Estatísticas da Wikipédia inglês simplificado

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Articles per size range / Records per namespace / Most edited articles / Zeitgeist

Metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.
See also metrics definitions


 
Monthly counts & Quarterly rankings: março 2013
 
DataWikipedistasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
mar 2013+1% -7% +1% +6%    +192%      +1%
fev 2013+1% -24% +1% -46%    -11%      +1%
jan 2013+2% -1%0%+2% +84%    +8%      +1%
dez 2012+2% +23%+9%+1% +24%    +22%      +1%
nov 2012+1% +17% +1% -17%    -12%      +1%
out 2012+1% +8% +1% -3%    +10%      +1%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P____Q____R____S__
mar 20134088351412392 k 3331,5   123 k      37 k
fev 20134053401511990 k 3130,5   42 k      37 k
jan 20134013681982490 k 5730,3   47 k      36 k
dez 20123945682002488 k 3130,4   44 k      36 k
nov 20123877351622287 k 2530,2   36 k      36 k
out 20123842261391686 k 3030,1   41 k      35 k
set 20123816391292085 k 3129,9   37 k      35 k
ago 20123777321302084 k 3229,8   40 k      34 k
jul 20123745411422283 k 3829,7   42 k      34 k
jun 20123704641791882 k 3029,6   53 k      34 k
mai 20123640401541981 k 3829,3   55 k      33 k
abr 20123600381492280 k 4429   63 k      32 k
mar 20123562451602579 k 3928,7   54 k      32 k
fev 20123517351552178 k 3228,5   47 k      31 k
jan 20123482441821977 k 2328,2   40 k      31 k
dez 20113438401481876 k 2728   36 k      31 k
nov 20113398391502175 k 2827,8   38 k      30 k
out 20113359241361974 k 1827,6   36 k      30 k
set 20113335341251574 k 1827,3   47 k      30 k
ago 20113301341491973 k 1526,9   40 k      29 k
jul 20113267441471573 k 2026,5   34 k      29 k
jun 20113223401681972 k 2826,3   34 k      29 k
mai 20113183471602071 k 2926,1   34 k      28 k
abr 20113136431482570 k 2825,9   43 k      28 k
mar 20113093461642669 k 3025,6   36 k      28 k
fev 20113047311502068 k 3025,4   30 k      27 k
jan 20113016361632268 k 2525,3   35 k      27 k
dez 20102980561831567 k 2425,1   30 k      27 k
nov 20102924411451666 k 2224,9   31 k      26 k
out 20102883431571865 k 2224,7   28 k      26 k
set 20102840331191665 k 1824,5   30 k      25 k
ago 20102807381321964 k 3724,3   41 k      25 k
jul 20102769401311763 k 1524,1   29 k      25 k
jun 20102729381461863 k 3323,8   36 k      24 k
mai 20102691341472162 k50 k3523,61545621940 k147 Mb14,6 M994 k1,4 M28 k80 k24 k
abr 20102657491831861 k49 k3423,31526611940 k143 Mb14,1 M972 k1,3 M28 k77 k23 k
mar 20102608471893360 k48 k2123,11511611839 k139 Mb13,7 M951 k1,3 M27 k75 k23 k
fev 20102561481482659 k48 k1722,71495601833 k137 Mb13,4 M938 k1,3 M26 k72 k23 k
jan 20102513501842658 k47 k2922,31484601835 k135 Mb13,2 M928 k1,3 M26 k71 k22 k
dez 20092463391492158 k46 k22221465601831 k131 Mb12,8 M903 k1,3 M25 k69 k22 k
nov 20092424441532357 k46 k3121,81452601830 k129 Mb12,5 M908 k1,2 M24 k68 k22 k
out 20092380441691956 k45 k3221,61444591729 k126 Mb12,3 M892 k1,2 M24 k67 k21 k
set 20092336391482055 k44 k2921,41437591729 k123 Mb12,0 M875 k1,2 M23 k66 k20 k
ago 20092297521551754 k43 k3021,21426591731 k120 Mb11,7 M855 k1,2 M23 k64 k19 k
jul 20092245391611453 k42 k22211414581735 k117 Mb11,4 M837 k1,1 M22 k63 k19 k
jun 20092206551881652 k41 k1820,61406571727 k115 Mb11,2 M824 k1,1 M22 k62 k18 k
mai 20092151491922152 k40 k2820,31392571736 k112 Mb11,0 M814 k1,1 M22 k61 k18 k
abr 20092102491892151 k39 k38201382561631 k110 Mb10,7 M794 k1,1 M22 k60 k18 k
mar 20092053661902750 k38 k3619,81377561638 k107 Mb10,4 M773 k1,1 M21 k58 k17 k
fev 20091987682082449 k37 k3519,51367561634 k103 Mb10,1 M753 k1,0 M20 k56 k17 k
jan 20091919642052448 k36 k24719,21354551647 k100 Mb9,8 M733 k1,0 M20 k54 k16 k
dez 20081855641901840 k35 k9421,71523621842 k93 Mb9,3 M676 k916 k19 k52 k16 k
nov 20081791471762337 k34 k4322,21579651934 k90 Mb8,9 M645 k886 k18 k51 k16 k
out 20081744461892536 k33 k4622,11575651932 k86 Mb8,6 M624 k862 k17 k48 k15 k
set 20081698481522434 k31 k4722,11572641930 k83 Mb8,2 M596 k830 k17 k46 k14 k
ago 20081650481622333 k30 k4522,11574651931 k79 Mb7,9 M573 k804 k16 k44 k14 k
jul 20081602591682732 k29 k7022,11580651937 k76 Mb7,6 M551 k777 k16 k42 k13 k
jun 20081543501622529 k27 k4322,51593671934 k71 Mb7,1 M517 k735 k15 k38 k13 k
mai 20081493441462428 k26 k3422,31565661932 k67 Mb6,7 M487 k706 k14 k36 k12 k
abr 20081449451301827 k25 k31221566661927 k64 Mb6,5 M469 k679 k13 k34 k11 k
mar 20081404431422126 k24 k2721,81562661926 k62 Mb6,2 M450 k658 k13 k33 k11 k
fev 20081361541501925 k23 k4121,51537661830 k59 Mb5,9 M433 k640 k12 k30 k10 k
jan 20081307401242024 k22 k3421,31523651832 k56 Mb5,6 M408 k618 k11 k28 k9,8 k
dez 20071267461311823 k21 k6220,91492631832 k52 Mb5,2 M380 k589 k11 k26 k9,3 k
nov 20071221381101721 k19 k2721,31441611726 k47 Mb4,7 M335 k554 k10 k22 k8,9 k
out 20071183391131620 k18 k2020,91431611725 k45 Mb4,5 M320 k530 k9,5 k21 k8,5 k
set 20071144331091520 k17 k2220,21402601722 k43 Mb4,3 M305 k509 k9,2 k19 k8,2 k
ago 20071111411301719 k17 k3819,81386591622 k41 Mb4,1 M293 k492 k8,8 k18 k7,9 k
jul 20071070401261718 k16 k3119,81350581617 k37 Mb3,7 M269 k460 k8,1 k15 k7,2 k
jun 20071030501341517 k15 k2019,91351581619 k35 Mb3,5 M256 k441 k7,6 k13 k6,9 k
mai 2007980461361416 k14 k1919,51329571627 k33 Mb3,4 M243 k423 k7,2 k12 k6,6 k
abr 2007934421011516 k13 k2218,51305561520 k32 Mb3,2 M232 k402 k6,8 k11 k6,3 k
mar 2007892361171315 k13 k19181280551523 k30 Mb3,0 M218 k384 k6,4 k9,6 k6,0 k
fev 2007856361291215 k12 k2217,21238541417 k28 Mb2,8 M200 k365 k5,8 k8,3 k5,7 k
jan 2007820521441114 k12 k2616,71194531420 k26 Mb2,6 M186 k346 k5,2 k7,4 k5,4 k
dez 2006768511351313 k11 k2516,21162511320 k24 Mb2,4 M170 k324 k4,7 k6,0 k5,2 k
nov 2006717551201512 k10,0 k2215,61141501320 k22 Mb2,2 M155 k300 k4,2 k4,9 k4,9 k
out 2006662451121312 k9,3 k2014,71150491315 k20 Mb2,1 M144 k273 k3,9 k4,6 k4,6 k
set 200661735871411 k8,8 k1514,21141491311 k19 Mb1,9 M135 k245 k3,4 k4,2 k4,2 k
ago 2006582421171211 k8,4 k1913,71126481313 k18 Mb1,8 M127 k236 k3,1 k3,8 k3,9 k
jul 20065403285610 k7,9 k2113,21115481311 k17 Mb1,7 M119 k209 k2,8 k3,3 k3,5 k
jun 2006508226379,4 k7,4 k1812,91120471311 k16 Mb1,6 M111 k194 k2,5 k3,1 k3,1 k
mai 2006486529378,8 k6,9 k1712,41117471312 k15 Mb1,5 M104 k183 k2,2 k3,0 k2,8 k
abr 2006434306588,3 k6,5 k1611,81120461310 k14 Mb1,4 M96 k169 k2,0 k2,7 k2,5 k
mar 2006404306877,8 k6,1 k1211,2111546139,7 k13 Mb1,3 M90 k157 k1,8 k2,3 k2,2 k
fev 2006374214967,5 k5,7 k2010,5111345138,5 k12 Mb1,3 M85 k136 k1,6 k2,1 k2,0 k
jan 2006353276186,9 k5,2 k2910,11136451311 k11 Mb1,2 M79 k127 k1,4 k1,8 k1,7 k
dez 2005326346666,0 k4,5 k159,9117444136,8 k9,7 Mb1,0 M69 k106 k1,1 k1,5 k1,3 k
nov 2005292234455,6 k4,1 k109,5117744145,6 k9,0 Mb966 k63 k100 k1,0 k1,3 k1,2 k
out 2005269224245,3 k3,8 k108,9119344143,8 k8,6 Mb924 k61 k93 k9301,3 k1,1 k
set 2005247142835,0 k3,6 k48,7116544143,6 k8,0 Mb853 k57 k89 k8101,3 k1,0 k
ago 2005233144164,8 k3,5 k128,2115143134,2 k7,5 Mb824 k55 k76 k7611,2 k999
jul 2005219234444,4 k3,1 k108114042134,8 k6,8 Mb739 k50 k70 k5261,0 k910
jun 2005196163454,1 k2,8 k147,4109642134,2 k5,8 Mb661 k46 k42 k453916838
mai 2005180142933,7 k2,5 k167,199640112,8 k4,7 Mb552 k41 k32 k392909756
abr 2005166102423,2 k2,3 k77,3104142101,8 k4,2 Mb502 k38 k28 k343817674
mar 2005156123513,0 k2,2 k77,2103142101,5 k4,0 Mb471 k36 k26 k300760651
fev 200514462032,8 k2,0 k87,2104443102,1 k3,7 Mb438 k34 k25 k251712600
jan 2005138112322,6 k1,9 k107,1108344101,4 k3,5 Mb413 k33 k21 k225693551
dez 200412791922,3 k1,7 k47,4111846111,5 k3,2 Mb382 k30 k20 k203681508
nov 2004118122212,1 k1,6 k47,2111545111,3 k3,0 Mb359 k28 k20 k186598460
out 2004106614 2,0 k1,5 k37108644111,1 k2,8 Mb328 k26 k18 k170566415
set 200410082031,9 k1,4 k76,8104443101,2 k2,6 Mb301 k25 k17 k148492401
ago 20049241631,7 k1,3 k46,9109846111,3 k2,4 Mb287 k23 k15 k134475357
jul 200488102011,6 k1,2 k36,6113747119882,3 Mb274 k22 k14 k118435344
jun 200478112521,5 k1,1 k56,4109745112,4 k2,1 Mb249 k20 k13 k106427330
mai 20046782021,3 k1,0 k95,2102845101,5 k1,8 Mb213 k17 k10 k95283307
abr 200459142521,1 k79465,29094791,3 k1,2 Mb151 k13 k7,1 k76223285
mar 2004451316186464954,9914489964926 kb122 k10 k4,9 k30162254
fev 200432715 71555734,5953519589766 kb105 k8,9 k2,9 k16232231
jan 200425511 62549024,2974519463651 kb94 k8,1 k1,2 k7213225
dez 200320412157345233,89625210699582 kb85 k7,5 k6813199197
nov 20031646 4873774310295511407498 kb76 k6,8 k196315280
out 20031256 3562725310915811521381 kb58 k5,0 k14839164
set 2003715 18813222,9924527136163 kb24 k1,9 k10135218
ago 2003612 1358213,17984069997 kb14 k1,2 k8622714
jul 2003512 914813,56873256655 kb7,4 k712611126
jun 2003411 6135 4,17783873242 kb5,5 k528611123
mai 2003311 5632 3,98203975440 kb5,3 k512611112
abr 20032   5230 3,28574281538 kb5,1 k46850192
mar 2003211 482713,17844264233 kb4,3 k39637162
fev 20031   2211 512174592218 kb2,3 k1295162
jan 20031   1911 4,61197535416 kb2,1 k1061 62
dez 20021   1710 4,992453 812 kb1,4 k1021 62
nov 20021   158 596747 310 kb1,2 k671 62
out 20021   148 5,196850 810 kb1,2 k671 62
set 20021   127 5,391242 128,8 kb984371162
ago 20021   117 4,790645 78,7 kb97651 162
jul 20021   106 4,575440 16,8 kb71640 162
jun 20021   106 4,475340 46,8 kb71540  62
mai 20021   96 4,475344 66,8 kb71540  62
abr 20021   86 4,275350 46,8 kb71540  62
mar 20021   86 3,873450 26,6 kb69740  62
fev 20021 1 86 3,573450 76,6 kb69740  62
jan 20021   75 362443  5,2 kb50335  42
dez 20011   75 362443  5,2 kb50335  42
nov 20011   75 362443 35,2 kb50335  42
out 20011   75 2,662443 125,2 kb50335  42
set 20011   32 260733 11,2 kb19820  1 
ago 20011   21 2,592450 1971 14711  1 
jul 20011   21 292450  970 14711  1 
jun 20011   21 292450 3970 14711  1 
mai 200111  11 1924100 1970 14711  1 
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
The following table ranks this project in relation to projects in other languages with 1000+ articles
jan 20133128323546 3358   38      271
out 20123236334345 4560   42      271
jul 20123232343745 3963   41      271
abr 20123233343645 3167   27      271
jan 20123235354245 5466   38      271
out 20113139364245 5567   40      271
jul 20113232334443 5971   39      271
abr 20113131343243 4972   38      271
jan 20113136363942 5267   43      271
out 20103130323740 4967   39      271
jul 20103032353840 5365   37      271
abr 2010293130393936436573795740383234283531271
jan 2010283134343939436678856235413637293834271
out 2009283233373841386781857536423940324236271
jul 2009273234413841506578837135413938324236271
abr 2009273231353841406576857139413938324034271
jan 2009272629363842106774856629423938314034270
out 2008273028354443283454594936434039334135268
jul 2008272530334442242849554732434039344134267
abr 2008272835394543381747504135454139364435267
jan 2008273236374543371649504534454140364338263
out 2007253337384744501252594740484440364642262
jul 2007252934384744421154574440484441394742257
abr 2007243037394443531355604738464242394643253
jan 2007232430424544461557614837484343374846250
out 2006232332384644501759605139484444384951246
jul 2006232635484545471862614741474444384850234
abr 2006232834404344472157554436454344384848229
jan 2006232635424244362450514135454243424850211
out 2005222534444142552843473743454041415053209
jul 2005211925403837423137413038433838415046198
abr 2005212934473939462638364041434035455047191
jan 2005192226384039372125263142423431394840187
out 2004192629553834441620182038353028344335185
jul 2004181721423532431412161736332926303934156
abr 2004181217303534301517121731393024293637139
jan 2004181517353330372827272735362722373630124
out 200320101821282519212020201827242135253298
jul 200323242319313025151414142838322830273786
abr 200326272714272525131212122828282622182469
jan 20033021191124211899992725212327162257
out 200222161492016118888192018191781641
jul 200217910716159888814161415731532
abr 200216810616148777712161314431218
jan 200216811314139333316141313221016
out 2001139102111082222101110921713
jul 20017442764222267762158
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
 WikipedistasArtigosBase de dadosLigações

Nota: os valores para os primeiros meses estão muito baixos. O histórico de revisões nem sempre era preservado nos primeiros tempos.

