741484440364742264
set 2007293737384844501553564741494440354642262
ago 2007293435374844441753564340494440364942260
jul 2007293335374844441556564541484441384942260
jun 2007283136404845601456574543484342394943260
mai 2007283037384643511455574137464242394843260
abr 2007283537384543541655574838464242394843258
mar 2007273637404544551755574738464242384744258
fev 2007263136384544502055604938474342374845258
jan 2007242934394644461958624837484343374946257
dez 2006252934404545441760635538464443364948257
nov 2006252532384644481861615339484444374952256
out 2006253132384644541859555040484444385051255
set 2006253137364645581858554944474444395150252
ago 2006252633414546562160605044484545405250249
jul 2006253037494546482162605142474546395051245
jun 2006254138424546462159575040474446395150244
mai 2006252436454445452158564739464545385049241
abr 2006253236424345472257534537464545395049239
mar 2006253136434344512353524338464544405250236
fev 2006243739424244372951523935464343425151221
jan 2006243137394345362751494236464343435151221
dez 2005242431434345462745454142474443435355219
nov 2005242736434344502647474041474443425155219
out 2005232938454143552843443744464142425254218
set 2005233338474143602841433643444241425251210
ago 2005233134414039373139403240443941405149207
jul 2005232127404038443237392938443939425149207
jun 2005232632364039393137392936444138445249204
mai 2005232541384140352942394041454138475347200
abr 2005212941484140462636343844444136465149200
mar 2005213437544340442333333644433935445147199
fev 2005212837334240362029273133423634394943198
jan 2005212943394240382024222943433532404943197
dez 2004202840404338441819192041403231394838196
nov 2004202335514237491819162042383231374841195
out 2004204045473935531619172043363129354436195
set 2004191936283834341620182133353129344336191
ago 2004192743293734411516161834353028334236188
jul 2004181836363733431412141738353027314035160
jun 2004182035253633301512151623343124293833150
mai 2004181935303533251713131625373124293838147
abr 2004181431273635301416111731403225303739143
mar 2004201838333935323333333337403227324042138
fev 2004201838453431343030303033383024333931131
jan 2004222063463431362828272736382823393731128
dez 2003242352283027272424232326352722353931119
nov 2003231863423127242121202023322522373332107
out 2003261770382826201919181818292523362633102
set 200328276237313122181817172634312935253597
ago 200327277437323226171716162936332833273791
jul 200328267238313224161615152842342931303889
jun 200331268134303025141413133035322925233080
mai 200329227533282825141413132731302924232774
abr 200326277331272725141413132929292823202572
mar 200325196730272719131312122329282422202569
fev 200334226628282719131312122628272627192565
jan 2003312261262524171010993326232529182360
dez 20022822542424201599992325222326142153
nov 20022518482223211499992822202122132047
out 20022216441920201188882020181919101843
set 2002201639172019118888191917201381638
ago 2002181336161716118888161715161061535
jul 20021710341517168888814171616731533
jun 200217243415171611777731171616631533
mai 20021711201516159777716161515631419
abr 2002178191515158777715161515431318
mar 2002177191515159555515161515331218
fev 20021712191514149444413151414221018
jan 2002168171414148222216151515221116
dez 2001158161313137222211131414211015
nov 2001147151312127222212111213211014
out 200112912121111822221011111121912
set 20011251312101052222111110921812
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
 WikipedistasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

Wikipedistas (usuários registrados)
A = Wikipedistas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikipedistas que editaram pelo menos dez vezes desde que chegaram
C = Wikipedistas que contribuíram cinco vezes ou mais este mês
D = Wikipedistas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Artigos que contêm pelo menos uma ligação interna e 200 caracteres de texto legível, não contando códigos wiki e html,
      ligações ocultas, etc.; títulos também não contam (outras colunas são baseadas no método oficial de contagem)
G = Novos artigos por dia no mês passado
H = Número médio de revisões por artigo
I = Tamanho médio dos artigos em bytes
J = Porcentagem de artigos com pelo menos 0,5 kb de texto legível (veja F)
K = Porcentagem de artigos com pelo menos 2 kb de texto legível (veja F)

Base de dados
L = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
M = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
N = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
O = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
P = Total de ligações para outras wikipédias
Q = Total de imagens apresentadas
R = Total de ligações para outros sítios
S = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Namespaces: Articles = 0   Talk = 1,3,5,7,9,..   Other = 2,4,6,8,..

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 5  10  25  100  250  1000  2500  5  10  100  1000  5  10  25  100  250  1000  5  10  100  1000  5  10  25  100  250  1000  5  10  100  1000 
out 20091538453199  4847275614026132 221 774830104 272591
set 200913474482083 464324463432795 221 68432961 282391
ago 200914193481782 4947305554629135 221 845935155 3028131
jul 20091498548161041504931454372595 531 765639125 23209 
jun 200916995441741 423927454362694 221 81533094 252212 
mai 20091638957206214342275674933132 331 865536112 242112 
abr 200917610149219  4843285715027121 11  976739133 2420101
mar 20091781175928112 4643285785135183 431 967341186 242183
fev 20091941175824101 4644274865633152 43  1116542155 2118102
jan 2009187117552310214943348634833123 541 955940185 2824102
dez 20081841024918922464227681482682 431 896542113 181452
nov 2008163100652381 4745254745029114 222 1026440112 181361
out 20091538453199  4847275614026132 221 774830104 272591
set 200913474482083 464324463432795 221 68432961 282391
ago 200914193481782 4947305554629135 221 845935155 3028131
jul 20091498548161041504931454372595 531 765639125 23209 
jun 200916995441741 423927454362694 221 81533094 252212 
mai 20091638957206214342275674933132 331 865536112 242112 
abr 200917610149219  4843285715027121 11  976739133 2420101
mar 20091781175928112 4643285785135183 431 967341186 242183
fev 20091941175824101 4644274865633152 43  1116542155 2118102
jan 2009187117552310214943348634833123 541 955940185 2824102
dez 20081841024918922464227681482682 431 896542113 181452
nov 2008163100652381 4745254745029114 222 1026440112 181361
out 200817510164259  4640264715133111 111 1026436143 171383
set 2008142935724131 443825452382581     845135122 181572
ago 20081531006224121 42412236452289      966644163 201661
jul 20081531036228152 3937236664626113     966042178 221682
jun 2008147885926132 373325463442784     935436134 1916102
mai 200813310058239  353521471493194     936432135 181581
abr 2008118755020101 2523183543829113 11  865432103 111151
mar 200812977442191 232014345312492 1   734525112 141162
fev 200813585471911312322133544023103     60442594 14107 
jan 2008110664420103123191255839251371    755327146 12831
dez 20071137645188522119144482419631    614124106 9531
nov 200798643518102 212012335251651     72412463 9851
out 200710366331691 1616943521154      50351763111115 
set 2007956238179  1816834730226  111 694329104 7631
ago 2007118764319101 17161015234238      674323126 963 
jul 200711370411991 201811147301441     56371772 982 
jun 20071208240167  22201333326176      5838184  865 
mai 200711573371671 201711634301852 11  6834153  8752
abr 20079259341762 1717922618115  21  5034164  8632
mar 20079555361481 1313523326144  33  50291231 5432
fev 200711471401361 1210633423152  11  5228154  4421
jan 200712471431271 995230231021     62371451 5411
dez 200611374351481111115335231662 222159292072 6531
nov 200611170371581 1175235271941     60311851 2211
out 2006986132143  983130201461     5125153  21  
set 2006775030166  87212418932     46241331 1   
ago 2006985935123  99523014811     5227101  332 
jul 200670422762  66312315721     462010   22  
jun 200647271583  5531159711     3620111  221 
mai 200671492674  4331191391      46251121     
abr 200655321482  4331171092      321872      
mar 200653321674  54412314101      342111   22  
fev 2006372211631 22211411711     2312721 11  
jan 2006513018951 332 13841      231662  1   
dez 200562321573  321 1063       211131  21  
nov 200539271253  321194311     251111  21  
out 200535201042  221 11821      14931      
set 20053015731  2211311       821       
ago 200538241652  331 643       2112711 11  
jul 200545281363  443 1282       2613411 21  
jun 2005342311531 111 652       1815721 11  
mai 20052415942  11  43        14821      
abr 20052412621      33        1242       
mar 20052815711      762       1193       
fev 20052214842      1054       854       
jan 2005191152       12104       1052       
dez 20041710521      432       7421  11  
nov 2004191391       311       431       
out 2004158511      11        543       
set 2004191343   1   321       11331      
ago 2004149332      33        631       
jul 2004211372       51        74        
jun 20042313743      31        1042   11  
mai 20042114822      53        963   11  
abr 20042516113   1   542       1161       
mar 2004161472       21        832       
fev 20041494        222       322       
jan 2004861        311       731       
dez 200311641       221       5311  11  
nov 2003644        31        11        
out 2003432        443       421       
set 200352         21        11        
ago 2003211        1         11        
jul 200321                             
jun 2003                               
mai 2003                               
abr 2003                               
mar 200311                             
fev 2003                               
jan 2003                               
dez 2002                     1         
nov 2002                               
out 2002                               
set 2002                               
ago 2002                               
jul 2002                               
jun 2002                               
mai 2002                               
abr 2002                               
mar 2002                               
fev 2002                               
jan 2002                               
dez 2001                               
nov 2001                               
out 20011                              
set 2001                     1         

 

Distribuição de edições de artigos por wikipedistas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikipedistasEdições total
113326100.0%478868100.0%
3438732.9%46549597.2%
10209015.7%45236794.5%
328366.3%43160390.1%
1003822.9%40676984.9%
3161881.4%37343678.0%
1000800.6%31196965.1%
3162310.2%23022348.1%
1000050.0%9526119.9%

 