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikipedistas (usuários registrados)
A = Wikipedistas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikipedistas que editaram pelo menos dez vezes desde que chegaram
C = Wikipedistas que contribuíram cinco vezes ou mais este mês
D = Wikipedistas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Artigos que contêm pelo menos uma ligação interna e 200 caracteres de texto legível, não contando códigos wiki e html,
      ligações ocultas, etc.; títulos também não contam (outras colunas são baseadas no método oficial de contagem)
G = Novos artigos por dia no mês passado
H = Número médio de revisões por artigo
I = Tamanho médio dos artigos em bytes
J = Porcentagem de artigos com pelo menos 0,5 kb de texto legível (veja F)
K = Porcentagem de artigos com pelo menos 2 kb de texto legível (veja F)

Base de dados
L = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
M = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
N = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
O = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
P = Total de ligações para outras wikipédias
Q = Total de imagens apresentadas
R = Total de ligações para outros sítios
S = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  2500  10000  5  10  100  1000  10000  1  3  5  10  25  100  250  1000  5  10  100  1000  1  3  5  10  25  100  250  1000  2500  5  10  100  1000  10000 
mar 20136042061418554231531 22218211537355412482 32  25797664125931 1110611
fev 20136352251517440191141 2927195 1435643321993 21  23379523218631 191892 
jan 20137012701981215524144  3935236 16773493521102 22  30712076351872  2321123 
dez 201267326320011750241261 3938247 1818258382192 22  337127783820531 2827122 
nov 2012618230162804322141  4240194 17966473821103 21  34513976432252  3126111 
out 2012607201139914816132  4539186 1736252382482 21  3049557401861  292681 
set 2012566204129774720132  4843194 13562403022114 21  25076513318841 262392 
ago 2012587200130743920941 4545204 1416548322361 11  258915834186311282382 
jul 2012572213142894722114  4844216 1566348351873 21  2908647311422113026122 
jun 20126462601791055418114115148206 18381543722104 11  353132804520751 3328112 
mai 2012611224154875219124215344228 1536748372575 11  31910873391951  3633163 
abr 20126442291498445221694 4844224 1777859362485 11  338143954318721 2824112 
mar 20126212291609652251793 4441245 1667960392494 11  320110754322741 282481 
fev 20126672461558550211352 4541253 1727960412083 11  33610572422653  282281 
jan 20127462671821045219123  4945234 2138363412494 11  41713687512085  2924111 
dez 2011594237148974818102  4842215 1646854372572 21  344996744251221 2724134 
nov 2011628229150925021113  4846295 1629064432282 21  32811776472484  3027132 
out 2011574199136875419103  4743285 1557963432582 31  340118764728631 3429164 
set 2011548184125824215922 4239276 1607651351982 31  346121824322611 3025101 
ago 2011621219149824719921 5046325 1507859432551 32  37813296582774  3026123 
jul 20116012181479144151021 4738257 141705239254  21  34612079512651  26217  
jun 20116892591688549196   4844248 1657559402741 21  3901328656261   2924141 
mai 20116862221609651209   4237206 1687858443061 21  37813486562961  221711  
abr 2011658221148805225112  4341196 1707459452764 21  40413596563273  2721101 
mar 201175023716498582691  4644233 1778160483083 21  45615794522952  302181 
fev 20116562211508849209   4843203 17178534025112 11  4161469862286   292391 
jan 201170125616399552271  5547224 2179572493182 32  475152106632821  2924122 
jan 20137012701981215524144  3935236 16773493521102 22  30712076351872  2321123 
out 2012607201139914816132  4539186 1736252382482 21  3049557401861  292681 
jul 2012572213142894722114  4844216 1566348351873 21  2908647311422113026122 
abr 20126442291498445221694 4844224 1777859362485 11  338143954318721 2824112 
jan 20127462671821045219123  4945234 2138363412494 11  41713687512085  2924111 
out 2011574199136875419103  4743285 1557963432582 31  340118764728631 3429164 
jul 20116012181479144151021 4738257 141705239254  21  34612079512651  26217  
abr 2011658221148805225112  4341196 1707459452764 21  40413596563273  2721101 
jan 201170125616399552271  5547224 2179572493182 32  475152106632821  2924122 
out 20106702261579852186   4843176 15571554130113 221 38112995613851  4133101 
jul 20106512181318447175   5748225 17486624635146 321 421155966337134  302372 
abr 20108112681831085518132  4945244 20683624833157 11  4701751116038101  232283 
jan 201081227918410770261411 4641244 20196755338135 11  5191801317547142  272361 
out 20097382481698953198   4948275 21589624127133 11  504175116673594  262481 
jul 200967123616187461482  5251335 16280563926105 31  4771701046937135  24208  
abr 200982229418910952218   4843275 205103715027121 11  5041791198138132  272391 
jan 200980229520511559241021 5044348 18883634833124 541 5151891216537205  3328102 
out 200874627418911066257   4841254 20697715233111 111 5541791237437143  191583 
jul 20086372401681106127142  4341246 18383664626103     5992081277547168  221682 
abr 200856520213084501871  3025193 16371543829113 11  4691731166238103  141351 
jan 20085762021247145201031 2519125 156815739251371    4881671026930146  13831 
out 200751418111370321681  1919104 98523421154      451149874823831 12115  
jul 20074881751267340178   2220132 1105947301441     44914294522062  11102  
abr 200752516410164341551  2320103 97462618115  21  4631488247236   9632 
jan 200755422314476431161  101062 1164230231021     43215495612052  5411 
out 20065031601126431133   11931 109442919135  111 4131408347213   31   
jul 200638913485503062   8731 89302315721     354118663212    22   
abr 200641912165361482   6321 7026171092      2891105732122        
jan 200630790613317851  543  541813841      25491452482   2    
out 2005222664221942   331  401611821      18646251561        
jul 20051916144231042   885  36161282       162623516311  32   
abr 2005173432413621   11   18933        113331443         
jan 200510931231252         22131194   1   65191362         
out 200488271484    211  12211        4114843         
jul 20048329201151    111  1644     1   431563     11   
abr 200483292515102    211  268542       55171261         
jan 200439181151         104311       3113731         
out 20032511652         74443       75421         
jul 200310221          1           3             
abr 20039                                      
jan 20033                        1             
out 200241                                     
jul 20021                        1             
abr 20023                        1             
jan 2002                                       
out 20013                        1             
jul 2001                                       

 

Distribuição de edições de artigos por wikipedistas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikipedistasEdições total
131,966100.0%1,084,834100.0%
39,41029.4%1,051,31496.9%
104,22113.2%1,021,97594.2%
321,5624.9%977,94990.1%
1006782.1%929,65785.7%
3163030.9%865,86779.8%
10001450.5%777,13971.6%
3162630.2%625,70757.7%
10000150.0%372,50834.3%
3162340.0%184,98117.1%

 

50 wikipedistas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdições 
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
 agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
CreolUC1+151,35767412,836127out 19, 2006235434335--
DjsassoUC2-150,957911,970111dez 10, 20043032322---
Auntof6UC3 045,8155,81320,6741,792ago 18, 200816855721--
OsirisUC4 036,85290320,771619set 28, 2009127920318--
EptalonUC5 028,28729811,85542dez 20, 200526573,04531--
Macdonald-rossUC6 026,3895655,351105set 04, 200913031,48426--
PeterdownunderUC9 015,7011627,942119mai 25, 200817706023--
Jim MichaelUC11+214,0331,0172,265188fev 20, 2010113427421--
Mh7kJUC13-113,3503078,661184jul 23, 2011616719--
GoblinBot4UC14 011,50639716,338552mar 17, 20091474----
BarrasUC15 010,8051211,14319fev 01, 20091518210---
TDKR Chicago 101UC17+28,9421,3751,725275jul 23, 20122501,116112--
KingRaven44UC20 07,6091692,22226out 17, 200912601,66320--
Oregonian2012UC24+16,9453071,772190fev 12, 201241254325--
ChenzwUC25+16,8322919,122332mar 10, 2007221297---
PiRSquared17UC29 06,45216,8546out 23, 20091254129---
PmlineditorUC30+66,2277538,62575abr 14, 20091446165---
The Rambling ManUC32-16,01764,9451mar 31, 20081825333---
GotandaUC33-15,834211,4115set 19, 2010923306---
Hazard-SJUC42 04,66833,2768jul 10, 201099424---
Gordonrox24UC51 03,946113,92228jun 07, 2009139283---
KidlatUC61+23,27975303ago 25, 2008167835---
DJDunsieUC62-13,26091,0891set 19, 2010923121---
AnseiUC64 03,101297461out 01, 20121801403--
SavhUC73 02,706811,70553set 26, 20109163---
September 1988UC81+52,420188755ago 04, 20109691,735178--
MentifistoUC94 02,15541,4503jan 17, 2008189933---
The Flying Spaghetti MonsterUC99+11,96931,4891dez 16, 20071931174---
SinbadUC105 01,803116432jul 04, 200720962222--
DidiWeidmannUC107+21,7599172-abr 27, 20081798----
Bsadowski1UC109-11,679102,21912jan 10, 200915409---
HamnetoUC111 01,6412270-out 21, 2012160213---
ONaNcleUC120 01,38644121mai 12, 200721498---
Werner100359UC121 01,378280-dez 18, 2010833189---
GrunnyUC122 01,33011,181-mar 08, 201011187---
KennedyUC123 01,32093,04723abr 23, 20081802123---
UltraRainbowsUC127+11,1833351-jun 12, 20122912---
Dale ArnettUC129 01,1511107-out 16, 200334533---
M7UC130 01,137101,15310mar 29, 200529232---
7mike5000UC131+551,128456451132nov 03, 2012147368--
JmarcanoUC151+293430250-set 12, 200720261254--
Snow BlizzardUC153+49145564437dez 05, 2012115854--
Clarkcj12UC156+990610193159nov 07, 200912392813--
JinkiUC167+21779958525498fev 03, 2013557031--
Lugia2453UC180+147759480345201fev 01, 2013575837--
MAXXX-309UC191+565333412mai 29, 201230591--
MichaeldsuarezUC193-3648171-ago 03, 201160520---
Patrick0MoranUC194-1644119011set 18, 2009128933---
Wiki13UC202-160725764ago 07, 201160113---
CourcellesUC208+158610687-fev 28, 201011266---

 

20 wikipedistas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
  Primeira ediçãoúltima edição
 posiçãototaldatadias
atrás
datadias
atrás
BarlinerUC720,203jul 23, 20072077jul 01, 2011638
RazorflameUC818,421nov 23, 20071954jun 17, 2012286
Nameless UserUC1015,028ago 30, 20081673out 04, 2010908
HorekiUC1213,804dez 13, 2011473out 17, 2012164
SynergyUC169,955jul 25, 20081709mar 24, 20101102
TygrrrUC187,858dez 28, 20062284jul 19, 2011620
GriffinofwalesUC197,857mai 07, 20091423set 02, 2011575
BlockinbloxUC217,365out 14, 20052724mar 27, 2012368
FreshstartUC227,245dez 13, 20052664ago 06, 20062428
FairfieldUC237,128set 20, 20072018abr 09, 20091451
KansanUC266,671jan 29, 20101156jan 03, 201386
TbennertUC276,484jun 05, 2011664jan 30, 201359
Hailey C. ShannonUC286,464jan 21, 20052990jan 23, 20091527
GwibUC316,185abr 10, 20072181jul 23, 2010981
American EagleUC345,801abr 08, 20081817fev 09, 2012415
The Three Headed KnightUC355,757abr 10, 20101085set 01, 2011576
D'ohBotUC365,611jun 26, 20091373abr 26, 2012338
GoblinBot2UC375,328nov 03, 20081608jan 05, 20101180
RyanCrossUC385,268mai 21, 20081774out 04, 2011543
PhnomPencilUC394,911ago 28, 2011580abr 13, 2012351

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 378.007 edições foram feitas por usuários anônimos, de um total de 2883.632 edições ( 13e %)
  


50 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições 
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
 datadias
atrás
datadias
atrás
EmausBotUC1122,598jun 13, 20101021mar 07, 2013231-
Luckas-botUC2115,260jul 10, 20081724jul 03, 201227011-
AddbotUC394,627fev 16, 20091503mar 31, 2013---
XqbotUC480,450jan 03, 20091547mar 07, 2013231-
SieBotUC570,020jun 18, 20072112jan 25, 2011795--
TXiKiBoTUC668,327fev 20, 20072230jan 09, 2013802-
MerlIwBotUC754,440abr 23, 2011707mar 31, 2013-1-
ArthurBotUC852,858dez 14, 20081567nov 15, 20121354-
VolkovBotUC948,590jan 21, 20072260mar 04, 2013263-
Thijs!botUC1046,388mai 10, 20062516out 15, 2012166--
ZéroBotUC1142,039ago 22, 2010951mar 07, 201323--
EscarbotUC1232,982jun 16, 20062479mar 03, 2013271-
JAnDbotUC1331,362ago 20, 20062414mar 06, 201324--
WikitanvirBotUC1424,106set 28, 2010914mai 15, 20123192-
YurikBotUC1523,353mai 21, 20052870ago 26, 20062408--
AlexbotUC1620,455jan 07, 20081909ago 28, 2012214--
MelancholieBotUC1718,047mar 30, 20081826nov 28, 20091218--
ChuispastonBotUC1816,705set 21, 2010921abr 28, 20123363-
RedBotUC1916,670ago 19, 20091319ago 24, 20122181-
GrouchoBotUC2014,422jan 11, 20091539mar 06, 2013241-
RibotBOTUC2112,962fev 21, 20091498jan 26, 201363--
AlleborgoBotUC2211,993mar 30, 20072192ago 08, 2010965--
TobeBotUC2311,850ago 16, 20091322set 14, 20109281-
YFdyh-botUC2411,201jun 17, 2012286fev 27, 201331--
PtbotgourouUC2510,022jul 29, 20081705mar 06, 201324--
Makecat-botUC269,428jun 21, 2012282mar 06, 201324--
DragonBotUC279,350out 05, 20072003fev 03, 201355--
Idioma-botUC289,180mar 01, 20072221mar 06, 201324--
Auntof6BotUC299,176set 01, 2011576mar 30, 2013---
BotMultichillUC309,009abr 26, 20072165abr 17, 2011713--
FlaBotUC318,994abr 30, 20052891set 11, 20091296--
FoxBotUC328,737out 01, 20091276fev 05, 2012419--
DarkicebotUC338,563dez 31, 20071916fev 13, 20101141780-
SynthebotUC348,270mar 29, 20072193jan 31, 201358--
ZorrobotUC358,137jun 12, 20081752set 06, 2012205--
SassoBotUC367,803dez 23, 20081558mar 06, 201324--
MystBotUC377,643jul 03, 20081731mar 08, 20123872-
YotbotUC387,159dez 29, 20081552mar 13, 200914784,232-
DodekBotUC396,867dez 29, 20062283ago 07, 20081696--
OKBotUC406,808jun 08, 20072122jan 28, 20091522--
CarsracBotUC416,674mai 21, 20081774mar 01, 201329--
SilvonenBotUC426,648abr 14, 20081811fev 14, 201344--
KamikazeBotUC436,536jul 03, 20101001jan 27, 201362--
TjBotUC446,504out 31, 2010881mar 06, 201324--
Ripchip BotUC456,328mar 05, 2011756fev 18, 20124061-
JackieBotUC466,164ago 12, 2010961mar 07, 201323--
RubinbotUC476,139abr 02, 20091458mar 05, 201325--
HRoestBotUC485,940jun 14, 20101020mar 07, 201323--
AmirobotUC495,889jul 15, 20081719nov 24, 2011492--
ChenzwBotUC505,878abr 10, 20081815abr 29, 2012335--

 

Artigos que contêm pelo menos uma ligação interna e .. caracteres de texto legível, não contando códigos wiki e html,
ligações ocultas, etc.; títulos também não contam  (excluindo páginas de redirecionamento)