50 wikipedistas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesPrimeira edição
ArtigosOutros
 posiçãoúltimos
30 dias
totaltotalúltimos
30 dias
datadias
atrás
agoraΔ
Eptalon2 030320714908596dez 20, 20051410
Razorflame3 067175261434880nov 23, 2007707
Nameless_User4+180713536156879ago 30, 2008426
Synergy6 02986123561jul 25, 2008462
Peterdownunder15 01495709200470mai 25, 2008523
RyanCross17 0275250402753jun 14, 2008503
The_Rambling_Man18 020348623649333mar 31, 2008578
Griffinofwales20+272944943539958mai 07, 2009176
Barras23 019838104708370fev 01, 2009271
D'ohBot24+7694379241jun 26, 2009126
Juliancolton28-18834482353109jun 25, 2008492
Hikitsurisan29-15433624455mai 29, 20061250
Chenzw30-1133261593664mar 10, 2007965
Yotcmdr33 0432769332488ago 31, 2008425
Tholly34 05268815062jul 01, 2008486
Huji35 0126133367 mai 13, 2007901
Majorly37 0292357310660dez 16, 20061049
Bluegoblin738+18423026964291out 12, 2008383
Vector41+13218821089ago 28, 20061159
Penarc44 01620171242jun 03, 2007880
Pmlinediter45+1654019603592864mai 02, 2009181
NonvocalScream49+736018743276684mar 23, 2008586
Tdxiang52-26172715524mai 03, 20061276
The_Flying_Spaghetti_Monster55-2115751320 dez 16, 2007684
Fr33kman56+39415554193296set 19, 2008406
Zephyrad57-21815421994jul 28, 20061190
Djsasso59+18015123534310dez 11, 20041784
Gesslein62 04414211126jan 20, 2008649
Mentifisto63+11681378988238jan 17, 2008652
Mercy64+311913151836199jun 28, 2008489
Either_way68 0101196172022dez 21, 2008313
Kidlat69+161118913 ago 25, 2008431
EhJJ70-1101174199663fev 26, 2009246
Kennedy73 021112245713abr 23, 2008555
12george181+3635498510924out 24, 2008371
Sinbad85+57894518418jul 04, 2007849
Werdan786-199419302dez 29, 20061036
Pahari_Sahib90+1549032266mar 15, 2008594
M793-138399243mar 29, 20051676
Beefball95+1158264547jun 10, 2008507
Maximillion_Pegasus106+22154730635195fev 06, 2008632
Microchip08107-2172927251abr 16, 2008562
Jmarcano123+11725992624set 12, 2007779
Macdonald-ross130+442305657931set 04, 200956
KingRaven44131...5655659292out 17, 200913
PeterSymonds148-28455120317jul 26, 2008461
EoGuy149+2311345136 mai 14, 2008534
Maarcis163+3303776711ago 30, 200961
Runningblader164-433757808jan 26, 2008643
Dalibor_Bosits165+114337420529mar 25, 2008584

 

20 wikipedistas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesPrimeira ediçãoúltima edição
 posiçãototaldatadias
atrás
datadias
atrás
Creol130520out 19, 20061107jan 29, 2009274
Barliner512965jul 27, 2007826dez 22, 2008312
Tygrrr77806dez 28, 20061037jul 09, 2009113
Blockinblox87402out 14, 20051477mar 27, 2009217
Freshstart97276dez 13, 20051417ago 06, 20061181
Fairfield107139set 20, 2007771abr 09, 2009204
DodekBot116879dez 29, 20061036ago 07, 2008449
Hailey_C._Shannon126568jan 21, 20051743jan 23, 2009280
Gwib136215abr 10, 2007934jul 15, 2009107
American_Eagle145809abr 08, 2008570jul 31, 200991
GoblinBot2165446nov 03, 2008361jul 16, 2009106
Cethegus194657out 02, 20061124set 29, 200931
Snake311214078jul 02, 20061216ago 21, 200970
Ricky81682223993mai 11, 20051633nov 19, 2007711
Isis253604abr 26, 2007918jul 20, 2009102
JurgenG263575ago 22, 20061165jun 05, 2009147
Neurolysis273469nov 28, 2008336mai 22, 2009161
Exert313197jun 18, 2007865ago 03, 200988
EchoBravo322906jan 11, 20071023out 22, 2008373
Winterkind362480mar 03, 2008606set 01, 200959

 

usuários anônimos, ordenados por número de contribuições
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
92.2.101.184982
24.17.48.241752
71.10.52.224597
83.13.213.19528
24.16.56.60429
92.1.95.219413
212.121.219.1354
88.134.192.92337
92.4.242.23322
24.1.4.241314

No total 194.705 edições foram feitas por usuários anônimos, de um total de 1187.399 edições ( 16e %)
  


50 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesPrimeira ediçãoúltima edição
 posiçãototaldatadias
atrás
datadias
atrás
SieBot153123jun 18, 2007865out 31, 2009 
Thijs!bot239440mai 10, 20061269set 05, 200955
TXiKiBoT337820fev 20, 2007983out 31, 2009 
VolkovBot432545mar 02, 2007973out 31, 2009 
JAnDbot524515ago 20, 20061167out 27, 20093
YurikBot623403mai 21, 20051623ago 25, 20061162
Escarbot721315jun 16, 20061232out 31, 2009 
Xqbot817467jan 03, 2009300out 31, 2009 
Alexbot916262jan 07, 2008662out 31, 2009 
MelancholieBot1015851mar 30, 2008579out 31, 2009 
ArthurBot1114290dez 18, 2008316out 31, 2009 
AlleborgoBot1211985abr 12, 2007932dez 16, 2008318
DragonBot139385out 05, 2007756ago 25, 200966
FlaBot149053abr 30, 20051644set 11, 200949
BotMultichill158974abr 26, 2007918abr 11, 2008567
Darkicebot168375dez 31, 2007669out 15, 200915
Synthebot177586mar 29, 2007946out 17, 200913
Yotbot187158dez 29, 2008305mar 13, 2009231
OKBot196816jun 08, 2007875jan 28, 2009275
SassoBot205550dez 29, 2008305out 31, 2009 
TinucherianBot_II215454out 25, 2008370out 29, 20091
CarsracBot225452mai 21, 2008527out 31, 2009 
Idioma-bot235411mar 01, 2007974out 31, 2009 
Ptbotgourou245406jul 29, 2008458out 31, 2009 
SilvonenBot255151abr 14, 2008564out 30, 2009 
ChenzwBot264889abr 10, 2008568out 08, 200922
AndersBot274839abr 26, 2008552out 25, 20095
Jotterbot284564ago 24, 2008432out 31, 2009 
PipepBot294442jul 31, 2007822set 27, 2008398
LaaknorBot303709nov 09, 2008355out 31, 2009 
Chlewbot313686nov 30, 20051430mar 10, 2008599
VecBot323496set 18, 20061138ago 27, 200964
W7bot333446fev 20, 2007983ago 19, 2007803
Nallimbot343223out 28, 2008367abr 01, 2009212
LinkFA-Bot353192jun 09, 2008508set 16, 200944
SteveBot363191nov 11, 2008353mar 01, 2009243
RibotBOT373133jul 26, 200996out 31, 2009 
BodhisattvaBot382954fev 21, 2008617jul 11, 2009111
BOTarate392818fev 11, 2008627set 07, 200953
AmaraBot402812jul 08, 2008479out 31, 2009 
YonaBot412720abr 07, 2007937jun 23, 2007860
TobeBot422666ago 16, 200975out 31, 2009 
Robbot432549out 11, 20032211out 31, 2009 
Thollybot442523ago 02, 2008454jun 27, 2009125
WikiDreamer_Bot452451jun 01, 2008516ago 06, 2008450
PixelBot462248nov 02, 2007728jan 23, 2008646
Rubinbot472247abr 02, 2009211out 31, 2009 
Chris_G_Bot482226set 30, 2008395mar 19, 2009225
Zorrobot492220jan 05, 2009298out 31, 2009 
Muro_Bot502086jul 03, 2008484out 19, 200911

 

Artigos que contêm pelo menos uma ligação interna e .. caracteres de texto legível, não contando códigos wiki e html,
ligações ocultas, etc.; títulos também não contam  (excluindo páginas de redirecionamento)

DataArtigos
 < 32 ch< 64 ch< 128 ch< 256 ch< 512 ch< 1 k ch< 2 k ch< 4 k ch< 8 k ch< 16 k ch< 32 k ch< 64 k ch
out 20090.0%0.2%8.0%23.6%39.6%60.8%82.3%93.1%97.7%99.3%99.8%99.9%
set 20090.0%0.2%8.2%24.1%40.1%61.4%82.5%93.2%97.8%99.4%99.9%100.0%
ago 20090.0%0.2%8.3%24.5%40.6%62.1%82.8%93.4%97.9%99.5%100.0%100.0%
jul 20090.0%0.2%8.4%25.5%41.7%62.5%82.8%93.3%97.8%99.4%99.9%100.0%
jun 20090.0%0.2%8.3%25.9%42.1%63.0%83.0%93.3%97.8%99.4%99.9%100.0%
mai 20090.0%0.2%8.4%26.2%42.5%63.4%83.4%93.5%97.9%99.4%99.9%100.0%

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.

See also Category Overview Complete (2.3 Mb!), Concise (74 kb)
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110GifOggPng
out 200981 k8,3 k1,8 k433988,1 k8312 k      95%1348
set 200978 k8,1 k1,8 k433987,7 k8312 k      95%1348
ago 200976 k7,9 k1,8 k423927,6 k8312 k      95%1338
jul 200975 k7,7 k1,6 k423907,5 k8312 k      95%1338
jun 200973 k7,5 k1,6 k423257,4 k8312 k      95%1338
mai 200972 k7,3 k1,5 k423157,2 k8312 k      95%1338
out 200981 k8,3 k1,8 k433988,1 k8312 k      95%1348
set 200978 k8,1 k1,8 k433987,7 k8312 k      95%1348
ago 200976 k7,9 k1,8 k423927,6 k8312 k      95%1338
jul 200975 k7,7 k1,6 k423907,5 k8312 k      95%1338
jun 200973 k7,5 k1,6 k423257,4 k8312 k      95%1338
mai 200972 k7,3 k1,5 k423157,2 k8312 k      95%1338
abr 200970 k7,0 k1,4 k423047,1 k8312 k      95%1338
mar 200969 k6,8 k1,4 k413006,9 k8311 k      95%1328
fev 200967 k6,5 k1,3 k213006,5 k8311 k      95%1128
jan 200965 k6,2 k1,2 k212966,3 k3511 k      95%1128
dez 200857 k6,0 k1,1 k212936,1 k3511 k      95%1128
nov 200854 k5,8 k1,0 k212925,9 k3410 k      95%1128
out 200852 k5,5 k914212905,7 k3410 k      95%1128
set 200849 k5,3 k843212755,5 k339,9 k      94%1128
ago 200847 k5,1 k783212645,3 k339,6 k      94%1128
jul 200845 k4,8 k720212615,0 k299,3 k      94%1128
jun 200842 k4,5 k654212534,8 k289,0 k      94%1128
mai 200840 k4,2 k608212524,4 k278,6 k      94%1128
abr 200839 k4,0 k562212434,1 k258,3 k      95%1128
mar 200837 k3,7 k538212253,9 k248,2 k      94%1128
fev 200836 k3,6 k516211833,8 k247,9 k      95%1128
jan 200834 k3,4 k503211703,7 k247,4 k      94%1128
dez 200732 k3,2 k478211433,4 k236,9 k      96%1128
nov 200730 k3,0 k457211303,0 k236,4 k      96%1128
out 200729 k2,9 k452211292,8 k236,2 k      95%1128
set 200728 k2,8 k436211282,2 k225,8 k      96%1128
ago 200727 k2,7 k396211241,7 k205,6 k      95%1128
jul 200725 k2,5 k364201201,6 k195,3 k      95%1118
jun 200724 k2,4 k341201111,5 k175,1 k      96%1118
mai 200723 k2,3 k318201111,4 k174,9 k      96%1118
abr 200722 k2,2 k307201111,3 k174,8 k      96%1118
mar 200721 k2,1 k288201081,2 k154,6 k      96%1118
fev 200720 k2,0 k28520921,2 k154,2 k      96%1118
jan 200719 k1,9 k25820921,1 k153,8 k      96%1118
dez 200618 k1,7 k2482092943153,7 k      95%1118
nov 200617 k1,6 k2362087773153,5 k      88%1118
out 200616 k1,4 k2262087754153,2 k      83%1118
set 200615 k1,3 k1981487735153,0 k      82%158
ago 200614 k1,2 k1921487681142,9 k      82%158
jul 200613 k1,1 k1861486661122,8 k      82%158
jun 200612 k1,0 k174986638122,8 k      81%1 8
mai 200612 k968160985591122,6 k      78%1 8
abr 200611 k896153985405122,3 k      77%1 8
mar 200610,0 k841146983357122,1 k      76%1 8
fev 20069,4 k766146983335112,1 k      76%1 8
jan 20068,5 k722132981310111,9 k      73%1 8
dez 20057,3 k667128981269111,9 k      66%1 8
nov 20056,7 k606125976241111,7 k      66%1 8
out 20056,3 k568124976224111,6 k      64%1 8
set 20055,9 k530123976218111,5 k      61%1 8
ago 20055,8 k502123976214111,5 k      61%1 8
jul 20055,3 k479117976187111,1 k      57%1 8
jun 20054,9 k43411597117511731      54%1 8
mai 20054,4 k40511297114211376      50%1 8
abr 20053,9 k36811097112811240      39%1 8
mar 20053,7 k34010997111811197      35%1 8
fev 20053,4 k3151079716011187      35%1 8
jan 20053,1 k2901069715411148      33%1 8
dez 20042,7 k2631069715010141      35%1 8
nov 20042,5 k2509697038994      23%1 8
out 20042,4 k2339296936987      22%1 8
set 20042,3 k2188916936881      21%  1
ago 20042,0 k2028516826840      18%  1
jul 20041,9 k179831682181      4%  1
jun 20041,8 k15982 67158           
mai 20041,6 k13282 66126           
abr 20041,3 k11970 33116           
mar 20041,1 k9365 3395           
fev 20049228162 3385           
jan 20048307257 3275           
dez 20037573949 3175           
nov 20035472825   4           
out 20034022122   3           
set 20031891512   3           
ago 2003131109   2           
jul 20038065   1           
jun 20034844   1           
mai 20034324               
abr 20034023               
mar 20033722               
fev 20031321               
jan 20031111               
dez 20021011               
nov 200281                
out 200281                
set 200271                
ago 200271                
jul 200261                
jun 200261                
mai 200261                
abr 200261                
mar 200261                
fev 200261                
jan 200251                
dez 200151                
nov 200151                
out 200151                
set 200111                

 

50 most edited articles (> 25 edits)  More..
 

EdiçõesUnique usersArtigosArchived
TotalReg.Reg.Unreg.
1569496%633460Wikipedia:Simple talk1095.4 Mb  
6224100%15 User:Chris G Bot/Rfx4.1 Mb  
546897%25775Wikipedia:Administrators' noticeboard249.1 Mb  
477798%33054Wikipedia:Requests for deletion70.1 Mb  
363298%28650User talk:Razorflame151.3 Mb  
345399%7613Template talk:Did you know54.5 Mb  
306055%262804Wikipedia:Sandbox/RevisionArchive1-Part28.3 Mb  
280397%23047Wikipedia:Vandalism in progress32.0 Mb  
238599%19914Wikipedia:Requests for adminship31.1 Mb  
228399%1166Wikipedia:Proposed good articles39.1 Mb  
227898%16323User talk:Gwib80.1 Mb  
196199%1209Wikipedia:Proposed very good articles19.5 Mb  
188860%172407Wikipedia:Sandbox/RevisionArchive1-Part12.2 Mb  
184998%12822Wikipedia:RecentChanges12.5 Mb  
158598%18822Wikipedia:Administrators25.5 Mb  
135698%10720User talk:Bluegoblin741.6 Mb  
131156%218312United States40.8 Mb  
123598%19820User talk:Eptalon40.2 Mb  
114196%11528User talk:Fairfield68.6 Mb  
113553%297292Mark4.0 Mb  
106197%10419User talk:RyanCross18.4 Mb  
100997%11921User talk:American Eagle31.6 Mb  
97299%1076Wikipedia:Requests for checkuser23.6 Mb  
91898%11511User talk:Christianrocker9011.5 Mb  
91696%10718User talk:Fr33kman38.7 Mb  
91096%10424User talk:Tygrrr39.5 Mb  
90193%13334User talk:Chenzw18.6 Mb  
88564%164178Jesus23.8 Mb  
83797%4923User:Razorflame8.8 Mb  
80659%100110Wade Redden13.8 Mb  
78649%132229World War II9.9 Mb  
78453%133223World War I13.2 Mb  
77760%148189Islam10.1 Mb  
77797%9216User talk:Kennedy16.5 Mb  
77693%15630User talk:Archer722.8 Mb  
77593%11535User talk:Majorly24.6 Mb  
74159%202213Candidiasis7.3 Mb  
73799%1488Wikipedia talk:Bots13.0 Mb  
73666%150151Adolf Hitler6.8 Mb  
73171%162158Talk:Main Page11.7 Mb  
72848%122171William Shakespeare5.7 Mb  
72839%115231Global warming10.0 Mb  
71566%149142Christianity18.0 Mb  
71255%148187Canada9.4 Mb  
70576%149130France9.8 Mb  
70355%194194Cancer (constellation)6.3 Mb  
69875%191131Wikipedia:Requested pages3.1 Mb  
69473%143123India11.3 Mb  
68996%6322User talk:Griffinofwales7.6 Mb  
67269%136117Earth7.2 Mb  

 

ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

set 2001: 1 1 Mark

out 2001: 1 1 Textual difficulty

fev 2002: 1 2 Mark , 2 1 Candidiasis

jul 2002: 1 1 Mark

ago 2002: 1 2 Candidiasis , 2 1 Northern League (baseball)

set 2002: 1 1 Candidiasis

out 2002: 1 1 Cancer (constellation)

dez 2002: 1 1 Chalcedon

jan 2003: 1 1 World War I

fev 2003: 1 3 Cancer (constellation) , 2 1 Very High Bitrate Digital Subscriber Line

mar 2003: 1 2 Cancer (constellation)

abr 2003: 1 1 Cancer (constellation)

mai 2003: 1 2 Cancer (constellation) , 2 1 Northern League (baseball)

jun 2003: 1 1 Northern League (baseball)

jul 2003: 1 4 Reliant Astrodome , 2 2 Cancer (constellation) , 3 1 Northern League (baseball)

ago 2003: 1 3 Cancer (constellation) , 2 2 Reliant Astrodome , 3 1 Montreal Wanderers

set 2003: 1 3 Name , 2 2 Very High Bitrate Digital Subscriber Line , 3 2 Oahu , 4 2 Non-profit , 5 2 Macadamia Nuts

out 2003: 1 2 Northern League (baseball) , 2 2 Microsoft Windows , 3 2 Verb , 4 2 Unit of measurement , 5 2 Terrestrial ecoregion , 6 2 Sheep , 7 2 Psychoneuroimmunology , 8 2 Microsoft , 9 2 History , 10 2 FAQ , 11 2 Chorizo , 12 2 Beekeeping

nov 2003: 1 3 Dimension , 2 2 Window , 3 2 Volume , 4 2 Table , 5 2 Systeme internationale , 6 2 State , 7 2 Server log , 8 2 Sport , 9 2 Pi , 10 2 Pluto , 11 2 Periodic table , 12 2 Plant , 13 2 Like , 14 2 Kill , 15 2 Helium , 16 2 Geometry , 17 2 Egypt , 18 2 Elements , 19 2 Depth , 20 2 Dimensions , 21 2 Crust , 22 2 Coin , 23 1 Very High Bitrate Digital Subscriber Line

dez 2003: 1 5 Main Page , 2 3 Zinc , 3 3 Dimension , 4 3 Browser , 5 3 Basic English , 6 2 English language learning and teaching , 7 2 Vulcanicity , 8 2 Fold (geology) , 9 2 Endogenetic process , 10 2 Old calendar , 11 2 Atlantic Ocean , 12 2 Mexico , 13 2 Gaol , 14 2 Republic of China , 15 2 Zoo , 16 2 Chinese language , 17 2 Web browser , 18 2 Unix , 19 2 University , 20 2 Right angle , 21 2 Recent conflicts in the Muslim World , 22 2 Plastic , 23 2 Periodic table , 24 2 Psychoneuroimmunology , 25 2 Mechanistic paradigm

jan 2004: 1 5 Main Page , 2 3 United States dollar , 3 3 Colour , 4 2 Wade Redden , 5 2 Names of numbers in English , 6 2 English language learning and teaching , 7 2 Euro , 8 2 Albert Einstein , 9 2 Semiotics , 10 2 Asia , 11 2 World War I , 12 2 Slavery , 13 2 River , 14 2 Japan