DataArtigos
 < 32 ch< 64 ch< 128 ch< 256 ch< 512 ch< 1 k ch< 2 k ch< 4 k ch< 8 k ch< 16 k ch< 32 k ch< 64 k ch
mai 20100.0%0.2%7.6%22.5%38.4%59.9%81.4%92.9%97.6%99.3%99.9%100.0%
abr 20100.0%0.2%7.8%22.9%39.0%60.6%81.6%93.0%97.7%99.4%99.9%100.0%
mar 20100.0%0.2%7.9%23.2%39.5%61.1%81.7%93.0%97.6%99.3%99.8%99.9%
fev 20100.0%0.2%8.0%23.5%39.8%61.5%82.0%93.1%97.7%99.4%99.9%100.0%
jan 20100.0%0.2%8.1%23.7%40.1%61.8%82.2%93.2%97.8%99.5%100.0%100.0%
dez 20090.0%0.2%8.2%23.9%40.4%62.0%82.3%93.2%97.7%99.3%99.8%99.9%
nov 20090.0%0.2%8.2%24.1%40.7%62.4%82.6%93.4%97.9%99.5%100.0%100.0%
out 20090.0%0.2%8.3%24.3%40.8%62.6%82.6%93.3%97.7%99.3%99.8%99.9%
set 20090.0%0.2%8.4%24.6%41.1%62.9%82.7%93.4%97.8%99.4%99.9%100.0%
ago 20090.0%0.2%8.5%24.9%41.4%63.3%82.8%93.4%97.8%99.4%99.9%100.0%
jul 20090.0%0.2%8.6%26.1%42.6%63.7%82.9%93.4%97.8%99.4%99.9%100.0%
jun 20090.0%0.2%8.5%26.5%43.0%64.2%83.3%93.6%97.9%99.4%99.9%100.0%
mai 20090.0%0.2%8.5%26.6%43.2%64.4%83.4%93.5%97.7%99.2%99.7%99.8%
abr 20090.0%0.4%9.0%27.1%43.8%65.0%83.7%93.7%97.9%99.4%99.9%100.0%
mar 20090.0%0.4%9.1%27.4%44.2%65.3%83.7%93.6%97.8%99.3%99.8%99.9%
fev 20090.0%0.4%9.3%28.0%44.7%65.7%83.9%93.8%98.0%99.5%100.0%100.0%
jan 20090.0%0.4%9.5%28.5%45.2%66.0%84.0%93.8%98.0%99.5%100.0%100.0%
dez 20080.0%0.5%4.1%18.5%37.9%61.8%81.8%92.8%97.6%99.3%99.8%99.9%
nov 20080.0%0.2%2.9%14.9%35.6%60.6%81.0%92.5%97.6%99.4%100.0%100.0%
out 20080.0%0.2%3.0%14.8%35.4%60.7%80.9%92.3%97.4%99.2%99.8%99.9%
set 20080.0%0.3%3.2%14.8%35.7%61.3%81.3%92.5%97.6%99.4%100.0%100.0%
ago 20080.0%0.2%3.1%14.0%35.3%61.1%81.3%92.5%97.6%99.4%99.9%100.0%
jul 20080.0%0.2%3.0%13.8%34.9%60.9%81.1%92.3%97.4%99.2%99.8%99.9%
jun 20080.0%0.2%3.0%13.9%33.4%60.1%81.0%92.4%97.6%99.4%99.9%100.0%
mai 20080.0%0.3%3.1%14.2%33.8%60.6%81.3%92.6%97.7%99.5%100.0%100.0%
abr 20080.0%0.3%3.2%14.3%33.9%60.5%81.2%92.5%97.7%99.5%100.0%100.0%
mar 20080.0%0.3%3.3%14.2%33.5%60.4%81.2%92.5%97.6%99.4%99.9%100.0%
fev 20080.0%0.3%3.4%14.2%33.8%60.8%81.5%92.7%97.7%99.4%99.8%99.9%
jan 20080.0%0.3%3.5%14.7%34.5%61.2%81.6%92.7%97.7%99.4%99.8%99.9%
dez 20070.0%0.3%3.8%15.6%35.9%61.9%81.9%92.8%97.7%99.4%99.8%99.9%
nov 20070.0%0.4%3.8%16.1%37.9%62.7%82.3%93.0%97.9%99.5%99.8%99.9%
out 20070.0%0.4%4.0%16.6%38.4%63.2%82.6%93.0%98.0%99.6%99.9%100.0%
set 20070.0%0.4%4.2%17.1%39.2%63.9%83.0%93.2%98.0%99.5%99.8%99.9%
ago 20070.1%0.5%4.5%17.9%40.2%64.7%83.4%93.4%98.1%99.6%99.9%100.0%
jul 20070.1%0.6%4.8%18.7%41.7%66.0%83.8%93.6%98.3%99.8%100.0%100.0%
jun 20070.1%0.6%4.9%18.7%41.6%65.9%83.6%93.5%98.2%99.7%100.0%100.0%
mai 20070.1%0.7%5.3%19.3%42.3%66.7%84.1%93.6%98.2%99.6%99.9%100.0%
abr 20070.1%0.7%5.5%19.8%43.0%67.3%84.5%93.8%98.2%99.6%99.9%100.0%
mar 20070.1%0.8%5.9%20.5%43.9%68.1%84.9%94.0%98.3%99.7%100.0%100.0%
fev 20070.2%0.9%6.3%21.8%45.5%69.6%85.7%94.3%98.4%99.8%100.0%100.0%
jan 20070.2%1.0%6.9%22.8%46.8%70.5%86.1%94.4%98.3%99.7%99.9%99.9%
dez 20060.2%1.2%7.6%24.2%48.6%72.0%86.9%94.7%98.5%99.9%100.0%100.0%
nov 20060.2%1.3%8.3%25.1%49.7%72.0%86.9%94.6%98.4%99.7%99.9%99.9%
out 20060.3%1.6%9.0%25.9%50.0%71.9%86.9%94.6%98.4%99.8%100.0%100.0%
set 20060.3%1.7%9.6%26.7%50.8%72.3%87.1%94.7%98.5%99.9%100.0%100.0%
ago 20060.3%1.7%9.8%27.0%51.5%72.9%87.2%94.6%98.3%99.6%99.8%99.8%
jul 20060.4%2.0%10.0%27.2%51.7%73.0%87.3%94.7%98.4%99.7%99.9%99.9%
jun 20060.4%2.1%10.5%27.6%52.1%73.1%87.1%94.4%98.3%99.6%99.8%99.8%
mai 20060.4%2.3%10.9%27.9%52.5%73.2%87.1%94.5%98.4%99.7%99.9%99.9%
abr 20060.5%2.6%11.5%28.2%53.0%73.3%87.0%94.4%98.4%99.7%99.9%99.9%
mar 20060.5%2.6%11.7%28.6%53.7%73.6%87.0%94.2%98.4%99.7%99.9%99.9%
fev 20060.5%2.9%12.2%29.4%54.1%74.0%87.1%94.3%98.5%99.8%100.0%100.0%
jan 20060.5%2.8%12.4%29.7%54.0%73.5%86.6%93.9%98.4%99.8%100.0%100.0%
dez 20050.6%3.2%13.0%30.5%54.4%73.0%86.1%93.4%98.1%99.7%99.9%100.0%
nov 20050.8%3.6%13.4%31.4%54.9%72.9%85.7%93.3%98.1%99.7%99.9%99.9%
out 20050.9%3.5%13.5%31.6%54.4%72.8%85.6%93.1%98.1%99.7%100.0%100.0%
set 20051.0%3.6%14.1%32.0%55.1%73.5%86.0%93.4%98.2%99.7%100.0%100.0%
ago 20051.2%4.1%14.4%32.5%55.4%74.0%86.1%93.5%98.3%99.8%100.0%100.0%
jul 20051.8%5.3%15.7%33.9%55.9%74.4%86.3%93.4%98.2%99.6%99.9%99.9%
jun 20052.2%6.7%17.9%36.0%56.8%74.9%86.9%93.9%98.3%99.7%100.0%100.0%
mai 20055.8%10.2%20.1%37.5%58.3%76.7%88.9%95.6%98.5%99.6%99.9%100.0%
abr 20051.8%5.6%14.9%33.1%55.8%75.9%89.0%95.5%98.4%99.5%99.9%100.0%
mar 20051.5%5.1%14.3%32.6%55.8%76.0%89.2%95.5%98.3%99.4%99.8%99.9%
fev 20050.7%3.9%13.2%31.1%54.4%75.6%89.4%95.5%98.3%99.4%99.8%99.9%
jan 20050.5%3.0%12.4%29.9%53.1%74.7%89.1%95.5%98.4%99.6%100.0%100.0%
dez 20040.3%2.3%11.8%28.9%52.2%73.7%88.3%95.2%98.4%99.7%100.0%100.0%
nov 20040.2%2.5%12.2%29.4%53.0%73.7%88.3%95.0%98.1%99.4%99.8%99.9%
out 20040.3%2.9%13.4%30.8%54.8%75.0%88.6%95.3%98.4%99.5%99.9%100.0%
set 20040.4%3.1%14.0%31.8%56.4%76.4%89.6%95.6%98.5%99.6%100.0%100.0%
ago 20040.2%2.8%12.9%29.9%53.8%75.0%89.0%95.2%98.2%99.4%99.9%100.0%
jul 20040.4%2.6%12.0%28.2%52.7%73.8%88.6%95.1%98.2%99.3%99.9%100.0%
jun 20040.1%2.5%12.6%29.9%54.3%75.1%88.8%95.3%98.3%99.3%99.9%100.0%
mai 20040.2%2.8%12.9%31.1%54.7%75.6%89.7%95.5%98.4%99.3%99.9%99.9%
abr 20040.3%2.8%12.8%29.3%51.9%75.6%90.9%96.5%99.2%99.9%100.0%100.0%
mar 20040.4%2.5%12.2%27.9%49.6%73.8%90.6%96.9%99.6%100.0%100.0%100.0%
fev 20040.4%2.6%10.7%24.2%46.3%72.2%90.6%96.6%99.3%99.9%99.9%99.9%
jan 20040.5%3.0%11.1%24.3%46.6%71.8%90.0%96.6%99.3%100.0%100.0%100.0%
dez 20030.6%3.4%11.0%23.3%45.0%71.3%89.7%96.9%99.5%100.0%100.0%100.0%
nov 20031.3%4.4%10.8%22.7%40.8%68.6%88.5%96.2%99.3%100.0%100.0%100.0%
out 20031.2%2.7%9.8%20.9%36.6%63.7%88.0%96.3%99.4%100.0%100.0%100.0%
set 20031.9%4.4%13.8%21.9%38.8%68.8%91.3%98.8%100.0%100.0%100.0%100.0%
ago 20031.9%4.7%17.8%29.0%49.6%76.7%92.6%99.1%100.0%100.0%100.0%100.0%
jul 20032.9%8.8%23.5%35.3%57.4%82.4%92.7%100.0%100.0%100.0%100.0%100.0%
jun 20030.0%2.2%17.8%28.9%48.9%80.0%91.1%100.0%100.0%100.0%100.0%100.0%
mai 20030.0%2.4%17.0%24.3%46.3%78.0%90.2%100.0%100.0%100.0%100.0%100.0%
abr 20030.0%2.6%15.8%23.7%42.1%76.3%89.5%100.0%100.0%100.0%100.0%100.0%
mar 20030.0%2.9%17.2%25.8%42.9%80.0%91.4%100.0%100.0%100.0%100.0%100.0%
fev 20030.0%0.0%8.3%8.3%16.6%49.9%83.2%99.9%99.9%99.9%99.9%99.9%
jan 20030.0%0.0%0.0%0.0%9.1%54.6%91.0%100.0%100.0%100.0%100.0%100.0%
dez 20020.0%0.0%0.0%0.0%10.0%60.0%100.0%100.0%100.0%100.0%100.0%100.0%
nov 20020.0%0.0%0.0%0.0%12.5%62.5%100.0%100.0%100.0%100.0%100.0%100.0%
out 20020.0%0.0%0.0%0.0%12.5%62.5%100.0%100.0%100.0%100.0%100.0%100.0%
set 20020.0%0.0%0.0%0.0%28.6%71.5%100.0%100.0%100.0%100.0%100.0%100.0%
ago 20020.0%0.0%0.0%0.0%28.6%71.5%100.0%100.0%100.0%100.0%100.0%100.0%
jul 20020.0%0.0%0.0%0.0%33.3%83.3%100.0%100.0%100.0%100.0%100.0%100.0%
jun 20020.0%0.0%0.0%0.0%33.3%83.3%100.0%100.0%100.0%100.0%100.0%100.0%
mai 20020.0%0.0%0.0%0.0%33.3%83.3%100.0%100.0%100.0%100.0%100.0%100.0%
abr 20020.0%0.0%0.0%0.0%33.3%83.3%100.0%100.0%100.0%100.0%100.0%100.0%
mar 20020.0%0.0%0.0%0.0%33.3%83.3%100.0%100.0%100.0%100.0%100.0%100.0%
fev 20020.0%0.0%0.0%0.0%33.3%83.3%100.0%100.0%100.0%100.0%100.0%100.0%
jan 20020.0%0.0%0.0%0.0%40.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
dez 20010.0%0.0%0.0%0.0%40.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
nov 20010.0%0.0%0.0%0.0%40.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
out 20010.0%0.0%0.0%0.0%40.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
set 20010.0%0.0%0.0%0.0%50.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
ago 20010.0%0.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
jul 20010.0%0.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
jun 20010.0%0.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
mai 20010.0%0.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.

See also Category Overview Complete (2.3 Mb!), Concise (74 kb)
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110OggPng
mar 2013129 k15 k3,6 k3549317 k10321 k       341
fev 2013127 k15 k3,6 k3549117 k10220 k       341
jan 2013126 k15 k3,5 k3549117 k10220 k       341
dez 2012124 k15 k3,5 k3549117 k10219 k       341
nov 2012123 k14 k3,5 k3548817 k10119 k       341
out 2012121 k14 k3,4 k3548716 k10119 k       341
set 2012120 k14 k3,4 k3548516 k10019 k       341
ago 2012119 k14 k3,4 k3547716 k10018 k       341
jul 2012117 k14 k3,3 k3547216 k10018 k       341
jun 2012116 k14 k3,3 k3547115 k10017 k       341
mai 2012114 k13 k3,3 k3547115 k10017 k       341
abr 2012113 k13 k3,3 k3547015 k10017 k       341
mar 2012111 k13 k3,2 k3546815 k10016 k       341
fev 2012109 k13 k3,1 k3546815 k10016 k       341
jan 2012108 k13 k3,1 k3546715 k9915 k       341
dez 2011107 k13 k3,0 k3546314 k9915 k       341
nov 2011105 k12 k3,0 k3546314 k9815 k       341
out 2011104 k12 k3,0 k3546314 k9814 k       341
set 2011103 k12 k3,0 k3546314 k9814 k       341
ago 2011102 k12 k2,9 k3546313 k9813 k       341
jul 2011101 k12 k2,9 k3446213 k9813 k       331
jun 2011101 k12 k2,9 k3446113 k9813 k       331
mai 201199 k11 k2,8 k3445913 k9513 k       331
abr 201198 k11 k2,8 k3445613 k9513 k       331
mar 201197 k11 k2,7 k3445213 k9513 k       331
fev 201196 k11 k2,7 k3444913 k9512 k       331
jan 201195 k11 k2,7 k3443612 k9412 k       331
dez 201093 k11 k2,6 k3443412 k9412 k       331
nov 201092 k10 k2,6 k3343112 k9412 k       321
out 201091 k10 k2,5 k3342912 k9412 k       321
set 201090 k10 k2,5 k3342212 k9412 k       321
ago 201089 k10 k2,4 k3342111 k9412 k       321
jul 201088 k9,8 k2,4 k3341911 k9112 k       321
jun 201087 k9,6 k2,3 k3340611 k8912 k       321
mai 201085 k9,4 k2,3 k3339810 k8612 k      11496321
abr 201084 k9,2 k2,2 k3339810 k8511 k      13141321
mar 201083 k9,0 k2,2 k3339710,0 k8511 k      16127321
fev 201082 k8,8 k2,1 k333969,8 k8411 k      10240321
jan 201081 k8,5 k2,0 k333969,7 k8311 k      15015321
dez 200979 k8,3 k1,9 k333959,5 k8311 k      11244321
nov 200978 k8,1 k1,9 k333959,4 k8011 k      10703321
out 200977 k7,9 k1,8 k333939,3 k8011 k      10249321
set 200975 k7,7 k1,8 k333938,9 k8011 k      9742321
ago 200973 k7,5 k1,8 k323878,8 k8011 k      10486311
jul 200972 k7,3 k1,6 k323858,6 k8011 k      11283311
jun 200971 k7,2 k1,6 k323218,5 k8011 k      8196311
mai 200970 k7,0 k1,5 k323118,1 k8011 k      13225311
abr 200969 k6,8 k1,4 k323008,0 k8011 k      10517311
mar 200967 k6,6 k1,4 k312977,8 k8010 k      13061301
fev 200965 k6,3 k1,3 k132967,3 k8010 k      12413121
jan 200964 k6,0 k1,2 k132927,1 k339,9 k      15328121
dez 200856 k5,8 k1,1 k132896,9 k339,7 k      17553121
nov 200853 k5,6 k989132886,8 k329,6 k      12634121
out 200851 k5,4 k903132866,6 k329,4 k      12057121
set 200849 k5,1 k832132716,4 k319,1 k      11983121
ago 200847 k5,0 k769132606,2 k319,0 k      11999121
jul 200845 k4,7 k708132576,0 k278,7 k      15362121
jun 200842 k4,4 k644132495,7 k268,5 k      14459121
mai 200840 k4,1 k597132485,4 k258,1 k      11022121
abr 200838 k3,9 k551132395,1 k247,8 k      9047121
mar 200837 k3,7 k527132234,9 k237,7 k      10386121
fev 200836 k3,5 k507131824,7 k237,5 k      13826121
jan 200834 k3,3 k495131694,5 k237,0 k      13858121
dez 200732 k3,1 k470131424,2 k226,6 k      17989121
nov 200730 k3,0 k449131293,7 k226,2 k      9765121
out 200729 k2,8 k444131283,4 k225,9 k      7862121
set 200728 k2,7 k430131272,5 k215,6 k      8451121
ago 200727 k2,6 k390131232,1 k195,4 k      10652121
jul 200725 k2,5 k360121192,0 k185,1 k      7520111
jun 200724 k2,4 k339121111,8 k164,9 k      7247111
mai 200723 k2,3 k317121111,8 k164,8 k      7373111
abr 200722 k2,1 k306121111,7 k164,6 k      7315111
mar 200721 k2,0 k288121081,6 k144,5 k      8273111
fev 200720 k1,9 k28512921,5 k144,1 k      6720111
jan 200719 k1,8 k25812921,4 k143,7 k      7648111
dez 200618 k1,7 k24812921,2 k143,6 k      9354111
nov 200617 k1,6 k23612871,1 k143,4 k      8973111
out 200616 k1,4 k22612871,0 k143,1 k      6459111
set 200615 k1,3 k198687976143,0 k      605251
ago 200614 k1,2 k192687916132,9 k      506351
jul 200614 k1,1 k186686890122,8 k      405551
jun 200612 k1,0 k173186834122,7 k      3515 1
mai 200612 k956159185773122,6 k      5114 1
abr 200611 k884152185606122,3 k      3829 1
mar 200610 k829145183530122,1 k      3574 1
fev 20069,4 k754145183504112,0 k      4338 1
jan 20068,5 k712130181476111,9 k      5423 1
dez 20057,3 k659127181433101,8 k      2824 1
nov 20056,7 k599124176402101,7 k      2725 1
out 20056,4 k563123176386101,6 k      2010 1
set 20056,0 k527122176364101,5 k      1214 1
ago 20055,8 k499122176359101,5 k      2358 1
jul 20055,3 k476116176321101,1 k      2186 1
jun 20055,0 k43311417130310714      2992 1
mai 20054,5 k40411117121810372      1862 1
abr 20053,9 k36810917116510237      1112 1
mar 20053,7 k34110817115210195      1026 1
fev 20053,4 k3161061717010184      1081 1
jan 20053,1 k2911051716610146      799 1
dez 20042,8 k262105171619140      1063 1
nov 20042,6 k2499417050894      767 1
out 20042,4 k2338916947887      396 1
set 20042,3 k2188616946781      850 1
ago 20042,1 k2028216835741      1102 1
jul 20041,9 k179801682671      525 1
jun 20041,8 k15979 67197          
mai 20041,6 k13279 66166          
abr 20041,3 k11967 33156          
mar 20041,1 k9362 33115          
fev 20049338158 3385          
jan 20048387253 3275          
dez 20037573947 3175          
nov 20035542826   4          
out 20034092123   3          
set 20031961512   3          
ago 2003139109   2          
jul 20038765   1          
jun 20035544   1          
mai 20034924              
abr 20034523              
mar 20034123              
fev 20031722              
jan 20031412              
dez 20021212              
nov 20021111              
out 20021111              
set 20021011              
ago 20021011              
jul 2002911              
jun 2002911              
mai 2002811              
abr 2002711              
mar 2002711              
fev 2002711              
jan 200241               
dez 200141               
nov 200141               
out 200141               
set 2001 1               
ago 2001   
jul 2001   
jun 2001   
mai 2001   

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

mai 2001: 1 1 Swedish Academy

jun 2001: 1 2 Ludwig Mies van der Rohe

ago 2001: 1 1 Swedish Academy

set 2001: 1 1 Mark

out 2001: 1 1 Paul Bunyan

fev 2002: 1 2 Ludwig Mies van der Rohe , 2 2 Mark

mar 2002: 1 2 Europa

abr 2002: 1 3 Europa

mai 2002: 1 3 Europa , 2 1 2026

jun 2002: 1 1 Ludwig Mies van der Rohe

jul 2002: 1 1 Mark

ago 2002: 1 2 Paul Bunyan , 2 2 Candidiasis

set 2002: 1 3 Europa , 2 1 2026

out 2002: 1 1 French Island (Victoria)

nov 2002: 1 1 Science Museum (London)

dez 2002: 1 1 Science Museum (London)

jan 2003: 1 1 2044

fev 2003: 1 3 Cancer (constellation) , 2 2 Swedish Academy , 3 1 List of communities in Nova Scotia

mar 2003: 1 2 Zacarias Moussaoui , 2 2 Cancer (constellation) , 3 1 Ludwig Mies van der Rohe

abr 2003: 1 3 Sibley-Monroe checklist 1

mai 2003: 1 3 Ludwig Mies van der Rohe , 2 3 1961 in sports

jun 2003: 1 3 1961 in sports , 2 2 List of communities in Nova Scotia , 3 2 Paul Bunyan

jul 2003: 1 4 Astrodome , 2 2 Cancer (constellation) , 3 1 Sibley-Monroe checklist 1

ago 2003: 1 3 Zacarias Moussaoui , 2 3 Cancer (constellation) , 3 2 Feral organism , 4 2 Astrodome

set 2003: 1 3 Name , 2 2 Basic English , 3 2 Very High Bitrate Digital Subscriber Line , 4 2 Oahu , 5 2 Non-profit

out 2003: 1 2 Speaker of the Australian House of Representatives , 2 2 Alfred Sisley , 3 2 Saku Koivu , 4 2 Allan Cup , 5 2 Northern League (baseball) , 6 2 List of NHL players , 7 2 Microsoft Windows , 8 2 Verb , 9 2 Unit of measurement , 10 2 Terrestrial ecoregion , 11 2 Sheep , 12 2 Psychoneuroimmunology , 13 2 Microsoft , 14 2 History , 15 2 FAQ

nov 2003: 1 3 Dimension , 2 2 Feral organism , 3 2 Zacarias Moussaoui , 4 2 Tunisair , 5 2 International Ice Hockey Federation , 6 2 Pluto , 7 2 Window , 8 2 Volume , 9 2 Table , 10 2 Systeme internationale , 11 2 State , 12 2 Server log , 13 2 Sport , 14 2 Pi (math) , 15 2 Periodic table , 16 2 Plant , 17 2 Like , 18 2 Killing , 19 2 Helium , 20 2 Geometry , 21 2 Egypt , 22 2 Elements , 23 2 Depth , 24 2 Dimensions

dez 2003: 1 5 Main Page , 2 3 Basic English , 3 3 Zinc , 4 3 Dimension , 5 3 Browser , 6 2 Feral organism , 7 2 Speaker of the Australian House of Representatives , 8 2 Ludwig Mies van der Rohe , 9 2 Zacarias Moussaoui , 10 2 English as a second language , 11 2 Vulcanicity , 12 2 Fold (geology) , 13 2 Endogenetic process , 14 2 Old calendar , 15 2 Atlantic Ocean , 16 2 Mexico , 17 2 Gaol , 18 2 Republic of China , 19 2 Zoo , 20 2 Chinese language , 21 2 Web browser , 22 2 Unix , 23 2 University , 24 2 Right angle , 25 2 Plastic

jan 2004: 1 5 Main Page , 2 3 Australian War Memorial , 3 3 United States dollar , 4 3 Colour , 5 2 San Cristóbal , 6 2 Zacarias Moussaoui , 7 2 World War I , 8 2 Wade Redden , 9 2 Names of numbers in English , 10 2 English as a second language , 11 2 Euro , 12 2 Albert Einstein , 13 2 Semiotics , 14 2 Asia , 15 2 Slavery , 16 2 River , 17 2 Japan , 18 1 Feral organism

fev 2004: 1 11 Main Page , 2 4 Computer network , 3 4 Mark , 4 4 Kami , 5 3 Russia , 6 3 Berlin , 7 3 Luxembourg , 8 3 Communication , 9 3 Cat , 10 3 Google , 11 2 Feral organism , 12 2 William Shakespeare , 13 2 Sibley-Monroe checklist 1 , 14 2 Zacarias Moussaoui , 15 2 Paul Bunyan , 16 2 Canada , 17 2 Wikipedia , 18 2 1990s , 19 2 Munich , 20 2 Peru , 21 2 Homonym , 22 2 Vienna , 23 2 Baden-Württemberg , 24 2 Treaty , 25 2 Satellite (natural)

mar 2004: 1 5 Television , 2 4 Main Page , 3 3 Lord Mayor , 4 3 Mark , 5 3 Discovery , 6 3 Christmas cake , 7 3 Gas syringe , 8 3 Scotland , 9 3 United States dollar , 10 3 Unit of measurement , 11 3 Universe , 12 3 Solar System , 13 3 OK , 14 3 Mars , 15 3 Asteroid , 16 2 Havre Boucher , 17 2 San Cristóbal , 18 2 Deutsche Eishockey Liga , 19 2 Pluto , 20 2 Mansfield, Victoria , 21 2 Sun , 22 2 Minnesota River , 23 2 German language , 24 2 Renegades , 25 2 Properties

abr 2004: 1 10 Main Page , 2 4 List of ice hockey leagues , 3 4 Mark , 4 4 French language , 5 4 Fertilizer , 6 4 Culture , 7 3 Los Santos Province , 8 3 Christianity , 9 3 United States , 10 3 North , 11 3 Gross domestic product , 12 3 Photon , 13 3 Desktop environment , 14 3 Linux , 15 3 Buddha , 16 3 Sphere , 17 3 Isotope , 18 3 Minute , 19 3 Female , 20 3 Slope , 21 3 Euro , 22 3 Periodic table , 23 3 Kilometre , 24 3 Graph theory , 25 3 Everything2

mai 2004: 1 6 Main Page , 2 4 Air space , 3 4 Vitamin C , 4 4 Generation , 5 4 Preposition , 6 4 North , 7 4 Internet Explorer , 8 4 Raw , 9 3 Lord Mayor , 10 3 United States , 11 3 Mark , 12 3 Oxidation , 13 3 Lao Tzu , 14 3 Snow , 15 3 East , 16 3 Lake , 17 3 Adelaide , 18 3 Nuclear war , 19 3 Market , 20 3 Rain , 21 3 Light , 22 3 Jungle , 23 3 19th century , 24 3 Decade , 25 3 Arrow

jun 2004: 1 5 Marco Polo , 2 5 Google Mail , 3 5 Population , 4 4 Science Museum (London) , 5 4 World War II , 6 4 GNU General Public License , 7 4 Tokyo , 8 4 Chat , 9 4 British English , 10 3 Saku Koivu , 11 3 Main Page , 12 3 Cancer (constellation) , 13 3 Herbivore , 14 3 Omnivore , 15 3 Aristotle , 16 3 Astronomer , 17 3 Adolf Hitler , 18 3 Neuron , 19 3 North Korea , 20 3 Resurrection , 21 3 Snow , 22 3 Adjustable spanner , 23 3 Video game console , 24 3 Plato , 25 3 Blindness

jul 2004: 1 4 Main Page , 2 4 Wikipedia , 3 4 EBay , 4 4 Tokyo , 5 4 English , 6 3 Christianity , 7 3 Translation , 8 3 Star , 9 3 Australia , 10 2 National Trust of Australia , 11 2 San Cristóbal , 12 2 Zacarias Moussaoui , 13 2 Czech Extraliga , 14 2 Bread roll , 15 2 World War II , 16 2 Spain , 17 2 Swedish Academy , 18 2 IRCd , 19 2 Mark , 20 2 Astrodome , 21 2 Saskatchewan , 22 2 Martin Luther , 23 2 Immanuel Kant , 24 2 1970 , 25 2 Carbon

ago 2004: 1 4 United States , 2 4 Stockholm , 3 4 Norway , 4 4 Cologne , 5 4 Turkey , 6 4 Sweden , 7 3 Abbotsford , 8 3 Spain , 9 3 Highland Football League , 10 3 Oral candidiasis , 11 3 Naples , 12 3 Socrates , 13 3 Afganistan , 14 3 Pakistan , 15 3 Atlanta , 16 3 Côte d'Ivoire , 17 3 Aristotle , 18 3 Kyoto , 19 3 Johann Sebastian Bach , 20 3 Tokyo , 21 3 Xenon , 22 3 Lisbon , 23 3 Estonia , 24 3 Chile , 25 3 Das Lied der Deutschen

set 2004: 1 8 Mark , 2 5 Main Page , 3 4 DNA , 4 3 Feral organism , 5 3 Australian War Memorial , 6 3 List of current Canadian first ministers , 7 3 List of Canadian painters , 8 3 Caspar Wessel , 9 3 Canada , 10 3 United States , 11 3 George Washington , 12 3 Mandarin language , 13 3 George W. Bush , 14 3 Wiki , 15 3 Japan , 16 2 Speaker of the Australian House of Representatives , 17 2 2050 , 18 2 2026 , 19 2 Divisions of the Australian House of Representatives , 20 2 Ludwig Mies van der Rohe , 21 2 Science Museum (London) , 22 2 Alfred Sisley , 23 2 Basic English , 24 2 Germany , 25 2 Christianity

out 2004: 1 5 Main Page , 2 4 Breakfast , 3 3 Australian War Memorial , 4 3 Division of North Sydney , 5 3 Ludwig Mies van der Rohe , 6 3 Norwegian Nobel Committee , 7 3 Candidiasis , 8 3 Mark , 9 3 Julius Caesar , 10 2 Division of Bendigo , 11 2 Division of Ballarat , 12 2 Speaker of the Australian House of Representatives , 13 2 List of bridges in Ottawa , 14 2 List of Canadian painters , 15 2 Zacarias Moussaoui , 16 2 Prostatitis , 17 2 Lord Mayor , 18 2 Ararat, Victoria , 19 2 Bukit Timah , 20 2 Northern League (baseball) , 21 2 Daemon (computer software) , 22 2 Cancer (constellation) , 23 2 Discovery , 24 2 Chalcedon , 25 2 Bag

nov 2004: 1 5 Zacarias Moussaoui , 2 4 Francisco Hernández de Córdoba (Yucatán conquistador) , 3 4 Main Page , 4 4 Mark , 5 3 Judaism , 6 3 Comparative , 7 3 George Orwell , 8 3 Chopsticks , 9 3 Synonym , 10 3 Psychology , 11 3 Archduke Franz Ferdinand of Austria , 12 3 George W. Bush , 13 3 English as a second language , 14 3 History , 15 2 National Trust of Australia , 16 2 Oxford, Nova Scotia , 17 2 Division of Ballarat , 18 2 Speaker of the Australian House of Representatives , 19 2 Divisions of the Australian House of Representatives , 20 2 Sibley-Monroe checklist 1 , 21 2 List of bridges to the Island of Montreal , 22 2 1961 in sports , 23 2 Francisco Hernández de Córdoba (founder of Nicaragua) , 24 2 List of ice hockey leagues , 25 2 List of subcamps of Kraków-Płaszów