fev 2004: 1 11 Main Page , 2 4 Mark , 3 4 Computer network , 4 4 Kami , 5 3 Russia , 6 3 Berlin , 7 3 Luxembourg , 8 3 Communication , 9 3 Cat , 10 3 Romania , 11 3 Google , 12 2 United States , 13 2 Wikipedia , 14 2 Canada , 15 2 1990s , 16 2 Munich , 17 2 Peru , 18 2 Homonym , 19 2 Vienna , 20 2 Baden-Württemberg , 21 2 Treaty , 22 2 Natural satellite , 23 2 Trier , 24 2 William Shakespeare , 25 2 Cardboard

mar 2004: 1 5 Television , 2 4 Main Page , 3 4 Asteroid , 4 3 Mark , 5 3 Discovery , 6 3 Christmas cake , 7 3 Gas syringe , 8 3 Scotland , 9 3 United States dollar , 10 3 Unit of measurement , 11 3 Universe , 12 3 Solar System , 13 3 OK , 14 3 Mars , 15 3 Mass , 16 3 Japan , 17 3 Dictionary , 18 2 Sun , 19 2 Minnesota River , 20 2 German language , 21 2 Renegades , 22 2 Properties , 23 2 Metal , 24 2 Paper , 25 2 London Borough of Islington

abr 2004: 1 10 Main Page , 2 4 Mark , 3 4 French language , 4 4 Fertilizer , 5 4 Culture , 6 4 Euro , 7 3 United States , 8 3 North , 9 3 Gross domestic product , 10 3 Photon , 11 3 Desktop environment , 12 3 Linux , 13 3 Buddha , 14 3 Sphere , 15 3 Isotope , 16 3 Minute , 17 3 Opera (browser) , 18 3 Bambuco , 19 3 Female , 20 3 Chess , 21 3 Slope , 22 3 Christianity , 23 3 Oceania , 24 3 Indian Ocean , 25 3 Mercury (element)

mai 2004: 1 6 Main Page , 2 4 Air space , 3 4 Vitamin C , 4 4 Generation , 5 4 Preposition , 6 4 North , 7 4 Internet Explorer , 8 4 Raw , 9 3 Mark , 10 3 United States , 11 3 Oxidation , 12 3 Lao Zi , 13 3 Snow , 14 3 East , 15 3 Lake , 16 3 Adelaide , 17 3 Nuclear war , 18 3 Market , 19 3 Rain , 20 3 Light , 21 3 Jungle , 22 3 19th century , 23 3 Decade , 24 3 Arrow , 25 3 Comet Halley

jun 2004: 1 6 Marco Polo , 2 6 Google Mail , 3 5 Aristotle , 4 5 Adolf Hitler , 5 5 Population , 6 5 Chat , 7 5 British English , 8 4 General Public License , 9 4 Herbivore , 10 4 Omnivore , 11 4 Astronomer , 12 4 Paris , 13 4 Tony Blair , 14 4 Neuron , 15 4 Tokyo , 16 4 Snow , 17 4 Japanese language , 18 4 Plato , 19 4 Blindness , 20 4 Albania , 21 4 World War II , 22 4 Search engine , 23 4 Periodic table , 24 4 Philosophy , 25 4 Microsoft

jul 2004: 1 5 Wikipedia , 2 5 Main Page , 3 5 English , 4 4 EBay , 5 4 Tokyo , 6 4 Australia , 7 3 Libertarianism , 8 3 Luke McCormick , 9 3 Cocoa , 10 3 Translation , 11 3 Fixed-wing aircraft , 12 3 Star , 13 3 Christianity , 14 3 1990s , 15 3 1980s , 16 3 Bible , 17 3 Wiki , 18 2 IRCd , 19 2 Mark , 20 2 Reliant Astrodome , 21 2 Saskatchewan , 22 2 Martin Luther , 23 2 Immanuel Kant , 24 2 1970 , 25 2 Carbon

ago 2004: 1 4 United States , 2 4 Stockholm , 3 4 Norway , 4 4 Cologne , 5 4 Turkey , 6 4 Sweden , 7 3 Highland Football League , 8 3 Oral candidiasis , 9 3 Naples , 10 3 Socrates , 11 3 Afganistan , 12 3 Pakistan , 13 3 Atlanta, Georgia , 14 3 Côte d'Ivoire , 15 3 Aristotle , 16 3 Kyoto, Japan , 17 3 Johann Sebastian Bach , 18 3 Tokyo , 19 3 Xenon , 20 3 Lisbon , 21 3 Estonia , 22 3 Chile , 23 3 Das Lied der Deutschen , 24 3 Plato , 25 3 South Africa

set 2004: 1 8 Mark , 2 5 Main Page , 3 4 Canada , 4 4 DNA , 5 3 United States , 6 3 George Washington , 7 3 Mandarin language , 8 3 George W. Bush , 9 3 Mexico , 10 3 Wiki , 11 3 Japan , 12 3 Cuba , 13 2 Candidiasis , 14 2 Iraq , 15 2 Czech Republic , 16 2 Snail mail , 17 2 Kinetic energy , 18 2 Amaterasu , 19 2 Shogun , 20 2 Fuck , 21 2 Lion , 22 2 Direction , 23 2 Your mileage may vary , 24 2 Arundel Castle , 25 2 Position

out 2004: 1 5 Breakfast , 2 5 Main Page , 3 4 Julius Caesar , 4 3 Candidiasis , 5 3 Mark , 6 3 Homer , 7 3 Munich , 8 3 English , 9 2 Bukit Timah , 10 2 Northern League (baseball) , 11 2 Daemon (computer software) , 12 2 Cancer (constellation) , 13 2 Discovery , 14 2 Ocean , 15 2 Chalcedon , 16 2 Lemon , 17 2 Brush , 18 2 List of elements by atomic number , 19 2 List of elements by symbol , 20 2 Hokkaido , 21 2 Bag , 22 2 Town , 23 2 Alpha male , 24 2 Adaware SE , 25 2 Dutch language

nov 2004: 1 4 Mark , 2 4 Psychology , 3 4 George W. Bush , 4 4 Main Page , 5 3 United States , 6 3 Comparative , 7 3 George Orwell , 8 3 Chopsticks , 9 3 Synonym , 10 3 Archduke Franz Ferdinand of Austria , 11 3 John Kerry , 12 3 English language learning and teaching , 13 3 Solar System , 14 3 Music , 15 3 Judaism , 16 3 History , 17 2 Very High Bitrate Digital Subscriber Line , 18 2 Candidiasis , 19 2 Wikipedia , 20 2 Flag , 21 2 Czech Republic , 22 2 Stephen Hawking , 23 2 Nahuatl language , 24 2 Spanish language , 25 2 Panama

dez 2004: 1 5 Mark , 2 4 Death penalty , 3 4 Main Page , 4 3 Creative network , 5 3 Reliant Astrodome , 6 3 Dictator , 7 3 Viktor Yushchenko , 8 3 Province , 9 3 Salamander , 10 3 February 12 , 11 3 February 22 , 12 3 1882 , 13 3 George W. Bush , 14 3 Das Lied der Deutschen , 15 3 Netherlands , 16 3 English language learning and teaching , 17 3 World War I , 18 3 France , 19 3 Edit , 20 3 English , 21 3 Dictionary , 22 3 Bottle , 23 2 Northern League (baseball) , 24 2 Eric Staal , 25 2 Highland Football League

jan 2005: 1 5 Cancer (constellation) , 2 5 Light pollution , 3 3 Daemon (computer software) , 4 3 January 30 , 5 3 February 21 , 6 3 May 1 , 7 3 Jurassic Park: Operation Genesis , 8 3 Pig Latin , 9 3 Jurassic Park , 10 3 Friends , 11 3 Mrs. Doubtfire , 12 3 J. R. R. Tolkien , 13 2 Northern League (baseball) , 14 2 Very High Bitrate Digital Subscriber Line , 15 2 Leipzig , 16 2 Meal , 17 2 James Joyce , 18 2 John Lennon , 19 2 Paul McCartney , 20 2 Boy , 21 2 Ferrocement , 22 2 Henry VIII of England , 23 2 Theodore Roosevelt , 24 2 Jimmy Carter , 25 2 Nickelodeon

fev 2005: 1 5 Ray Charles , 2 4 Wikipedia , 3 4 Dodgeball , 4 4 Rainbow , 5 4 Korean War , 6 4 George W. Bush , 7 4 Rudyard Kipling , 8 4 Brazil , 9 3 Cancer (constellation) , 10 3 Steel , 11 3 Stanley Kubrick , 12 3 Orphanage , 13 3 Uno (card game) , 14 3 Trailer (movie) , 15 3 Richard Attenborough , 16 3 Flower , 17 3 Cage , 18 3 February 7 , 19 3 American Samoa , 20 3 Diaper , 21 3 Jehovah's Witnesses , 22 3 Mario Party , 23 3 Light pollution , 24 3 Jerry Lee Lewis , 25 3 Frank Zappa

mar 2005: 1 5 Fibonacci , 2 4 Vandalism , 3 4 Algebra , 4 3 Guy Carbonneau , 5 3 Cheers , 6 3 September 26 , 7 3 Free will , 8 3 1973 , 9 3 Tunnel , 10 3 Somerset , 11 3 City of London , 12 3 Green , 13 2 Bukit Timah , 14 2 Eric Staal , 15 2 Montreal Wanderers , 16 2 Daemon (computer software) , 17 2 Cancer (constellation) , 18 2 Brown tree snake , 19 2 Mark , 20 2 BBC Radio Scotland , 21 2 Wikipedia , 22 2 Watergate scandal , 23 2 Welsh , 24 2 Jerusalem , 25 2 December 11

abr 2005: 1 6 Daemon (computer software) , 2 5 Main Page , 3 4 The Who , 4 4 Pope John Paul II , 5 4 Cartoonist , 6 3 IRCd , 7 3 BBC Radio Scotland , 8 3 Hip hop , 9 3 1923 , 10 3 1904 , 11 3 Scandinavia , 12 3 Led Zeppelin , 13 3 Elton John , 14 3 Aquilino Pimentel, Jr. , 15 3 Estonia , 16 3 Movie , 17 3 Blood , 18 2 Cancer (constellation) , 19 2 Reliant Astrodome , 20 2 Wikipedia , 21 2 Catholic , 22 2 River Clyde , 23 2 Guan Gong , 24 2 Istanbul , 25 2 The Smurfs

mai 2005: 1 6 Main Page , 2 5 Cancer (constellation) , 3 5 Pope John Paul II , 4 5 Homosexuality , 5 4 Brandon Wheat Kings , 6 4 Jew , 7 4 January 17 , 8 4 January 15 , 9 4 Will Smith , 10 4 Jerry Lee Lewis , 11 4 Pencil , 12 4 Earth , 13 3 United States , 14 3 A.C. Milan , 15 3 WC Fields , 16 3 July 14 , 17 3 Store , 18 3 January 22 , 19 3 January 20 , 20 3 January 16 , 21 3 January 13 , 22 3 January 12 , 23 3 January 2 , 24 3 Algiers , 25 3 Clint Eastwood

jun 2005: 1 6 United States , 2 5 Cairo , 3 5 Portugal , 4 5 China , 5 4 Scott Young , 6 4 Candidiasis , 7 4 Bent , 8 4 Kim Il-sung , 9 4 Calvin and Hobbes , 10 4 Audrey Hepburn , 11 4 Germany , 12 4 Jesus , 13 3 Northern League (baseball) , 14 3 Daemon (computer software) , 15 3 Reliant Astrodome , 16 3 Nirvana (band) , 17 3 Wikipedia , 18 3 Otis Redding , 19 3 Horse , 20 3 Tennessee , 21 3 Kentucky , 22 3 Jane Seymour , 23 3 Henrietta Maria of France , 24 3 Robert Englund , 25 3 Arkansas

jul 2005: 1 7 London , 2 6 Discovery , 3 5 Neil Young , 4 5 Vladimir Nabokov , 5 5 Oscar Wilde , 6 5 Pink Floyd , 7 5 Philosophy , 8 5 Music , 9 4 Northern League (baseball) , 10 4 Candidiasis , 11 4 Nirvana (band) , 12 4 Maceió (Brazil) , 13 4 Roberta Flack , 14 4 KC & the Sunshine Band , 15 4 The Specials , 16 4 Aaron Copland , 17 4 George Gershwin , 18 4 Costa Rica , 19 4 Steppenwolf , 20 4 Blue Öyster Cult , 21 4 The Cure , 22 4 Liberia , 23 4 John Williams , 24 4 Larry Mullen Jr. , 25 4 The Edge

ago 2005: 1 8 Pokémon (video game series) , 2 6 Reliant Astrodome , 3 5 Very High Bitrate Digital Subscriber Line , 4 5 Cancer (constellation) , 5 5 George W. Bush , 6 4 Candidiasis , 7 4 Testicle , 8 4 Consciousness , 9 4 Bill Clinton , 10 4 Alan Turing , 11 3 Pikachu , 12 3 Daemon (computer software) , 13 3 Mark , 14 3 BBC Radio 1Xtra , 15 3 Rage Against the Machine , 16 3 Large format lens , 17 3 The Simpsons , 18 3 Taumatawhakatangihangakoauauotamateapokaiwhenuakitanatahu , 19 3 Pneumoconiosis , 20 3 Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch , 21 3 Human rights , 22 3 Clock , 23 3 Marlon Brando , 24 3 1776 , 25 3 Guinea pig

set 2005: 1 20 Reliant Astrodome , 2 7 George W. Bush , 3 6 Candidiasis , 4 5 Cancer (constellation) , 5 4 Mark , 6 4 Vice president , 7 3 Ocarina , 8 3 Esperanto , 9 3 December 13 , 10 2 Northern League (baseball) , 11 2 BBC Radio 5 Live Sports Extra , 12 2 Canada , 13 2 Wendy Carlos , 14 2 Instant message , 15 2 Margaret Thatcher , 16 2 William Henry Harrison , 17 2 1557 , 18 2 Emeril Lagasse , 19 2 1615 , 20 2 Byte , 21 2 Juan Ponce de Leon , 22 2 1514 , 23 2 Terry Fox , 24 2 Piedmont , 25 2 Swedish krona

out 2005: 1 6 Edgar Allan Poe , 2 5 Cancer (constellation) , 3 5 Candidiasis , 4 5 Monica Lewinsky , 5 4 Gene Hackman , 6 4 Hippopotamus , 7 4 Elton John , 8 4 Toledo, Ohio , 9 4 George W. Bush , 10 3 Very High Bitrate Digital Subscriber Line , 11 3 Mark , 12 3 BBC Radio 5 Live Sports Extra , 13 3 Wikipedia , 14 3 Canada , 15 3 Dominican Republic , 16 3 Kg , 17 3 Donkey , 18 3 Charlemagne , 19 3 Coesfeld , 20 3 Bear , 21 3 Caribbean , 22 3 Nineteen Eighty-Four , 23 3 Edip Yuksel , 24 3 Hamster , 25 3 Andy Warhol

nov 2005: 1 6 The Holocaust , 2 5 Eric Staal , 3 5 Freddie Mercury , 4 5 1986 , 5 5 1985 , 6 5 1949 , 7 5 Thanksgiving , 8 5 George W. Bush , 9 4 Doug Bentley , 10 4 Wade Redden , 11 4 Daemon (computer software) , 12 4 Candidiasis , 13 4 Reliant Astrodome , 14 4 Satan , 15 4 1468 , 16 4 Cambridgeshire , 17 4 Full Metal Jacket , 18 4 1915 , 19 4 Xbox 360 , 20 4 1944 , 21 4 Love , 22 4 1964 , 23 4 1942 , 24 4 1940 , 25 4 1990

dez 2005: 1 8 Mark , 2 8 Penis , 3 8 George W. Bush , 4 8 Sex , 5 7 The Holocaust , 6 7 Dog , 7 6 Jew , 8 6 Jimmy Wales , 9 6 Rape , 10 5 Santa Claus , 11 5 Leet , 12 5 Joseph Stalin , 13 5 Zoology , 14 5 Money , 15 4 Star Wars Episode IV: A New Hope , 16 4 Something Awful , 17 4 Shit , 18 4 Bob Barker , 19 4 Fear and Loathing in Las Vegas , 20 4 Quantum mechanics , 21 4 Aristotle , 22 4 Adolf Hitler , 23 4 Health , 24 3 Cancer (constellation) , 25 3 Candidiasis

jan 2006: 1 11 Mark , 2 8 George W. Bush , 3 8 Chile , 4 7 Reliant Astrodome , 5 7 United States , 6 7 Adolf Hitler , 7 6 16-cell , 8 6 Cancer (constellation) , 9 6 Candidiasis , 10 6 The Holocaust , 11 6 Penis , 12 6 Wolfgang Amadeus Mozart , 13 5 Oral candidiasis , 14 5 Holocaust , 15 5 Vagina , 16 5 HTML , 17 5 Cuba , 18 5 Black , 19 4 Carey Price , 20 4 Eric Staal , 21 4 Guy Carbonneau , 22 4 Brown tree snake , 23 4 Canada , 24 4 Great white shark , 25 4 Oak

fev 2006: 1 12 Mark , 2 8 Reliant Astrodome , 3 6 The Holocaust , 4 5 Bukit Timah , 5 5 Very High Bitrate Digital Subscriber Line , 6 5 Canada , 7 5 Holocaust , 8 5 Movie , 9 5 Cat , 10 4 Peter Schaefer , 11 4 Eric Staal , 12 4 Doug Bentley , 13 4 Wade Redden , 14 4 Scott Young (ice hockey b. 1967) , 15 4 Brandon Wheat Kings , 16 4 Islam , 17 4 Jew , 18 4 Kyrgyzstan , 19 4 West Bank , 20 4 Gate , 21 4 Composite number , 22 4 Salmon , 23 4 Ice hockey , 24 4 Steven Spielberg , 25 4 Zazaki

mar 2006: 1 9 Mark , 2 7 Jimmy Wales , 3 6 United States , 4 6 Holocaust , 5 6 Cannabis , 6 6 Adolf Hitler , 7 6 Christianity , 8 6 Defense , 9 6 Germany , 10 6 Copyright , 11 6 Farming , 12 5 Eric Staal , 13 5 Cancer (constellation) , 14 5 Brown tree snake , 15 5 Blog , 16 5 Canada , 17 5 Ash Ketchum , 18 5 Postage stamp , 19 5 Ravioli , 20 5 Kangaroo , 21 5 Vegetarianism , 22 5 Vietnam , 23 5 Big Bang , 24 5 Karl Marx , 25 5 Spain

abr 2006: 1 8 Holocaust , 2 7 Candidiasis , 3 7 Reliant Astrodome , 4 7 Xbox , 5 6 Wade Redden , 6 5 Eric Staal , 7 5 Cancer (constellation) , 8 5 Iraq , 9 5 Abortion , 10 5 Anus , 11 5 Hinduism , 12 5 Christianity , 13 4 Racism , 14 4 Hominoid , 15 4 Hannibal , 16 4 Carthage , 17 4 Trumpet , 18 4 Satanism , 19 4 Zeus , 20 4 Shark , 21 4 1988 , 22 4 Cathedral , 23 4 Communism , 24 4 Plato , 25 4 Dog

mai 2006: 1 14 Mark , 2 11 Cancer (constellation) , 3 9 Worm , 4 8 Brown tree snake , 5 7 Daemon (computer software) , 6 7 The Simpsons , 7 6 Wikipedia , 8 6 Canada , 9 6 Holocaust , 10 6 Baseball , 11 5 Wade Redden , 12 5 Candidiasis , 13 5 United States , 14 5 Wikispecies , 15 5 Deer , 16 5 Sherpa , 17 5 Great white shark , 18 5 Turtle , 19 5 Pokémon (video game series) , 20 5 Role-playing game , 21 5 Feces , 22 5 Pythagoras , 23 5 Tapeworm , 24 5 Adolf Hitler , 25 5 England

jun 2006: 1 13 Eric Staal , 2 7 Wade Redden , 3 7 Sexual intercourse , 4 6 Reliant Astrodome , 5 5 Daemon (computer software) , 6 5 Candidiasis , 7 5 Mark , 8 5 Smallpox , 9 5 Gay , 10 5 Pythagoras , 11 5 Spain , 12 4 Carey Price , 13 4 Northern League (baseball) , 14 4 Flashlight , 15 4 African American Vernacular English , 16 4 Holocaust , 17 4 Doctor Who , 18 4 Saudi Arabia , 19 4 Penis , 20 4 Tony Blair , 21 4 Buddhism , 22 4 Poland , 23 3 Doug Bentley , 24 3 Guy Carbonneau , 25 3 Marty Murray