dez 2004: 1 5 Mark , 2 4 Francisco Hernández de Córdoba (Yucatán conquistador) , 3 4 Main Page , 4 4 Death penalty , 5 3 International Ice Hockey Federation , 6 3 World War I , 7 3 Creative network , 8 3 Astrodome , 9 3 Dictator , 10 3 Viktor Yushchenko , 11 3 Province , 12 3 Salamander , 13 3 February 12 , 14 3 February 22 , 15 3 1882 , 16 3 George W. Bush , 17 3 Das Lied der Deutschen , 18 3 Netherlands , 19 3 English as a second language , 20 3 France , 21 3 Edit , 22 3 English , 23 3 Dictionary , 24 3 Bottle , 25 2 Division of Higgins

jan 2005: 1 5 Alberta Junior Hockey League , 2 5 Cancer (constellation) , 3 5 Light pollution , 4 4 Canadian Junior Hockey League , 5 3 Arup , 6 3 Fort William, Ontario , 7 3 Daemon (computer software) , 8 3 January 30 , 9 3 February 21 , 10 3 May 1 , 11 3 Jurassic Park: Operation Genesis , 12 3 Pig Latin , 13 3 Jurassic Park , 14 3 Friends , 15 3 Mrs. Doubtfire , 16 3 J. R. R. Tolkien , 17 2 Prostatitis , 18 2 Paul Bunyan , 19 2 Northern League (baseball) , 20 2 Very High Bitrate Digital Subscriber Line , 21 2 Europa , 22 2 Leipzig , 23 2 Meal , 24 2 James Joyce , 25 2 John Lennon

fev 2005: 1 4 Dodgeball , 2 4 Ray Charles , 3 3 2045 , 4 3 Cancer (constellation) , 5 3 Wikipedia , 6 3 Steel , 7 3 Orphanage , 8 3 Uno (card game) , 9 3 Trailer (movie) , 10 3 Richard Attenborough , 11 3 Flower , 12 3 Cage , 13 3 February 7 , 14 3 American Samoa , 15 3 Diaper , 16 3 Rainbow , 17 3 Jehovah's Witnesses , 18 3 Mario Party (series) , 19 3 Light pollution , 20 3 Korean War , 21 3 Jerry Lee Lewis , 22 3 Frank Zappa , 23 3 Seinfeld , 24 3 George W. Bush , 25 3 1992

mar 2005: 1 5 Francisco Hernández de Córdoba (Yucatán conquistador) , 2 5 Fibonacci , 3 4 Divisions of the Australian House of Representatives , 4 4 Alfred Sisley , 5 4 Vandalism , 6 4 Algebra , 7 3 Australian War Memorial , 8 3 Bernie Morris , 9 3 Ad Council , 10 3 Guy Carbonneau , 11 3 Europa , 12 3 Cheers , 13 3 September 26 , 14 3 Free will , 15 3 1973 , 16 3 Tunnel , 17 3 Somerset , 18 3 City of London , 19 3 Green , 20 2 Division of Flinders , 21 2 List of communities in Nova Scotia , 22 2 Greenwood, Nova Scotia , 23 2 Oxford, Nova Scotia , 24 2 Ludwig Mies van der Rohe , 25 2 San Cristóbal

abr 2005: 1 12 Zacarias Moussaoui , 2 6 Daemon (computer software) , 3 5 Division of Higgins , 4 5 Main Page , 5 4 Australian War Memorial , 6 4 Ludwig Mies van der Rohe , 7 4 Periwinkle (color) , 8 4 Gábor Csupó , 9 4 The Who , 10 4 Pope John Paul II , 11 4 Cartoonist , 12 3 Francisco Hernández de Córdoba (Yucatán conquistador) , 13 3 International Ice Hockey Federation , 14 3 Alfred Sisley , 15 3 State Library of Victoria , 16 3 Second Fleet (Australia) , 17 3 Ararat, Victoria , 18 3 IRCd , 19 3 BBC Radio Scotland , 20 3 Hip hop , 21 3 1923 , 22 3 1904 , 23 3 Scandinavia , 24 3 Led Zeppelin , 25 3 Elton John

mai 2005: 1 6 Alfred Sisley , 2 6 Main Page , 3 5 List of ice hockey leagues , 4 5 Cancer (constellation) , 5 5 Pope John Paul II , 6 5 Homosexuality , 7 4 International Ice Hockey Federation , 8 4 Brandon Wheat Kings , 9 4 Jew , 10 4 Will Smith , 11 4 Pencil , 12 4 Earth , 13 3 Ludwig Mies van der Rohe , 14 3 Canadian Junior Hockey League , 15 3 United States , 16 3 A.C. Milan , 17 3 WC Fields , 18 3 Store , 19 3 Clint Eastwood , 20 3 Organic chemistry , 21 3 May 8 , 22 3 Buffy the Vampire Slayer , 23 3 January 17 , 24 3 Pope Benedict XVI , 25 3 January 15

jun 2005: 1 6 United States , 2 5 List of ice hockey leagues , 3 5 Cairo , 4 4 Jesus , 5 4 Scott Young , 6 4 Candidiasis , 7 4 Bent , 8 4 Kim Il-sung , 9 4 Calvin and Hobbes , 10 4 Audrey Hepburn , 11 4 Portugal , 12 4 China , 13 3 Division of Wannon , 14 3 Speaker of the Australian House of Representatives , 15 3 Ludwig Mies van der Rohe , 16 3 Honey War , 17 3 Zacarias Moussaoui , 18 3 Jersey (clothing) , 19 3 A minor , 20 3 Germany , 21 3 Northern League (baseball) , 22 3 Daemon (computer software) , 23 3 Astrodome , 24 3 Nirvana (band) , 25 3 Wikipedia

jul 2005: 1 7 London , 2 6 Discovery , 3 5 Ludwig Mies van der Rohe , 4 5 Neil Young , 5 5 Vladimir Nabokov , 6 5 Oscar Wilde , 7 5 Philosophy , 8 5 Music , 9 4 List of ice hockey leagues , 10 4 Northern League (baseball) , 11 4 Candidiasis , 12 4 Nirvana (band) , 13 4 Maceió (Brazil) , 14 4 Roberta Flack , 15 4 KC & the Sunshine Band , 16 4 The Specials , 17 4 Aaron Copland , 18 4 George Gershwin , 19 4 Costa Rica , 20 4 Steppenwolf , 21 4 Blue Öyster Cult , 22 4 The Cure , 23 4 John Williams , 24 4 Larry Mullen Jr. , 25 4 The Edge

ago 2005: 1 8 List of ice hockey leagues , 2 8 Pokémon (video game series) , 3 7 WWE Cruiserweight Championship , 4 6 Astrodome , 5 5 Very High Bitrate Digital Subscriber Line , 6 5 George W. Bush , 7 4 Canadian Junior Hockey League , 8 4 Saku Koivu , 9 4 Candidiasis , 10 4 Testicle , 11 4 Bill Clinton , 12 4 Alan Turing , 13 3 Australian War Memorial , 14 3 Speaker of the Australian House of Representatives , 15 3 Ludwig Mies van der Rohe , 16 3 List of bridges to the Island of Montreal , 17 3 List of Montreal Canadiens players , 18 3 1942–43 NHL season , 19 3 Francisco Hernández de Córdoba (Yucatán conquistador) , 20 3 Market East Station , 21 3 Alfred Sisley , 22 3 Greg Johnson , 23 3 Arup , 24 3 Monaro (New South Wales) , 25 3 Pikachu

set 2005: 1 20 Astrodome , 2 6 Candidiasis , 3 6 George W. Bush , 4 5 Ludwig Mies van der Rohe , 5 4 Science Museum (London) , 6 4 Pip Skid , 7 4 Cancer (constellation) , 8 4 Mark , 9 4 Vice president , 10 3 Saku Koivu , 11 3 List of Calgary Flames players , 12 3 Ocarina , 13 2 Division of Higgins , 14 2 List of NHL players (J) , 15 2 List of NHL players (B) , 16 2 List of Detroit Red Wings players , 17 2 List of Montreal Canadiens players , 18 2 Czech Extraliga , 19 2 List of subcamps of Stutthof , 20 2 List of subcamps of Kraków-Płaszów , 21 2 Cockatoo Island (New South Wales) , 22 2 Fort William, Ontario , 23 2 Lord Mayor , 24 2 Ararat, Victoria , 25 2 Christianity

out 2005: 1 17 Hurricane Vince (2005) , 2 7 A (musical note) , 3 6 Edgar Allan Poe , 4 5 Ludwig Mies van der Rohe , 5 5 Cancer (constellation) , 6 5 Candidiasis , 7 5 Monica Lewinsky , 8 4 List of Montreal Canadiens players , 9 4 Science Museum (London) , 10 4 Swedish Academy , 11 4 Gene Hackman , 12 4 Hippopotamus , 13 4 Elton John , 14 4 Toledo, Ohio , 15 4 George W. Bush , 16 3 1968 Atlantic hurricane season , 17 3 William Shakespeare , 18 3 List of Canadian painters , 19 3 List of Detroit Red Wings players , 20 3 Airblue , 21 3 Southern Professional Hockey League , 22 3 Alfred Sisley , 23 3 Jimmy Creighton , 24 3 WWE Cruiserweight Championship , 25 3 Christianity

nov 2005: 1 7 WWE Cruiserweight Championship , 2 6 The Holocaust , 3 5 Science Museum (London) , 4 5 Freddie Mercury , 5 5 Thanksgiving , 6 5 George W. Bush , 7 4 2050 , 8 4 Zacarias Moussaoui , 9 4 List of ice hockey leagues , 10 4 Hurricane Vince (2005) , 11 4 Eric Staal , 12 4 Doug Bentley , 13 4 Wade Redden , 14 4 Daemon (computer software) , 15 4 Candidiasis , 16 4 Astrodome , 17 4 Satan , 18 4 1468 , 19 4 Cambridgeshire , 20 4 Full Metal Jacket , 21 4 1915 , 22 4 Xbox 360 , 23 4 Love , 24 4 1986 , 25 4 1985

dez 2005: 1 8 Penis , 2 8 Sex , 3 7 List of ice hockey leagues , 4 7 Mark , 5 7 The Holocaust , 6 7 George W. Bush , 7 7 Dog , 8 6 Jew , 9 6 Jimmy Wales , 10 6 Rape , 11 5 Ryan Miller , 12 5 Saku Koivu , 13 5 Santa Claus , 14 5 Leet , 15 5 Joseph Stalin , 16 5 Zoology , 17 4 Naturalism (arts) , 18 4 Star Wars Episode IV: A New Hope , 19 4 Something Awful , 20 4 Shit , 21 4 Bob Barker , 22 4 Quantum mechanics , 23 4 Money , 24 4 Health , 25 3 Australian War Memorial

jan 2006: 1 11 Mark , 2 8 Chile , 3 7 Paul Bunyan , 4 7 United States , 5 7 Astrodome , 6 7 Adolf Hitler , 7 7 George W. Bush , 8 6 16-cell , 9 6 Cancer (constellation) , 10 6 Candidiasis , 11 6 List of Calgary Flames players , 12 6 The Holocaust , 13 6 Penis , 14 6 Wolfgang Amadeus Mozart , 15 5 Australian War Memorial , 16 5 Ken Wregget , 17 5 Taylor Chorney , 18 5 Hurricane Vince (2005) , 19 5 Oral candidiasis , 20 5 Holocaust , 21 5 Vagina , 22 5 Cuba , 23 4 List of Montreal Canadiens players , 24 4 Saku Koivu , 25 4 Alex Auld

fev 2006: 1 12 Mark , 2 9 Saku Koivu , 3 8 WWE Cruiserweight Championship , 4 8 Astrodome , 5 7 Zacarias Moussaoui , 6 7 Hurricane Vince (2005) , 7 6 Larry Aurie , 8 6 Alex Auld , 9 6 The Holocaust , 10 5 List of ice hockey leagues , 11 5 State Library of Victoria , 12 5 A minor , 13 5 Canada , 14 5 Bukit Timah , 15 5 Very High Bitrate Digital Subscriber Line , 16 5 Holocaust , 17 5 Movie , 18 5 Cat , 19 4 2045 , 20 4 1968 Atlantic hurricane season , 21 4 International Ice Hockey Federation , 22 4 Ryan Miller , 23 4 Jake Forbes , 24 4 Katie Weatherston , 25 4 Paul Bunyan

mar 2006: 1 35 Zacarias Moussaoui , 2 9 Mark , 3 7 Australian War Memorial , 4 7 Saku Koivu , 5 7 Paul Bunyan , 6 7 Hurricane Vince (2005) , 7 7 Jimmy Wales , 8 6 Ludwig Mies van der Rohe , 9 6 Germany , 10 6 Christianity , 11 6 United States , 12 6 Holocaust , 13 6 Cannabis , 14 6 Adolf Hitler , 15 6 Defense , 16 6 Copyright , 17 6 Farming , 18 5 Feral organism , 19 5 Science Museum (London) , 20 5 List of ice hockey leagues , 21 5 Pluto , 22 5 Spain , 23 5 Canada , 24 5 Eric Staal , 25 5 Cancer (constellation)

abr 2006: 1 43 Zacarias Moussaoui , 2 9 WWE Cruiserweight Championship , 3 8 Holocaust , 4 7 List of ice hockey leagues , 5 7 Saku Koivu , 6 7 Xbox , 7 6 Wade Redden , 8 6 Astrodome , 9 5 Australian War Memorial , 10 5 Ludwig Mies van der Rohe , 11 5 Airblue , 12 5 Central Canada Hockey League , 13 5 Alex Auld , 14 5 Paul Bunyan , 15 5 Hurricane Vince (2005) , 16 5 Christianity , 17 5 Cancer (constellation) , 18 5 Candidiasis , 19 5 Iraq , 20 5 Abortion , 21 5 Anus , 22 5 Hinduism , 23 4 Aylesford, Nova Scotia , 24 4 2050 , 25 4 2044

mai 2006: 1 124 Zacarias Moussaoui , 2 13 WWE Cruiserweight Championship , 3 13 Mark , 4 11 Ryan Miller , 5 10 Cancer (constellation) , 6 9 Earthworm , 7 8 Prostatitis , 8 8 Paul Bunyan , 9 8 Hurricane Vince (2005) , 10 7 Brown tree snake , 11 7 The Simpsons , 12 6 Canada , 13 6 Daemon (computer software) , 14 6 Wikipedia , 15 6 Holocaust , 16 6 Baseball , 17 5 United States , 18 5 Wade Redden , 19 5 Candidiasis , 20 5 Europa , 21 5 Wikispecies , 22 5 Deer , 23 5 Sherpa , 24 5 Great white shark , 25 5 Turtle

jun 2006: 1 11 Jordan Staal , 2 10 Eric Staal , 3 9 2026 , 4 8 Alex Auld , 5 7 Airblue , 6 7 Sexual intercourse , 7 6 2050 , 8 6 List of NHL players (A) , 9 6 Zacarias Moussaoui , 10 6 WWE Cruiserweight Championship , 11 6 Wade Redden , 12 5 List of NHL players (J) , 13 5 List of NHL players (C) , 14 5 Hurricane Vince (2005) , 15 5 Spain , 16 5 Daemon (computer software) , 17 5 Candidiasis , 18 5 Mark , 19 5 Astrodome , 20 5 Smallpox , 21 5 Gay , 22 5 Pythagoras , 23 4 Ludwig Mies van der Rohe , 24 4 List of NHL players (B) , 25 4 Lee Fogolin

jul 2006: 1 17 WWE Cruiserweight Championship , 2 10 Candidiasis , 3 10 Sex , 4 8 Mark , 5 7 Airblue , 6 7 Taylor Pyatt , 7 7 United States , 8 6 2026 , 9 6 List of Montreal Canadiens players , 10 6 Astrodome , 11 6 Jimmy Wales , 12 5 Saku Koivu , 13 5 Marc Staal , 14 5 Scott Young (ice hockey b. 1967) , 15 5 Domestic violence , 16 5 Wikipedia , 17 5 Feces , 18 5 Philippines , 19 4 2050 , 20 4 List of NHL players (A) , 21 4 Zacarias Moussaoui , 22 4 Ryan Miller , 23 4 Prostatitis , 24 4 Anton Babchuk , 25 4 Jared Staal