jul 2006: 1 10 Candidiasis , 2 10 Sex , 3 9 Mark , 4 7 United States , 5 6 Reliant Astrodome , 6 6 Jimmy Wales , 7 5 Scott Young (ice hockey b. 1967) , 8 5 Domestic violence , 9 5 Wikipedia , 10 5 Feces , 11 5 Philippines , 12 4 Wade Redden , 13 4 Quebec Bulldogs , 14 4 Brandon Wheat Kings , 15 4 Crumple zone , 16 4 2006 FIFA World Cup , 17 4 Abdullah Öcalan , 18 4 Mao Zedong , 19 4 Anus , 20 4 Peloponnese , 21 4 Saddam Hussein , 22 4 Google Mail , 23 4 Hiroshima , 24 4 Turkey , 25 4 Music

ago 2006: 1 13 Reliant Astrodome , 2 13 African-American people , 3 12 Wikipedia , 4 12 Jimmy Wales , 5 9 Pornography , 6 9 Nigger , 7 8 Candidiasis , 8 8 Martin Luther King, Jr. , 9 7 Lesbian , 10 7 Taiwan , 11 6 Pescara , 12 6 Dwarf planet , 13 6 Nucleophilic substitution , 14 6 Dick Cheney , 15 6 Homosexuality , 16 6 Planet , 17 5 Daemon (computer software) , 18 5 Cancer (constellation) , 19 5 BBC Radio 1Xtra , 20 5 Democratic Republic of the Congo , 21 5 La Rochelle , 22 5 Wolfgang Amadeus Mozart , 23 5 Adolf Hitler , 24 5 Florida , 25 5 Pluto

set 2006: 1 14 Lesbian , 2 12 Reliant Astrodome , 3 10 Candidiasis , 4 9 Steve Irwin , 5 8 Atheism , 6 8 Spain , 7 7 Mark , 8 7 Hong Kong , 9 7 Terrorism , 10 6 Islam , 11 6 Yemen , 12 6 Pythagoras , 13 6 Philippines , 14 6 England , 15 6 Germany , 16 5 Cancer (constellation) , 17 5 Gamal Abdel Nasser , 18 5 Legacy , 19 5 Ubuntu , 20 5 Anthony Kiedis , 21 5 Unit circle , 22 5 Air gun , 23 5 Iraq , 24 5 Canada , 25 5 Abdullah Öcalan

out 2006: 1 14 Candidiasis , 2 10 Wikipedia , 3 8 Gay , 4 8 Singapore , 5 8 Adolf Hitler , 6 6 Cancer (constellation) , 7 6 Mark , 8 6 RuneScape , 9 6 The Beatles , 10 6 William Shakespeare , 11 6 Cat , 12 6 Judaism , 13 6 Jesus , 14 5 Eric Staal , 15 5 Guy Carbonneau , 16 5 Daemon (computer software) , 17 5 Islam , 18 5 Woodworking , 19 5 Graphite , 20 5 Wii , 21 5 Tropical cyclone , 22 5 Concentration camp , 23 5 Desert , 24 5 Zeus , 25 5 Love

nov 2006: 1 13 Mark , 2 10 Mormonism , 3 9 Bill Gates , 4 9 Adolf Hitler , 5 8 Holocaust , 6 8 France , 7 7 United States , 8 7 Wikipedia , 9 7 Uruguay , 10 7 Fire , 11 7 Jesus , 12 6 Darth Vader , 13 6 Cult , 14 6 California Gold Rush , 15 6 Monkey , 16 6 Botswana , 17 6 Singapore , 18 6 Acid , 19 6 Head , 20 6 Christmas , 21 6 Orange , 22 6 Christianity , 23 6 Europe , 24 5 Candidiasis , 25 5 Iridium (element)

dez 2006: 1 13 Judaism , 2 11 Mark , 3 9 Gerard Way , 4 9 Wiki , 5 9 Jesus , 6 8 Michael Jackson , 7 8 Alcohol , 8 7 Cancer (constellation) , 9 7 Wii , 10 7 Charles Dickens , 11 7 Christianity , 12 7 Apple , 13 6 Candidiasis , 14 6 Brown tree snake , 15 6 List of acronyms and initialisms , 16 6 George Michael , 17 6 Wikipedia , 18 6 Holocaust , 19 6 Concentration camp , 20 6 Saddam Hussein , 21 6 The Holocaust , 22 6 North Korea , 23 6 Christmas , 24 5 Reliant Astrodome , 25 5 United States

jan 2007: 1 13 Cancer (constellation) , 2 11 Carey Price , 3 11 Candidiasis , 4 11 Mark , 5 10 Reliant Astrodome , 6 8 United States , 7 7 Apple Inc. , 8 6 Canada , 9 6 50 Cent , 10 6 Anal sex , 11 6 Sexual intercourse , 12 6 Movie , 13 6 England , 14 6 Association football , 15 6 Germany , 16 6 Judaism , 17 5 Vikings , 18 5 Eric Staal , 19 5 Daemon (computer software) , 20 5 Islam , 21 5 Coprophilia , 22 5 InuYasha , 23 5 Golden Earring , 24 5 Nazism , 25 5 Charles Dickens

fev 2007: 1 13 September 11 attacks , 2 12 United States , 3 11 Reliant Astrodome , 4 10 Candidiasis , 5 9 Mark , 6 8 Eric Staal , 7 8 Cannabis , 8 8 Hillary Rodham Clinton , 9 8 Global warming , 10 8 Spain , 11 7 Daemon (computer software) , 12 7 Cancer (constellation) , 13 7 Vietnam War , 14 7 World War II , 15 7 France , 16 6 Michael Jackson , 17 6 Napoléon Bonaparte , 18 6 George Washington , 19 6 Saddam Hussein , 20 6 Iran , 21 6 Terrorism , 22 6 Rome , 23 6 English language , 24 6 Japan , 25 5 Vikings

mar 2007: 1 13 Cancer (constellation) , 2 12 Mark , 3 10 Candidiasis , 4 9 Emergency medical services in the United Kingdom , 5 8 Global warming , 6 8 American Civil War , 7 8 Spain , 8 8 Google , 9 7 Wade Redden , 10 7 Reliant Astrodome , 11 7 United States , 12 7 Car , 13 6 Eric Staal , 14 6 Cannabis , 15 6 Death penalty , 16 6 Middle Ages , 17 6 Abraham Lincoln , 18 6 The Holocaust , 19 6 Alcohol , 20 6 Buddhism , 21 6 England , 22 6 Quebec , 23 6 Mathematics , 24 6 Government , 25 6 France

abr 2007: 1 12 Mark , 2 8 Cancer (constellation) , 3 7 Eric Staal , 4 7 Candidiasis , 5 7 Reliant Astrodome , 6 7 Canada , 7 7 Amazon Rainforest , 8 7 Engineering , 9 7 World War II , 10 7 God , 11 7 Egypt , 12 6 United States , 13 6 Islam , 14 6 Little Red Riding Hood , 15 6 High School Musical , 16 6 American Civil War , 17 6 Abraham Lincoln , 18 6 Alcohol , 19 5 Daemon (computer software) , 20 5 Bill Gates , 21 5 Dingo , 22 5 Falun Gong , 23 5 Battle of Bannockburn , 24 5 Waffen-SS , 25 5 Andy Warhol

mai 2007: 1 14 Mark , 2 11 Islam , 3 9 Eric Staal , 4 8 Wade Redden , 5 8 Candidiasis , 6 8 Brown tree snake , 7 8 Sexual intercourse , 8 8 William Shakespeare , 9 7 Sufism , 10 7 Manchester United F.C. , 11 7 Cat , 12 6 Cancer (constellation) , 13 6 Dingo , 14 6 Rocky Marciano , 15 6 Canada , 16 6 Monkey , 17 6 Rape , 18 6 Grey wolf , 19 6 Chocolate , 20 6 Cannabis , 21 6 Global warming , 22 6 Texas , 23 6 Penis , 24 6 Communism , 25 6 Car

jun 2007: 1 15 Mark , 2 11 Frieza , 3 11 Zarbon , 4 10 Dodoria , 5 10 My Chemical Romance , 6 9 Bear , 7 9 Penis , 8 8 Candidiasis , 9 8 Vince McMahon , 10 7 RuneScape , 11 7 Justin Timberlake , 12 6 Carey Price , 13 6 Furniture , 14 6 Giant Panda , 15 6 Anal sex , 16 6 Cannabis , 17 6 Sexual intercourse , 18 6 Christianity , 19 6 Mathematics , 20 6 Judaism , 21 5 Eric Staal , 22 5 Wade Redden , 23 5 Avril Lavigne , 24 5 Racism , 25 5 United States

jul 2007: 1 11 Harry Potter , 2 9 Main Page , 3 8 Eric Staal , 4 8 M×0 , 5 8 D.Gray-man , 6 7 Daemon (computer software) , 7 7 Candidiasis , 8 6 I'm with You , 9 6 Harry Potter and the Deathly Hallows , 10 6 Kelly Clarkson , 11 6 Justin Timberlake , 12 6 Evolution , 13 6 Dog , 14 5 Quebec Bulldogs , 15 5 Avril Lavigne , 16 5 MySpace , 17 5 Nicky Hilton , 18 5 James Clark Ross , 19 5 Miss World , 20 5 Donald Trump , 21 5 Yamaha Corporation , 22 5 Mount Takao , 23 5 Bleach (manga) , 24 5 Lily Allen , 25 5 Furniture

ago 2007: 1 9 Sexual intercourse , 2 8 Main Page/Test 1 , 3 8 50 Cent , 4 8 Chopsticks , 5 7 Mark , 6 7 BBC Radio 1Xtra , 7 7 Hanami , 8 7 Jimi Hendrix , 9 7 India , 10 7 Main Page , 11 6 Candidiasis , 12 6 BBC Radio 5 Live Sports Extra , 13 6 Geisha , 14 6 American Staffordshire Terrier , 15 6 Intelligent design , 16 6 Names for large numbers , 17 6 Little Red Riding Hood , 18 6 Ho Chi Minh , 19 6 The Simpsons , 20 6 Pope John Paul II , 21 6 Saturn (planet) , 22 6 Profanity , 23 6 Idiom , 24 5 Eric Staal , 25 5 United States

set 2007: 1 14 Mark , 2 8 Brown tree snake , 3 8 Evolution , 4 7 Candidiasis , 5 7 United States , 6 7 Edgar Atheling , 7 7 Catholicism , 8 7 Encyclopedia , 9 6 Copyright infringement of software , 10 6 Kitzmiller v. Dover Area School District , 11 6 Crusade , 12 6 Christianity , 13 5 Paneuropean Picnic , 14 5 Cuban Missile Crisis , 15 5 Mr. Children , 16 5 Lysergic acid diethylamide , 17 5 Bipolar disorder , 18 5 United States Constitution , 19 5 John Howard , 20 5 Dominican Republic , 21 5 Ancient Egypt , 22 5 Tunisia , 23 5 Global warming , 24 5 The Beatles , 25 5 Vietnam War

out 2007: 1 12 Candidiasis , 2 9 Carey Price , 3 9 Mark , 4 9 United States , 5 8 Justin Timberlake , 6 8 Global warming , 7 8 Germany , 8 8 World War II , 9 7 Very High Bitrate Digital Subscriber Line , 10 7 Wikipedia , 11 7 PlayStation 3 , 12 7 Judaism , 13 6 Northern League (baseball) , 14 6 School , 15 6 Arab people , 16 6 Great Depression , 17 6 Warcraft , 18 6 Edgar Allan Poe , 19 6 Caffeine , 20 6 George Washington , 21 6 Christopher Columbus , 22 6 Dog , 23 6 Cat , 24 6 Spain , 25 6 India

nov 2007: 1 11 Sandy Robson , 2 10 Carey Price , 3 9 Brown tree snake , 4 9 United States , 5 9 Australia , 6 8 Candidiasis , 7 8 Thanksgiving , 8 8 Apple , 9 7 Mark , 10 7 Kevin Rudd , 11 7 Islam , 12 7 Chiara Zanni , 13 7 Cristiano Ronaldo , 14 7 Nuclear power , 15 7 Penis , 16 6 School , 17 6 Chuck Norris , 18 6 Nickel Creek , 19 6 Alan Carr , 20 6 Elizabeth I of England , 21 6 Cloud , 22 6 Galileo Galilei , 23 6 Association football , 24 6 India , 25 6 Google

dez 2007: 1 8 Sari , 2 8 United States , 3 8 Xbox 360 , 4 8 World War II , 5 7 Chuck Norris Facts , 6 7 Warhammer 40,000 , 7 7 Jimi Hendrix , 8 7 Pokémon (video game series) , 9 7 Muhammad , 10 7 Nazism , 11 7 Global warming , 12 6 Eric Staal , 13 6 The Queen Vic , 14 6 RADWIMPS , 15 6 Brett Lee , 16 6 Diplodocus , 17 6 Tourette syndrome , 18 6 United States Declaration of Independence , 19 6 Christmas , 20 6 Foot , 21 5 Candidiasis , 22 5 Chris Thile , 23 5 Benazir Bhutto , 24 5 Carcinogen , 25 5 Ghostzilla

jan 2008: 1 11 William Shakespeare , 2 9 United States , 3 8 Britney Spears , 4 8 Alcohol , 5 8 Jesus , 6 7 Anarchopedia , 7 7 Calvin Harris , 8 7 RuneScape , 9 7 Noob , 10 7 Bono , 11 7 Evolution , 12 7 Italy , 13 6 Eric Staal , 14 6 Mark , 15 6 Romeo + Juliet , 16 6 Moulin Rouge! , 17 6 Group 0 , 18 6 Mean Girls , 19 6 Static RAM , 20 6 Cuban Missile Crisis , 21 6 Robot , 22 6 Lindsay Lohan , 23 6 United States Declaration of Independence , 24 6 Romeo and Juliet , 25 6 Sony

fev 2008: 1 16 United States , 2 14 Mark , 3 14 Jesus , 4 12 Carey Price , 5 11 Islam , 6 9 Moulin Rouge! , 7 9 RuneScape , 8 9 Prostitution , 9 8 Simple English Wikipedia , 10 8 Coffee , 11 8 World War I , 12 7 Eric Staal , 13 7 Carbon footprint , 14 7 Plain White T's , 15 7 Kosovo , 16 7 Pipe organ , 17 7 Volcano , 18 7 Adolf Hitler , 19 7 Buddhism , 20 7 Government , 21 7 Earth , 22 7 Cheese , 23 6 Blog , 24 6 Earth Angel , 25 6 Chris Fehn

mar 2008: 1 13 Carey Price , 2 13 Mark , 3 9 IPod , 4 9 World War I , 5 8 United States , 6 8 Gorilla , 7 7 Women in Ancient Athens , 8 7 Islam , 9 7 Proxy server , 10 7 Noob , 11 7 Canada , 12 7 Germany , 13 7 United Kingdom , 14 7 Tree , 15 6 Wade Redden , 16 6 Hannah Montana , 17 6 Chris Benoit , 18 6 Cecilia Cheung , 19 6 Zac Efron , 20 6 Pier Gerlofs Donia , 21 6 Thirty Years' War , 22 6 World history , 23 6 George Washington Carver , 24 6 DNA , 25 6 Adolf Hitler

abr 2008: 1 13 Mark , 2 12 Carey Price , 3 10 Noob , 4 9 IRCd , 5 9 William Shakespeare , 6 8 Gandhi (band) , 7 8 Jesus , 8 7 Cancer (constellation) , 9 7 United States , 10 7 Baseball , 11 7 Poland , 12 7 Earthquake , 13 7 Association football , 14 7 God , 15 6 Billy Graham , 16 6 Halo 3 , 17 6 Indiana Jones and the Kingdom of the Crystal Skull , 18 6 Seedling , 19 6 Transcendental Meditation , 20 6 History of China , 21 6 Breast , 22 6 Colombia , 23 6 Big Bang , 24 6 English language , 25 6 Computer

mai 2008: 1 16 Carey Price , 2 13 Dog , 3 10 United States , 4 10 Animal Farm , 5 10 World War I , 6 8 Guy Carbonneau , 7 8 Cancer (constellation) , 8 8 Old Major (Animal Farm) , 9 8 Giant Panda , 10 8 Michael Jackson , 11 7 Billy Graham , 12 7 OGame , 13 7 Boxer (Animal Farm) , 14 7 Cuban Missile Crisis , 15 7 World history , 16 7 Pornography , 17 7 George Washington , 18 7 Buddhism , 19 7 The Americas , 20 6 Mark , 21 6 Poplar Forest , 22 6 Benjamin (Animal Farm) , 23 6 MP3 player , 24 6 Wangxiaobo , 25 6 50 Cent

jun 2008: 1 10 William Shakespeare , 2 9 Baseball uniform , 3 8 High School Musical 3: Senior Year , 4 8 Charles Spurgeon , 5 8 United States , 6 8 Islam , 7 8 Cheese , 8 7 Carey Price , 9 7 Ana Ivanović , 10 7 Parental advisory , 11 7 Rubik's Cube , 12 7 England , 13 7 LOL , 14 6 Daemon (computer software) , 15 6 Mark , 16 6 Naas , 17 6 Get Smart , 18 6 She , 19 6 Baleen whale , 20 6 Kudu , 21 6 Polar bear , 22 6 PlayStation 3 , 23 6 RMS Titanic , 24 6 Global warming , 25 6 Gothic architecture

jul 2008: 1 14 Jessica Alba , 2 12 Powderfinger , 3 10 Wade Redden , 4 9 Baseball uniform , 5 8 Daniela Hantuchová , 6 8 American Airlines Flight 11 , 7 8 Scottish Premier League , 8 8 Chess , 9 7 Main Page/Introduction , 10 7 Charles Spurgeon , 11 7 Mass Rapid Transit (Singapore) , 12 7 NASA , 13 7 Gun , 14 6 List of Quebec Nordiques head coaches , 15 6 Mark , 16 6 Wicca rock , 17 6 Andre Agassi , 18 6 WWE The Great American Bash , 19 6 Chris Parks , 20 6 Tom Kaulitz , 21 6 Anna Kournikova , 22 6 Green Day , 23 6 Global warming , 24 6 Romania , 25 5 Daemon (computer software)

ago 2008: 1 11 Powderfinger , 2 11 2008 Summer Olympics , 3 10 Evolution , 4 10 Charles Darwin , 5 9 Sarah Palin , 6 8 Homeopathy , 7 8 Simple English Wikipedia , 8 8 Neopets , 9 8 Human , 10 8 Jesus , 11 7 Gumby , 12 7 Charlotte's Web (1973 movie) , 13 7 2008 South Ossetia war , 14 7 Main Page/Introduction , 15 7 Mass Rapid Transit (Singapore) , 16 7 RAID , 17 7 Gene , 18 7 Jupiter , 19 7 Main Page , 20 6 Flat Earth , 21 6 Sniper , 22 6 Charlotte's Web 2: Wilbur's Great Adventure , 23 6 Michael Phelps , 24 6 Madden NFL 09 , 25 6 Littlest Pet Shop (video game)

set 2008: 1 11 Sarah Palin , 2 9 Dipsy , 3 9 Main Page , 4 8 Oklahoma , 5 8 Green Day , 6 7 Whitey Wistert , 7 7 Laa-Laa , 8 7 Po (Teletubby) , 9 7 Paul Newman , 10 7 RAID , 11 7 Big Bang , 12 7 Dog , 13 6 Halo 3 , 14 6 Cell , 15 6 Brother Bear 2 , 16 6 Iranian coup d'etat (1953) , 17 6 CERN , 18 6 Sniper , 19 6 Baseball uniform , 20 6 Baptist , 21 6 Middle-earth characters , 22 6 Nuclear power , 23 6 David Beckham , 24 6 Liancourt Rocks , 25 6 Renaissance

out 2008: 1 10 Sligo Rovers F.C. , 2 9 Halo 3 , 3 9 Sniper , 4 9 Main Page , 5 8 Jonas Brothers , 6 8 Jimi Hendrix , 7 8 Pornography , 8 7 Mark , 9 7 Bambi , 10 7 Earthquake-proof , 11 7 Paris , 12 6 Wade Redden , 13 6 Cancer (constellation) , 14 6 Derrick Pierce , 15 6 Mathew Turner , 16 6 Victory , 17 6 Jörg Haider , 18 6 United States , 19 6 RuneScape , 20 6 Britney Spears , 21 6 Communism , 22 6 Terrorism , 23 6 Google , 24 6 God , 25 5 Dalek