ago 2006: 1 13 Zacarias Moussaoui , 2 13 Astrodome , 3 13 African-American people , 4 12 Wikipedia , 5 12 Jimmy Wales , 6 10 Paul Bunyan , 7 9 Pornography , 8 9 Nigger , 9 8 Candidiasis , 10 8 Martin Luther King, Jr. , 11 7 Lesbian , 12 7 Taiwan , 13 6 Broughton, Nova Scotia , 14 6 Ludwig Mies van der Rohe , 15 6 List of ice hockey leagues , 16 6 Port Arthur Bearcats , 17 6 Pescara , 18 6 Dwarf planet , 19 6 Nucleophilic substitution , 20 6 Dick Cheney , 21 6 Homosexuality , 22 6 Planet , 23 5 Australian War Memorial , 24 5 List of Canadian painters , 25 5 List of Montreal Canadiens players

set 2006: 1 14 Lesbian , 2 11 Astrodome , 3 10 Ludwig Mies van der Rohe , 4 9 Zacarias Moussaoui , 5 9 Candidiasis , 6 9 Steve Irwin , 7 8 WWE Cruiserweight Championship , 8 8 Atheism , 9 7 Saku Koivu , 10 7 Paul Bunyan , 11 7 Spain , 12 7 Mark , 13 7 Hong Kong , 14 7 Terrorism , 15 6 Oleg Tverdovsky , 16 6 Pythagoras , 17 6 Philippines , 18 6 England , 19 5 Canada , 20 5 Cancer (constellation) , 21 5 Legacy , 22 5 Ubuntu , 23 5 Anthony Kiedis , 24 5 Unit circle , 25 5 Air gun

out 2006: 1 13 Candidiasis , 2 10 Wikipedia , 3 9 Ludwig Mies van der Rohe , 4 9 WWE Cruiserweight Championship , 5 8 Feral organism , 6 8 Gay , 7 8 Singapore , 8 8 Adolf Hitler , 9 7 Prostatitis , 10 6 William Shakespeare , 11 6 Greg Johnson , 12 6 Judaism , 13 6 Jesus , 14 6 Mark , 15 6 RuneScape , 16 6 The Beatles , 17 6 Cat , 18 5 List of Montreal Canadiens players , 19 5 Jordan Staal , 20 5 Paul Bunyan , 21 5 Islam , 22 5 Eric Staal , 23 5 Guy Carbonneau , 24 5 Daemon (computer software) , 25 5 Cancer (constellation)

nov 2006: 1 14 Paul Bunyan , 2 13 Mark , 3 10 WWE Cruiserweight Championship , 4 10 Mormonism , 5 9 Bill Gates , 6 9 Adolf Hitler , 7 8 Ludwig Mies van der Rohe , 8 8 Holocaust , 9 8 France , 10 7 United States , 11 7 Jesus , 12 7 Wikipedia , 13 7 Uruguay , 14 7 Fire , 15 6 Ryan Miller , 16 6 Death mask , 17 6 Saku Koivu , 18 6 Gábor Csupó , 19 6 Christianity , 20 6 Darth Vader , 21 6 Cult , 22 6 California Gold Rush , 23 6 Monkey , 24 6 Botswana , 25 6 Singapore

dez 2006: 1 13 Judaism , 2 12 WWE Cruiserweight Championship , 3 10 Mark , 4 9 Jesus , 5 9 Gerard Way , 6 9 Wiki , 7 8 Ludwig Mies van der Rohe , 8 8 Saku Koivu , 9 8 Alcohol , 10 7 Paul Bunyan , 11 7 Christianity , 12 7 Michael Jackson , 13 7 Charles Dickens , 14 7 Apple , 15 6 Allan Cup , 16 6 Cancer (constellation) , 17 6 Candidiasis , 18 6 Brown tree snake , 19 6 List of acronyms and initialisms , 20 6 George Michael , 21 6 Wikipedia , 22 6 Wii , 23 6 Holocaust , 24 6 Concentration camp , 25 6 The Holocaust

jan 2007: 1 13 Cancer (constellation) , 2 12 WWE Cruiserweight Championship , 3 11 Carey Price , 4 11 Candidiasis , 5 11 Mark , 6 10 Ludwig Mies van der Rohe , 7 10 Ryan Miller , 8 10 Paul Bunyan , 9 9 Astrodome , 10 7 United States , 11 7 Europa , 12 7 Apple Inc. , 13 6 Zacarias Moussaoui , 14 6 Alfred Sisley , 15 6 Saku Koivu , 16 6 Sexual intercourse , 17 6 Judaism , 18 6 50 Cent , 19 6 Anal sex , 20 6 Movie , 21 6 England , 22 6 Association football , 23 5 2050 , 24 5 Southern Professional Hockey League , 25 5 List of ice hockey leagues

fev 2007: 1 24 WWE Cruiserweight Championship , 2 15 Paul Bunyan , 3 12 United States , 4 12 September 11 attacks , 5 10 Candidiasis , 6 9 Jordan Staal , 7 9 Mark , 8 8 Spain , 9 8 Astrodome , 10 8 Cannabis , 11 8 Global warming , 12 7 World War II , 13 7 Cancer (constellation) , 14 7 Hillary Rodham Clinton , 15 7 France , 16 6 List of Canadian painters , 17 6 List of Detroit Red Wings players , 18 6 Ryan Miller , 19 6 Eric Staal , 20 6 Daemon (computer software) , 21 6 Michael Jackson , 22 6 Napoléon Bonaparte , 23 6 George Washington , 24 6 Vietnam War , 25 6 Terrorism

mar 2007: 1 15 Jordan Staal , 2 12 Paul Bunyan , 3 12 Cancer (constellation) , 4 12 Mark , 5 10 Saku Koivu , 6 9 Emergency medical services in the United Kingdom , 7 8 Spain , 8 8 Global warming , 9 8 American Civil War , 10 8 Google , 11 7 2050 , 12 7 WWE Cruiserweight Championship , 13 7 United States , 14 7 Car , 15 7 Candidiasis , 16 6 List of NHL players (B) , 17 6 Eric Staal , 18 6 Astrodome , 19 6 Cannabis , 20 6 Death penalty , 21 6 Middle Ages , 22 6 Abraham Lincoln , 23 6 The Holocaust , 24 6 Alcohol , 25 6 Buddhism

abr 2007: 1 12 Ryan Miller , 2 11 Mark , 3 9 Paul Bunyan , 4 7 Saku Koivu , 5 7 HC Dynamo Moscow , 6 7 WWE Cruiserweight Championship , 7 7 World War II , 8 7 Canada , 9 7 Astrodome , 10 7 Amazon rainforest , 11 7 Engineering , 12 7 God , 13 6 2050 , 14 6 Ludwig Mies van der Rohe , 15 6 Jordan Staal , 16 6 Islam , 17 6 United States , 18 6 Cancer (constellation) , 19 6 Little Red Riding Hood , 20 6 Abraham Lincoln , 21 6 Alcohol , 22 6 Egypt , 23 5 List of NHL players (B) , 24 5 List of ice hockey leagues , 25 5 Christianity

mai 2007: 1 14 List of Wikipedias , 2 14 Ryan Miller , 3 12 Mark , 4 11 Saku Koivu , 5 10 Islam , 6 9 Ludwig Mies van der Rohe , 7 9 Paul Bunyan , 8 9 Eric Staal , 9 8 William Shakespeare , 10 8 Taylor Pyatt , 11 8 Jordan Staal , 12 8 Wade Redden , 13 8 Candidiasis , 14 7 List of ice hockey leagues , 15 7 Sexual intercourse , 16 7 Brown tree snake , 17 7 Manchester United F.C. , 18 6 WWE Cruiserweight Championship , 19 6 World War II , 20 6 Car , 21 6 Dingo , 22 6 Rocky Marciano , 23 6 Monkey , 24 6 Rape , 25 6 Grey wolf

jun 2007: 1 15 Mark , 2 11 Frieza , 3 11 Zarbon , 4 10 Dodoria , 5 10 My Chemical Romance , 6 9 Bear , 7 9 Penis , 8 8 List of Wikipedias , 9 8 WWE Cruiserweight Championship , 10 8 Vince McMahon , 11 7 Ludwig Mies van der Rohe , 12 7 RuneScape , 13 7 Justin Timberlake , 14 6 List of NHL players (J) , 15 6 Alex Plante , 16 6 Saku Koivu , 17 6 Sexual intercourse , 18 6 Paul Bunyan , 19 6 Christianity , 20 6 Judaism , 21 6 Carey Price , 22 6 Candidiasis , 23 6 Giant panda , 24 6 Anal sex , 25 6 Cannabis

jul 2007: 1 27 WWE Cruiserweight Championship , 2 9 Main Page , 3 9 Harry Potter , 4 8 List of Wikipedias , 5 8 Zacarias Moussaoui , 6 8 Eric Staal , 7 8 M×0 , 8 8 D.Gray-man , 9 7 Daemon (computer software) , 10 7 Candidiasis , 11 6 List of NHL players (B) , 12 6 Paul Bunyan , 13 6 I'm with You , 14 6 Harry Potter and the Deathly Hallows , 15 6 Evolution , 16 6 Dog , 17 5 Quebec Bulldogs , 18 5 Avril Lavigne , 19 5 Nicky Hilton , 20 5 Miss World , 21 5 Donald Trump , 22 5 Yamaha Corporation , 23 5 Takao , 24 5 Bleach (manga) , 25 5 Lily Allen

ago 2007: 1 12 WWE Cruiserweight Championship , 2 9 Sexual intercourse , 3 8 Periwinkle (color) , 4 8 Main Page/Test 1 , 5 8 50 Cent , 6 8 Chopsticks , 7 7 List of Wikipedias , 8 7 Main Page , 9 7 A minor , 10 7 Mark , 11 7 BBC Radio 1Xtra , 12 7 Hanami , 13 7 Jimi Hendrix , 14 7 India , 15 6 Airblue , 16 6 Zacarias Moussaoui , 17 6 First Time , 18 6 Candidiasis , 19 6 BBC Radio 5 Live Sports Extra , 20 6 American Staffordshire Terrier , 21 6 Intelligent design , 22 6 Names for large numbers , 23 6 Little Red Riding Hood , 24 6 Ho Chi Minh , 25 6 The Simpsons

set 2007: 1 20 WWE Cruiserweight Championship , 2 13 Mark , 3 12 Paul Bunyan , 4 8 Brown tree snake , 5 8 Evolution , 6 7 List of Wikipedias , 7 7 United States , 8 7 Edgar Atheling , 9 7 Catholicism , 10 7 Encyclopedia , 11 6 Feral organism , 12 6 Candidiasis , 13 6 Copyright infringement of software , 14 6 Kitzmiller, et al. v. Dover Area School District, et al. , 15 6 Crusade , 16 5 William Shakespeare , 17 5 Main Page , 18 5 Christianity , 19 5 Car , 20 5 Paneuropean Picnic , 21 5 Cuban Missile Crisis , 22 5 Lysergic acid diethylamide , 23 5 United States Constitution , 24 5 John Howard , 25 5 Dominican Republic

out 2007: 1 11 Candidiasis , 2 9 WWE Cruiserweight Championship , 3 9 United States , 4 9 Mark , 5 8 Paul Bunyan , 6 8 Carey Price , 7 8 Justin Timberlake , 8 8 Global warming , 9 7 Saku Koivu , 10 7 Very High Bitrate Digital Subscriber Line , 11 7 Wikipedia , 12 6 World War II , 13 6 Germany , 14 6 Judaism , 15 6 Northern League (baseball) , 16 6 School , 17 6 Arab people , 18 6 Great Depression , 19 6 Warcraft , 20 6 PlayStation 3 , 21 6 Edgar Allan Poe , 22 6 Caffeine , 23 6 George Washington , 24 6 Dog , 25 6 Cat

nov 2007: 1 11 Paul Bunyan , 2 11 Sandy Robson , 3 9 Carey Price , 4 9 Australia , 5 8 Saku Koivu , 6 8 Candidiasis , 7 8 Brown tree snake , 8 8 Thanksgiving , 9 8 Apple , 10 7 United States , 11 7 Mark , 12 7 Kevin Rudd , 13 7 Chiara Zanni , 14 7 Cristiano Ronaldo , 15 7 Nuclear power , 16 7 Penis , 17 6 Jordan Staal , 18 6 Islam , 19 6 School , 20 6 Chuck Norris , 21 6 Alan Carr , 22 6 Elizabeth I of England , 23 6 Cloud , 24 6 Galileo Galilei , 25 6 Association football

dez 2007: 1 10 Ludwig Mies van der Rohe , 2 8 Paul Bunyan , 3 8 World War II , 4 8 United States , 5 8 Sari , 6 8 Xbox 360 , 7 7 Ryan Miller , 8 7 Chuck Norris facts , 9 7 Warhammer 40,000 , 10 7 Jimi Hendrix , 11 7 Pokémon (video game series) , 12 7 Muhammad , 13 7 Nazism , 14 7 Global warming , 15 6 Division of Ballarat , 16 6 Eric Staal , 17 6 The Queen Vic , 18 6 Radwimps , 19 6 Brett Lee , 20 6 Diplodocus , 21 6 Tourette syndrome , 22 6 United States Declaration of Independence , 23 6 Christmas , 24 6 Foot , 25 5 Airblue

jan 2008: 1 16 Paul Bunyan , 2 11 William Shakespeare , 3 9 United States , 4 8 Jesus , 5 8 Britney Spears , 6 8 Alcohol , 7 7 Ludwig Mies van der Rohe , 8 7 Ryan Miller , 9 7 Calvin Harris , 10 7 RuneScape , 11 7 Newbie , 12 7 Bono , 13 7 Evolution , 14 7 Italy , 15 6 Saku Koivu , 16 6 Car , 17 6 Eric Staal , 18 6 Mark , 19 6 Romeo + Juliet , 20 6 Moulin Rouge! , 21 6 Group 0 , 22 6 Mean Girls , 23 6 Static RAM , 24 6 Cuban Missile Crisis , 25 6 Robot

fev 2008: 1 16 United States , 2 14 Jesus , 3 13 Mark , 4 12 Carey Price , 5 11 Islam , 6 9 Paul Bunyan , 7 9 Moulin Rouge! , 8 9 RuneScape , 9 9 Prostitution , 10 8 List of ice hockey leagues , 11 8 Ryan Miller , 12 8 Jordan Staal , 13 8 World War I , 14 8 Simple English Wikipedia , 15 8 Coffee , 16 7 Glen Hanlon , 17 7 Eric Staal , 18 7 Carbon footprint , 19 7 Plain White T's , 20 7 Kosovo , 21 7 Pipe organ , 22 7 Volcano , 23 7 Adolf Hitler , 24 7 Buddhism , 25 7 Government

mar 2008: 1 12 Carey Price , 2 12 Mark , 3 10 Paul Bunyan , 4 9 Ludwig Mies van der Rohe , 5 9 World War I , 6 9 IPod , 7 8 List of Wikipedias , 8 8 Zacarias Moussaoui , 9 8 List of ice hockey leagues , 10 8 Ryan Miller , 11 8 United States , 12 8 Classical Athens , 13 8 Gorilla , 14 7 Germany , 15 7 Islam , 16 7 Canada , 17 7 Proxy server , 18 7 Newbie , 19 7 United Kingdom , 20 7 Tree , 21 6 William Shakespeare , 22 6 Saku Koivu , 23 6 Wade Redden , 24 6 Hannah Montana , 25 6 Chris Benoit

abr 2008: 1 16 Kontinental Hockey League , 2 13 Mark , 3 12 Carey Price , 4 10 Newbie , 5 9 William Shakespeare , 6 8 Jesus , 7 8 IRCd , 8 7 Saku Koivu , 9 7 United States , 10 7 Cancer (constellation) , 11 7 Gandhi (band) , 12 7 Baseball , 13 7 Poland , 14 7 Earthquake , 15 7 Association football , 16 7 God , 17 6 List of Wikipedias , 18 6 List of ice hockey leagues , 19 6 Jordan Staal , 20 6 Paul Bunyan , 21 6 Billy Graham , 22 6 Halo 3 , 23 6 Indiana Jones and the Kingdom of the Crystal Skull , 24 6 Seedling , 25 6 Transcendental Meditation

mai 2008: 1 15 Carey Price , 2 13 Dog , 3 11 Ludwig Mies van der Rohe , 4 10 Jordan Staal , 5 10 Paul Bunyan , 6 10 World War I , 7 10 United States , 8 10 Animal Farm , 9 9 Kontinental Hockey League , 10 8 Old Major (Animal Farm) , 11 8 Giant panda , 12 8 Michael Jackson , 13 7 Americas , 14 7 Billy Graham , 15 7 Guy Carbonneau , 16 7 Cancer (constellation) , 17 7 OGame , 18 7 Boxer (Animal Farm) , 19 7 Cuban Missile Crisis , 20 7 World history , 21 7 Pornography , 22 7 George Washington , 23 7 Buddhism , 24 6 Tunisair , 25 6 Saku Koivu

jun 2008: 1 12 Paul Bunyan , 2 10 William Shakespeare , 3 9 Baseball uniform , 4 8 Islam , 5 8 High School Musical 3: Senior Year , 6 8 Charles Spurgeon , 7 8 Cheese , 8 7 Kontinental Hockey League , 9 7 United States , 10 7 Carey Price , 11 7 Ana Ivanović , 12 7 Parental advisory , 13 7 Rubik's Cube , 14 7 England , 15 7 LOL , 16 6 Germany , 17 6 Daemon (computer software) , 18 6 Mark , 19 6 Naas , 20 6 Get Smart , 21 6 She , 22 6 Mysticeti , 23 6 Kudu , 24 6 Polar bear , 25 6 PlayStation 3

jul 2008: 1 19 Kontinental Hockey League , 2 14 Jessica Alba , 3 11 Powderfinger , 4 10 Wade Redden , 5 9 Baseball uniform , 6 8 List of Canadian painters , 7 8 Daniela Hantuchová , 8 8 American Airlines Flight 11 , 9 8 Scottish Premier League , 10 8 Chess , 11 7 Alex Auld , 12 7 Langston University , 13 7 Paul Bunyan , 14 7 Main Page/Introduction , 15 7 Charles Spurgeon , 16 7 Mass Rapid Transit (Singapore) , 17 7 NASA , 18 7 Gun , 19 6 Ryan Johnson , 20 6 Arup , 21 6 Mark , 22 6 Wicca rock , 23 6 Andre Agassi , 24 6 WWE The Great American Bash , 25 6 Chris Parks

ago 2008: 1 11 Hurricane Vince (2005) , 2 11 Powderfinger , 3 11 2008 Summer Olympics , 4 10 Evolution , 5 10 Charles Darwin , 6 9 Kontinental Hockey League , 7 9 Sarah Palin , 8 8 List of Canadian painters , 9 8 Jesus , 10 8 Homeopathy , 11 8 Simple English Wikipedia , 12 8 Neopets , 13 8 Human , 14 7 Main Page , 15 7 Gumby , 16 7 Charlotte's Web (1973 movie) , 17 7 2008 South Ossetia war , 18 7 Main Page/Introduction , 19 7 Mass Rapid Transit (Singapore) , 20 7 RAID , 21 7 Gene , 22 7 Jupiter , 23 6 Airblue , 24 6 Daniel Tosh , 25 6 Flat Earth

set 2008: 1 17 Kontinental Hockey League , 2 11 Sarah Palin , 3 9 Saku Koivu , 4 9 Rick Riordan , 5 9 Main Page , 6 9 Dipsy , 7 8 Oklahoma , 8 8 Green Day , 9 7 Australian War Memorial , 10 7 2050 , 11 7 Science Museum (London) , 12 7 Whitey Wistert , 13 7 Laa-Laa , 14 7 Po (Teletubby) , 15 7 Paul Newman , 16 7 RAID , 17 7 Big Bang , 18 7 Dog , 19 6 Jesus , 20 6 Halo 3 , 21 6 Cell , 22 6 Brother Bear 2 , 23 6 Iranian coup d'etat (1953) , 24 6 Sniper , 25 6 Baseball uniform

out 2008: 1 18 Paul Bunyan , 2 10 List of Canadian painters , 3 10 Kontinental Hockey League , 4 10 Saku Koivu , 5 10 Sligo Rovers F.C. , 6 9 Main Page , 7 9 Halo 3 , 8 9 Sniper , 9 8 Rick Riordan , 10 8 Jonas Brothers , 11 8 Jimi Hendrix , 12 8 Pornography , 13 7 Mark , 14 7 Bambi , 15 7 Seismic retrofit , 16 7 Paris , 17 6 Ludwig Mies van der Rohe , 18 6 United States , 19 6 Wade Redden , 20 6 Cancer (constellation) , 21 6 Derrick Pierce , 22 6 Mathew Turner , 23 6 Victory , 24 6 Jörg Haider , 25 6 RuneScape

nov 2008: 1 20 Barack Obama , 2 13 Mark , 3 12 Bop It , 4 10 Hot chocolate , 5 9 Airblue , 6 8 List of Canadian painters , 7 8 Paul Bunyan , 8 8 Manchester , 9 8 Penis , 10 7 United States , 11 7 November 2008 Mumbai attacks , 12 7 Phetchabun , 13 7 Giant panda , 14 7 Nudity , 15 7 France , 16 6 Australian War Memorial , 17 6 Kontinental Hockey League , 18 6 Saku Koivu , 19 6 Rick Riordan , 20 6 Main Page , 21 6 Miley Cyrus , 22 6 Cancer (constellation) , 23 6 Trang , 24 6 Crich Tramway Village , 25 6 Halo 3

dez 2008: 1 11 Paul Bunyan , 2 10 Kontinental Hockey League , 3 10 Penis , 4 9 Ludwig Mies van der Rohe , 5 9 Santa Claus , 6 8 Barack Obama , 7 8 Headset , 8 8 George W. Bush , 9 7 Thermocouple , 10 7 Supercomputer , 11 7 MRI , 12 7 Blackpool tramway , 13 7 Joseph Stalin , 14 6 Rick Riordan , 15 6 Main Page , 16 6 United States , 17 6 Mark , 18 6 Static electricity , 19 6 Standard-definition television , 20 6 Hydrogen car , 21 6 South Thailand insurgency , 22 6 Airbag , 23 6 Adolf Hitler , 24 5 Septicemic plague , 25 5 Car

jan 2009: 1 13 Barack Obama , 2 12 Kontinental Hockey League , 3 12 Paul Bunyan , 4 9 United States , 5 9 Daniela Hantuchová , 6 8 World War II , 7 8 Nudity , 8 8 Joseph Stalin , 9 8 Adolf Hitler , 10 8 George W. Bush , 11 8 Romania , 12 7 Ludwig Mies van der Rohe , 13 7 Sexual intercourse , 14 7 Encyclopedia Dramatica , 15 7 Feces , 16 7 Japan , 17 6 Periwinkle (color) , 18 6 Jordan Staal , 19 6 Harry Potter , 20 6 Jesus , 21 6 Mydoom , 22 6 Phosgene , 23 6 Avril Lavigne , 24 6 Aer language , 25 6 Curitiba

fev 2009: 1 20 Barack Obama , 2 17 WrestleMania XXVI , 3 15 Wikipedia , 4 14 Sexual intercourse , 5 14 List of colors , 6 13 Paul Bunyan , 7 12 Car , 8 12 Sniper , 9 10 Grand Olympic Auditorium , 10 10 Large Hadron Collider , 11 9 Swahili Wikipedia , 12 9 Penis , 13 9 George W. Bush , 14 9 Dog , 15 9 Mathematics , 16 9 Internet , 17 8 Jesus , 18 8 Baseball uniform , 19 8 Anna Kournikova , 20 8 New York City , 21 7 William Shakespeare , 22 7 Christianity , 23 7 Bop It , 24 7 Simple English Wikipedia , 25 7 Jew

mar 2009: 1 18 Barack Obama , 2 17 WrestleMania XXVI , 3 17 Jimmy Wales , 4 15 Guy Carbonneau , 5 12 Wikipedia , 6 11 Hermann Göring , 7 11 Cheese , 8 9 United States , 9 9 Bop It , 10 9 Large Hadron Collider , 11 9 Message (computer science) , 12 9 Computer , 13 8 Color of the day (police) , 14 8 Snow White and the Seven Dwarfs (1937 movie) , 15 8 Crich Tramway Village , 16 8 Ben Hall , 17 8 Pope John Paul II , 18 8 Cat , 19 8 Internet , 20 7 Ryan Miller , 21 7 Sexual intercourse , 22 7 Jesus , 23 7 Car , 24 7 Walt Poddubny , 25 7 Autofellatio

abr 2009: 1 14 Color blindness , 2 13 George W. Bush , 3 12 WrestleMania XXVI , 4 12 Mosque , 5 11 Barack Obama , 6 9 World War I , 7 9 Swine influenza , 8 9 Ernst Röhm , 9 9 Wikipedia , 10 9 Cat , 11 8 Paul Bunyan , 12 8 United States , 13 8 Battle of Gettysburg , 14 8 Asshole , 15 8 Cuban Missile Crisis , 16 8 Refrigerator , 17 8 Pope John Paul II , 18 7 Taylor Pyatt , 19 7 Jordan Staal , 20 7 Rick Riordan , 21 7 World War II , 22 7 Hannah Montana , 23 7 Dave Thomas , 24 7 AIDS , 25 7 Epilepsy

mai 2009: 1 13 Paul Bunyan , 2 12 Eric Staal , 3 12 Cheese , 4 11 Darius Danesh , 5 11 Teletubbies , 6 10 Adolf Hitler , 7 9 Hurricane Ismael , 8 9 Jonas Brothers , 9 9 Mormonism , 10 9 Leonardo da Vinci , 11 9 Star , 12 9 Internet , 13 8 Australian War Memorial , 14 8 World War I , 15 8 Swine influenza , 16 8 Simple English Wikipedia , 17 8 Down syndrome , 18 8 Cat , 19 7 International Ice Hockey Federation , 20 7 Rick Riordan , 21 7 Jesus , 22 7 Huang Xianfan , 23 7 Wikipedia , 24 7 George W. Bush , 25 7 Black hole

jun 2009: 1 27 Michael Jackson , 2 11 Earth , 3 10 Australian War Memorial , 4 8 Daniel Tosh , 5 7 2009–10 NHL season , 6 7 Sexual intercourse , 7 7 London Underground 1967 tube stock , 8 7 Simple English Wikipedia , 9 7 Wikipedia , 10 7 Jessica Alba , 11 7 Dog , 12 7 Cheese , 13 6 List of ice hockey leagues , 14 6 Jordan Staal , 15 6 World War II , 16 6 United States , 17 6 The Wave 96.4 FM , 18 6 Foot binding , 19 6 Bubble tea , 20 6 WrestleMania XXVI , 21 6 Ghana , 22 6 Ludwig van Beethoven , 23 5 William Shakespeare , 24 5 Car , 25 5 Wood Street railway station

jul 2009: 1 13 Italy , 2 12 2009–10 NHL season , 3 12 Michael Jackson , 4 10 Saku Koivu , 5 10 Jupiter , 6 8 Daniel Tosh , 7 8 Wernher von Braun , 8 8 Earth , 9 7 United States , 10 7 Victoria line , 11 7 WrestleMania XXVI , 12 7 Jimmy Wales , 13 7 Woodrow Wilson , 14 7 Chat , 15 6 List of Wikipedias , 16 6 Sexual intercourse , 17 6 Wikipedia , 18 6 Sex , 19 5 Ludwig Mies van der Rohe , 20 5 List of ice hockey leagues , 21 5 Basic English , 22 5 Adobe Reader , 23 5 Buffalo , 24 5 Hinglaj Mata , 25 5 University of Balochistan

ago 2009: 1 20 List of 20th Century Fox movies , 2 15 India , 3 12 Earth , 4 10 Abraham Lincoln , 5 9 Ludwig Mies van der Rohe , 6 9 WrestleMania XXVI , 7 9 Wikipedia , 8 8 MissingNo. , 9 8 2009 Atlantic hurricane season , 10 8 Philippines , 11 8 God , 12 7 Daniel Tosh , 13 7 Essjay controversy , 14 7 Joe Biden , 15 7 20th Century Fox , 16 6 Australian War Memorial , 17 6 2009–10 NHL season , 18 6 Jesse Helms , 19 6 Victoria line , 20 6 Hemis National Park , 21 6 1492 Pictures , 22 6 Cannabis , 23 6 Michael Jackson , 24 6 Water cycle , 25 5 List of Canadian painters

set 2009: 1 14 Michael Jackson , 2 13 Paul Bunyan , 3 12 Bella Thorne , 4 11 Barack Obama , 5 10 Jupiter , 6 9 List of Wikipedias , 7 9 Rick Riordan , 8 9 WrestleMania XXVI , 9 9 Evolution , 10 8 2009–10 NHL season , 11 8 Leonese language , 12 8 Joe Biden , 13 8 Adolf Hitler , 14 7 Australian War Memorial , 15 7 List of bridges to the Island of Montreal , 16 7 Siege of Fort Zeelandia , 17 7 Linkin Park , 18 7 Atheism , 19 7 France , 20 6 Dave Pasch , 21 6 Anton Babchuk , 22 6 World War I , 23 6 Viking , 24 6 Race (sociology) , 25 6 Napoleon II of France

out 2009: 1 17 2009–10 NHL season , 2 12 Paul Bunyan , 3 11 Wikipedia , 4 10 Daniel Tosh , 5 9 Barack Obama , 6 8 Bella Thorne , 7 8 World War I , 8 8 Norwegian Nobel Committee , 9 8 Justin Bieber , 10 8 Moon landing conspiracy theory , 11 8 Martin Luther King, Jr. , 12 7 Sexual intercourse , 13 7 United States , 14 7 Bukit Timah , 15 7 WrestleMania XXVI , 16 7 Manchester , 17 7 Illegal drugs , 18 7 Hyderabad, India , 19 7 Michael Jackson , 20 7 Kurt Cobain , 21 6 List of Wikipedias , 22 6 Harry Potter , 23 6 United States Declaration of Independence , 24 6 Horse , 25 6 Alexander Graham Bell

nov 2009: 1 33 Jimmy Wales , 2 12 Jesus , 3 12 Michael Jackson , 4 11 Daniel Tosh , 5 11 Lady Gaga , 6 10 Barack Obama , 7 10 WrestleMania XXVI , 8 10 Illegal drugs , 9 10 Pie , 10 9 Ludwig Mies van der Rohe , 11 9 Dog , 12 8 Simple English Wikipedia , 13 8 Robert Enke , 14 8 Christopher Columbus , 15 8 Cat , 16 8 Australia , 17 7 Miley Cyrus , 18 7 Twilight (series) , 19 7 Baby , 20 7 2012 , 21 7 Global warming , 22 7 Manchester United F.C. , 23 6 List of Wikipedias , 24 6 Zacarias Moussaoui , 25 6 Kontinental Hockey League

dez 2009: 1 17 Rick Riordan , 2 16 WrestleMania XXVI , 3 12 Paul Bunyan , 4 9 Justin Bieber , 5 8 Christmas , 6 7 William Shakespeare , 7 7 Akmal Shaikh , 8 7 Tiger Woods , 9 7 List of Universal Pictures movies , 10 7 List of Disney animated movies , 11 7 Brittany Murphy , 12 7 Edgar Allan Poe , 13 7 Seismic retrofit , 14 6 Kijiji , 15 6 Judaism , 16 6 Catherine Morland , 17 6 Northanger Abbey , 18 6 Sujebi , 19 6 Gwar , 20 6 Eddie Fatu , 21 6 The Fox and the Hound , 22 6 Twilight (series) , 23 6 Newbie , 24 6 Evolution , 25 6 Cat

jan 2010: 1 15 Rick Riordan , 2 12 Federal Hockey League , 3 11 Daniel Tosh , 4 11 WrestleMania XXVI , 5 10 Justin Bieber , 6 10 Jonas Brothers , 7 10 Dominican Republic , 8 10 Adolf Hitler , 9 10 Dog , 10 10 Elizabeth II , 11 9 Barack Obama , 12 9 The Brothers Karamazov , 13 9 World War I , 14 9 Ana Ivanović , 15 9 Death of Tina Watson , 16 9 Sun , 17 8 Paul Bunyan , 18 8 7 Seconds , 19 8 2010 Haiti earthquake , 20 8 Bird nest , 21 8 Miley Cyrus , 22 8 Nigger , 23 7 List of Wikipedias , 24 7 Lady Gaga , 25 7 Medical Renaissance