nov 2008: 1 20 Barack Obama , 2 13 Mark , 3 12 Bop It , 4 10 Hot chocolate , 5 8 Manchester , 6 8 Penis , 7 7 Cancer (constellation) , 8 7 November 2008 Mumbai attacks , 9 7 Phetchabun , 10 7 United States , 11 7 Giant Panda , 12 7 Nudity , 13 7 France , 14 6 Trang , 15 6 Crich Tramway Village , 16 6 Halo 3 , 17 6 United States presidential election, 2008 , 18 6 Miley Cyrus , 19 6 McDonald's , 20 6 Global warming , 21 6 Cattle , 22 6 Main Page , 23 6 Google , 24 6 God , 25 5 High School Musical 3: Senior Year

dez 2008: 1 10 Penis , 2 9 Santa Claus , 3 8 Headset , 4 8 Barack Obama , 5 8 George W. Bush , 6 7 Thermocouple , 7 7 Supercomputer , 8 7 MRI , 9 7 Blackpool tramway , 10 7 Joseph Stalin , 11 6 Mark , 12 6 Static electricity , 13 6 Standard-definition television , 14 6 Hydrogen car , 15 6 South Thailand Insurgency , 16 6 Airbag , 17 6 United States , 18 6 Adolf Hitler , 19 6 Main Page , 20 5 Cancer (constellation) , 21 5 Virgin Killer , 22 5 Dsp , 23 5 Lenz's law , 24 5 Electronic cigarette , 25 5 Sanam Luang

jan 2009: 1 13 Barack Obama , 2 9 Daniela Hantuchová , 3 9 United States , 4 8 Nudity , 5 8 Joseph Stalin , 6 8 Adolf Hitler , 7 8 George W. Bush , 8 8 Romania , 9 8 World War II , 10 7 Encyclopedia Dramatica , 11 7 Sexual intercourse , 12 7 Feces , 13 7 Japan , 14 6 Mydoom , 15 6 Phosgene , 16 6 Avril Lavigne , 17 6 Aer language , 18 6 Curitiba , 19 6 Liancourt Rocks , 20 6 Wikipedia , 21 6 Ejaculation , 22 6 Table tennis , 23 6 Fat , 24 6 Jimmy Wales , 25 6 Harry Potter

fev 2009: 1 20 Barack Obama , 2 15 Wikipedia , 3 14 Sexual intercourse , 4 14 List of colors , 5 12 Sniper , 6 12 Car , 7 10 Grand Olympic Auditorium , 8 10 Large Hadron Collider , 9 9 Swahili Wikipedia , 10 9 Penis , 11 9 George W. Bush , 12 9 Dog , 13 9 Mathematics , 14 9 Internet , 15 8 Baseball uniform , 16 8 Anna Kournikova , 17 8 New York City , 18 8 Jesus , 19 7 Bop It , 20 7 Simple English Wikipedia , 21 7 Jew , 22 7 Red Hot Chili Peppers , 23 7 Evolution , 24 7 Meaning of life , 25 7 Christianity

mar 2009: 1 18 Barack Obama , 2 17 Jimmy Wales , 3 15 Guy Carbonneau , 4 12 Wikipedia , 5 11 Hermann Göring , 6 11 Cheese , 7 9 Bop It , 8 9 Large Hadron Collider , 9 9 United States , 10 9 Message (computer science) , 11 9 Computer , 12 8 Walt Poddubny , 13 8 Color of the day (police) , 14 8 Snow White and the Seven Dwarfs (1937 movie) , 15 8 Crich Tramway Village , 16 8 Ben Hall , 17 8 Pope John Paul II , 18 8 Cat , 19 8 Internet , 20 7 Autofellatio , 21 7 Down syndrome , 22 7 Sexual intercourse , 23 7 Global warming , 24 7 Adolf Hitler , 25 7 George W. Bush

abr 2009: 1 14 Color blindness , 2 13 George W. Bush , 3 12 Mosque , 4 11 Barack Obama , 5 9 Swine influenza , 6 9 Ernst Röhm , 7 9 Wikipedia , 8 9 Cat , 9 9 World War I , 10 8 Battle of Gettysburg , 11 8 Asshole , 12 8 United States , 13 8 Cuban Missile Crisis , 14 8 Refrigerator , 15 8 Pope John Paul II , 16 7 Hannah Montana , 17 7 Dave Thomas , 18 7 AIDS , 19 7 Epilepsy , 20 7 World War II , 21 6 Politika , 22 6 Islam , 23 6 Miley Cyrus , 24 6 Bobby Robson , 25 6 Sun

mai 2009: 1 12 Eric Staal , 2 12 Cheese , 3 11 Darius Danesh , 4 10 Teletubbies , 5 9 Hurricane Ismael , 6 9 Mormonism , 7 9 Leonardo da Vinci , 8 9 Adolf Hitler , 9 9 Internet , 10 8 Swine influenza , 11 8 Jonas Brothers , 12 8 Down syndrome , 13 8 Star , 14 8 Cat , 15 7 Huang XianFan , 16 7 Simple English Wikipedia , 17 7 LOL , 18 7 World War I , 19 7 Jesus , 20 7 Google , 21 7 France , 22 6 Madagascar (disambiguation) , 23 6 Label (philately) , 24 6 Tropical Storm Barry (2007) , 25 6 Liquid crystal display

jun 2009: 1 26 Michael Jackson , 2 10 Earth , 3 7 London Underground 1967 Stock , 4 7 Jessica Alba , 5 6 Foot binding , 6 6 Bubble tea , 7 6 Simple English Wikipedia , 8 6 United States , 9 6 Wikipedia , 10 6 Sexual intercourse , 11 6 Ludwig van Beethoven , 12 6 Dog , 13 6 Cheese , 14 5 Wood Street railway station , 15 5 The Wave 96.4 FM , 16 5 PGA Tour , 17 5 Johnny & Associates , 18 5 Sexual fetishism , 19 5 The Man from Earth , 20 5 Nap (textile) , 21 5 Victoria line , 22 5 Ghana , 23 5 Philippines , 24 5 Medicine , 25 5 Newcastle United F.C.

jul 2009: 1 13 Italy , 2 12 Michael Jackson , 3 10 Jupiter , 4 8 Wernher von Braun , 5 8 Earth , 6 7 Victoria line , 7 7 Chat , 8 6 United States , 9 6 Bobby Robson , 10 6 Wikipedia , 11 6 Jimmy Wales , 12 6 Pirates of the Caribbean: The Curse of the Black Pearl , 13 6 Woodrow Wilson , 14 6 Death penalty , 15 6 Adolf Hitler , 16 6 Sex , 17 6 Noun , 18 6 Basic English , 19 5 Sidereal day , 20 5 Adobe Acrobat , 21 5 Buffalo , 22 5 Hinglaj Mata , 23 5 University of Balochistan , 24 5 Kremlin , 25 5 Paris Hilton

ago 2009: 1 20 List of 20th Century Fox movies , 2 14 India , 3 12 Earth , 4 9 MissingNo. , 5 9 Abraham Lincoln , 6 8 2009 Atlantic hurricane season , 7 8 Wikipedia , 8 7 Essjay controversy , 9 7 Joe Biden , 10 7 20th Century Fox , 11 7 Philippines , 12 7 God , 13 6 Jesse Helms , 14 6 Victoria line , 15 6 1492 Pictures , 16 6 Ted Kennedy , 17 6 Cannabis , 18 6 Michael Jackson , 19 5 Gloria Stuart , 20 5 St John's Church (Halesowen) , 21 5 Tropical Storm Claudette (2009) , 22 5 Yury Luzhkov , 23 5 Tanggula Railway Station , 24 5 Swine influenza , 25 5 Steve Hart

set 2009: 1 14 Michael Jackson , 2 10 Barack Obama , 3 10 Jupiter , 4 8 Leonese language , 5 8 Joe Biden , 6 8 Evolution , 7 7 Siege of Fort Zeelandia , 8 7 Atheism , 9 7 Adolf Hitler , 10 7 CNN , 11 7 France , 12 6 Napoleon II of France , 13 6 Lipizzaner , 14 6 London Underground 2009 Stock , 15 6 Linkin Park , 16 5 Vikings , 17 5 Crater (constellation) , 18 5 Race (sociology) , 19 5 Napoleon III , 20 5 Evangelical Christian Church in Canada , 21 5 Patrick Swayze , 22 5 Queen Elizabeth School , 23 5 The Mars Volta , 24 5 Arjen Robben , 25 5 Mimicry

out 2009: 1 10 Wikipedia , 2 9 Bukit Timah , 3 8 Justin Bieber , 4 8 Moon hoax , 5 8 Barack Obama , 6 7 Manchester , 7 7 Hyderabad, India , 8 7 Michael Jackson , 9 7 Kurt Cobain , 10 7 Martin Luther King, Jr. , 11 7 World War I , 12 6 United States , 13 6 Illegal drugs , 14 6 Horse , 15 6 Sexual intercourse , 16 6 Harry Potter , 17 5 Billy Graham , 18 5 List of area codes in Canada , 19 5 Snake Worship , 20 5 British National Party , 21 5 Lionel Messi , 22 5 Blackpool tramway , 23 5 Charlotte's Web 2: Wilbur's Great Adventure , 24 5 The Fox and the Hound (film) , 25 5 Macedonia

Speakers: Number of speakers of a language is the estimated total of primary and secondary speakers, is in many cases a very rough estimation (based on the page on the English Wikipedia about that language)
Regions are parts of the world where the language is spoken in substantial amounts (compared to total number of speakers). Regions where a language gained presence only by a recent diaspora are generally not included.
Region codes: AF:Africa, AS:Asia, EU:Europe, NA:North America, OC:Oceania, SA:South America, W:World Wide, CL:Constructed Language

Estatísticas geradas em Terça-feira, 24 de novembro 2009 a partir de cópias do banco de dados SQL de Sábado, 31 de outubro 2009
Versão do script:2.5
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
For documentation see meta
Scripts: scripts.zip

All data and images on this page are in the public domain.