fev 2010: 1 33 Ryan Miller , 2 18 Rick Riordan , 3 15 Daniel Tosh , 4 13 Ghost , 5 12 Justin Bieber , 6 10 Oxford, Nova Scotia , 7 10 2009–10 NHL season , 8 10 Wank , 9 9 World War I , 10 9 Lawn , 11 9 Toilet , 12 9 Abraham Lincoln , 13 9 Chess , 14 8 North Kosovo , 15 8 Miley Cyrus , 16 8 Demon , 17 8 Desert , 18 8 Michael Jackson , 19 8 Dog , 20 8 Elizabeth II , 21 7 Bella Thorne , 22 7 Lady Gaga , 23 7 List of surviving veterans of World War I , 24 6 Kontinental Hockey League , 25 6 Sexual intercourse

mar 2010: 1 18 Ryan Miller , 2 17 2009–10 NHL season , 3 13 Chess , 4 12 Saku Koivu , 5 12 Daniel Tosh , 6 12 Justin Bieber , 7 10 Jew , 8 10 Fascism , 9 10 Global warming , 10 10 George Washington , 11 9 Paul Bunyan , 12 9 Davy Crockett , 13 9 Barack Obama , 14 9 Illegal drugs , 15 9 Computer , 16 8 William Shakespeare , 17 8 Faggot , 18 8 Lady Gaga , 19 8 World War II , 20 8 United States , 21 8 Jesus , 22 8 United States Constitution , 23 8 Wikipedia , 24 8 Renaissance , 25 8 Michael Jackson

abr 2010: 1 36 2009–10 NHL season , 2 22 2010 Stanley Cup playoffs , 3 14 Ryan Miller , 4 11 Justin Bieber , 5 11 Riaz Ahmed Gohar Shahi , 6 10 Daniel Tosh , 7 10 Moon landing conspiracy theory , 8 9 Josip Broz Tito , 9 9 Napoleon , 10 9 Chess , 11 8 Car , 12 8 Martin Luther King, Jr. , 13 7 List of Wikipedias , 14 7 William Shakespeare , 15 7 Arctic fox , 16 7 Eugène Terre'Blanche , 17 7 Pokémon , 18 7 Solar energy , 19 7 Lech Kaczyński , 20 7 John Adams , 21 7 George W. Bush , 22 7 God , 23 7 Australia , 24 6 Kijiji , 25 6 Jordan Staal

mai 2010: 1 15 Justin Bieber , 2 12 Wikipedia , 3 11 Simple English Wikipedia , 4 10 Daniel Tosh , 5 9 The Lion King II: Simba's Pride , 6 9 Josip Broz Tito , 7 8 Michael Howe (bushranger) , 8 8 Jimmy Wales , 9 7 Bella Thorne , 10 7 World War I , 11 7 Car , 12 7 Vietnam War , 13 7 Penis , 14 7 Chess , 15 7 Blood , 16 7 Japan , 17 7 God , 18 6 Central Canada Hockey League , 19 6 Federal Hockey League , 20 6 World War II , 21 6 City of Manchester Stadium , 22 6 Pokémon , 23 6 Albatross , 24 6 Newton's laws of motion , 25 6 Muhammad

jun 2010: 1 12 Bella Thorne , 2 12 Justin Bieber , 3 12 2010 FIFA World Cup , 4 11 Simple English Wikipedia , 5 9 Ryan Miller , 6 9 Gaza flotilla raid , 7 9 Al Jackson Jr , 8 8 Chatroulette , 9 8 IPad , 10 8 Car , 11 7 Pithole, Pennsylvania , 12 7 World War II , 13 7 Wikipedia , 14 7 Apple Inc. , 15 7 Computer , 16 6 Airblue , 17 6 Sexual intercourse , 18 6 LeBron James , 19 6 IPhone , 20 6 E-book , 21 6 YouTube , 22 6 AIDS , 23 6 Love , 24 6 Vampire , 25 6 Trojan War

jul 2010: 1 25 Airblue , 2 15 Justin Bieber , 3 11 Twilight (series) , 4 10 Daniel Tosh , 5 10 2010 FIFA World Cup , 6 9 Bella Thorne , 7 9 Suraj Narredu , 8 7 Epic Movie , 9 7 Miley Cyrus , 10 7 Jew , 11 7 Elizabeth II , 12 6 Ludwig Mies van der Rohe , 13 6 Kontinental Hockey League , 14 6 Ice algae , 15 6 Perpetual motion , 16 6 Gettysburg Address , 17 6 Mario , 18 6 Bible , 19 5 Geyser , 20 5 Alex Auld , 21 5 Islam , 22 5 John 3:16 , 23 5 Nike, Inc. , 24 5 YouTube , 25 5 Staff (stick)

ago 2010: 1 16 Bella Thorne , 2 11 France , 3 10 Aang , 4 8 Future of the Earth , 5 8 The Lightning Thief , 6 8 History of the United States , 7 7 The Fox and the Hound , 8 7 Pinniped , 9 7 The Pilgrim's Progress , 10 7 Triangle , 11 6 Reggie Jackson , 12 6 Daniel Tosh , 13 6 Tosh.0 , 14 6 Justin Bieber , 15 6 Hot dog , 16 6 Bill Clinton , 17 6 September 11 attacks , 18 5 Angela Fong , 19 5 Kontinental Hockey League , 20 5 Kijiji , 21 5 Fiat 500 , 22 5 Darren Young (wrestler) , 23 5 Junior Seau , 24 5 Molde FK , 25 5 Avatar: The Last Airbender (season 1)

set 2010: 1 10 Bella Thorne , 2 10 Simple English Wikipedia , 3 9 Dog , 4 8 Isaac Newton , 5 7 Feral organism , 6 7 Tosh.0 , 7 7 The Church of Jesus Christ of Latter-day Saints , 8 7 Augusto Pinochet , 9 7 Penis , 10 6 List of Wikipedias , 11 6 Angela Fong , 12 6 Hannibal Alkhas , 13 6 Yogi Bear , 14 6 Christianity , 15 6 Asperger syndrome , 16 6 History of the United States , 17 6 Adenoidectomy , 18 6 Gay , 19 6 Abraham Lincoln , 20 5 William Shakespeare , 21 5 Alfred Sisley , 22 5 Meg Whitman , 23 5 William Langland , 24 5 2010 Canterbury earthquake , 25 5 Faggot

out 2010: 1 11 Bella Thorne , 2 10 History of the United States , 3 9 Daniel Tosh , 4 8 Tosh.0 , 5 8 Néstor Kirchner , 6 7 2026 , 7 7 Conservatives in the United States , 8 7 Billy Graham , 9 7 Bald Eagle , 10 6 2010 Copiapó mining accident , 11 6 Judaism , 12 6 Islam , 13 6 Food web , 14 6 Simple English Wikipedia , 15 6 Cubism , 16 6 Renaissance , 17 6 Berlin Wall , 18 6 United States Declaration of Independence , 19 6 Martin Luther King, Jr. , 20 5 Connie Madigan , 21 5 Woolsthorpe-by-Colsterworth , 22 5 Weak acid , 23 5 Liu Xiaobo , 24 5 James Naismith , 25 5 Japanese American internment

nov 2010: 1 10 Bella Thorne , 2 10 History of the United States , 3 10 Adolf Hitler , 4 8 List of Wikipedias , 5 8 Anton Babchuk , 6 8 Tosh.0 , 7 8 World War I , 8 8 Grand Duchess Anastasia Nikolaevna of Russia , 9 7 Conservatives in the United States , 10 7 United States , 11 6 Pithole, Pennsylvania , 12 6 Wandering Albatross , 13 6 World War II , 14 6 Human rights , 15 6 Michael Jackson , 16 6 Love , 17 6 Dog , 18 6 Cat , 19 5 Villain , 20 5 Daniel Tosh , 21 5 Christianity , 22 5 Canada , 23 5 Medieval music , 24 5 Charlie Chaplin , 25 5 Vaccination

dez 2010: 1 11 Shrek , 2 10 WikiLeaks , 3 10 Grand Duchess Anastasia Nikolaevna of Russia , 4 10 Adolf Hitler , 5 8 Tosh.0 , 6 8 Singapore , 7 8 George W. Bush , 8 8 Mahatma Gandhi , 9 7 Bella Thorne , 10 7 Conservatives in the United States , 11 7 Deaths in 2010 , 12 6 Islam , 13 6 Miley Cyrus , 14 6 Aristotle , 15 5 Denis Napthine , 16 5 2026 , 17 5 List of current Canadian first ministers , 18 5 Periwinkle (color) , 19 5 2011 in sports , 20 5 Radio drama , 21 5 Shuzo Matsuoka , 22 5 Julian Assange , 23 5 Kanda University of International Studies , 24 5 Lifeboat , 25 5 Lotte Giants

jan 2011: 1 14 Lightning Bar , 2 10 William Shakespeare , 3 10 2011 in sports , 4 9 Tosh.0 , 5 9 Wikipedia , 6 8 2026 , 7 8 Deaths in 2011 , 8 8 Miley Cyrus , 9 8 Simple English Wikipedia , 10 8 George Washington , 11 7 Judaism , 12 7 United States , 13 7 Racism , 14 7 Obesity , 15 7 Computer virus , 16 7 Adolf Hitler , 17 7 Russia , 18 6 United States Constitution , 19 6 2011 , 20 6 List of Greek gods and goddesses , 21 6 Human rights , 22 6 50 Cent , 23 6 Anus , 24 6 The Walt Disney Company , 25 6 Romeo and Juliet

fev 2011: 1 13 WrestleMania XXVIII , 2 11 2011 in sports , 3 10 Justin Bieber , 4 10 List of Greek gods and goddesses , 5 10 Thomas Edison , 6 10 Snow , 7 10 Albert Einstein , 8 8 Bella Thorne , 9 8 Car , 10 8 Henry VIII of England , 11 8 Martin Luther King, Jr. , 12 7 2011 Egyptian revolution , 13 7 Lady Gaga , 14 7 Human rights , 15 7 Abraham Lincoln , 16 7 Adolf Hitler , 17 6 2026 , 18 6 Barack Obama , 19 6 Komodo dragon , 20 6 LeBron James , 21 6 Imaginary number , 22 6 Illegal drugs , 23 6 Malcolm X , 24 6 Valentine's Day , 25 6 Hamlet

mar 2011: 1 82 2011 Tōhoku earthquake and tsunami , 2 12 William Shakespeare , 3 11 Ryan Miller , 4 10 Barack Obama , 5 10 Human rights , 6 9 Simple English Wikipedia , 7 9 Bleach , 8 8 United States , 9 8 Asexual reproduction , 10 8 List of Greek gods and goddesses , 11 7 Fukushima Daiichi Nuclear Power Plant , 12 7 Miley Cyrus , 13 7 Carolus Linnaeus , 14 7 Elizabeth Taylor , 15 7 Socrates , 16 7 Isaac Newton , 17 6 List of current Canadian first ministers , 18 6 2011 in sports , 19 6 Cabot High School , 20 6 World War I , 21 6 Jesus , 22 6 Car , 23 6 Classical Athens , 24 6 Thought , 25 6 Paris Hilton

abr 2011: 1 16 WrestleMania XXVIII , 2 14 Pithole, Pennsylvania , 3 11 Tosh.0 , 4 11 World War II , 5 10 Feces , 6 8 Kontinental Hockey League , 7 8 Nikolayevsk Incident , 8 8 Dan Kelly , 9 8 Saturn (planet) , 10 7 2011 Green Bay Packers season , 11 7 Ryan Miller , 12 7 Bobby Fischer , 13 7 History of the United States , 14 7 Carolus Linnaeus , 15 6 Ludwig Mies van der Rohe , 16 6 William Shakespeare , 17 6 2011 in sports , 18 6 Phil and Lil DeVille , 19 6 Daniel Tosh , 20 6 Jean-Baptiste de Lamarck , 21 6 Prince William, Duke of Cambridge , 22 6 Avril Lavigne , 23 6 Facebook , 24 6 Russell Brand , 25 6 Ninja

mai 2011: 1 22 Bella Thorne , 2 22 Osama bin Laden , 3 14 Barack Obama , 4 11 Darfur conflict , 5 10 Wiki , 6 9 Portal 2 , 7 9 Illegal drugs , 8 8 World War II , 9 8 World War I , 10 8 Simple English Wikipedia , 11 8 Johannes Gutenberg , 12 7 Islam , 13 7 Quantum mechanics , 14 7 Saturn (planet) , 15 6 2011 in sports , 16 6 Wikipedia , 17 6 List of Greek gods and goddesses , 18 6 Oklahoma , 19 6 Feces , 20 6 God , 21 5 List of Wikipedias , 22 5 William Shakespeare , 23 5 List of ice hockey leagues , 24 5 Behak Maken , 25 5 Password

jun 2011: 1 39 Bella Thorne , 2 9 Science Museum (London) , 3 9 2011 in sports , 4 8 World War II , 5 8 Internet , 6 7 Airblue , 7 7 Barack Obama , 8 7 Nathan Kress , 9 6 Daniel Tosh , 10 6 Miley Cyrus , 11 6 Mad cow disease , 12 5 Speaker of the Australian House of Representatives , 13 5 Kontinental Hockey League , 14 5 Interstate 485 , 15 5 Bengali Wikipedia , 16 5 Bragg Diffraction , 17 5 The Fox and the Hound , 18 5 Tropical Depression Ten (2005) , 19 5 Sikhism , 20 5 Krypton , 21 5 Bell , 22 5 Martin Luther King, Jr. , 23 5 Penis , 24 5 Video game , 25 5 Cheese

jul 2011: 1 32 Bella Thorne , 2 11 Saturn (planet) , 3 10 The King's Speech , 4 8 2011 in sports , 5 7 Guilford Native American Association , 6 7 Airblue , 7 7 The Brunts School , 8 7 Amy Winehouse , 9 6 Arecibo message , 10 6 Simple English Wikipedia , 11 6 Thought , 12 6 Scottish Premier League , 13 5 List of Wikipedias , 14 5 William Shakespeare , 15 5 Kontinental Hockey League , 16 5 Gay Nigger Association of America , 17 5 27 Club , 18 5 Jagadguru Rambhadracharya , 19 5 Rebecca Black , 20 5 Sikhism , 21 5 Jupiter , 22 4 List of ice hockey leagues , 23 4 Art Institute of Chicago , 24 4 Falling in Reverse , 25 4 Physical chemistry

ago 2011: 1 13 2011 in sports , 2 13 Dragon Ball , 3 12 Valve Corporation , 4 11 Minecraft , 5 10 4chan , 6 10 Space Invaders , 7 10 Wikipedia , 8 9 Bella Thorne , 9 8 Muammar al-Gaddafi , 10 8 Call of Duty: Modern Warfare 3 , 11 7 Gay Nigger Association of America , 12 7 Internet , 13 6 List of Wikipedias , 14 6 2011 Green Bay Packers season , 15 6 2011 Virginia earthquake , 16 6 Halo: Reach , 17 6 Amy Winehouse , 18 6 The Legend of Zelda: The Wind Waker , 19 6 Dog , 20 5 Tarkovsky , 21 5 List of ice hockey leagues , 22 5 Blackburn B-103 , 23 5 Explode (song) , 24 5 Theoretical chemistry , 25 5 Capcom

set 2011: 1 16 2011 Green Bay Packers season , 2 9 Adolf Hitler , 3 8 2011 in sports , 4 8 Yabasic , 5 8 Cristiano Ronaldo , 6 8 Toronto Maple Leafs , 7 7 John McDouall Stuart , 8 7 Call of Duty: Modern Warfare 2 , 9 7 Illegal drugs , 10 7 London , 11 6 Lady Gaga , 12 6 Laptop , 13 6 Ostrich , 14 6 France , 15 5 World War I , 16 5 Car , 17 5 Avril Lavigne , 18 5 Rihanna , 19 5 Battle of Dunkirk , 20 5 Carolus Linnaeus , 21 5 Dragon Ball , 22 5 Asexual reproduction , 23 5 Wikipedia , 24 5 List of Greek gods and goddesses , 25 5 Michael Jackson

out 2011: 1 22 Steve Jobs , 2 15 2011 Green Bay Packers season , 3 11 Libya , 4 11 Adolf Hitler , 5 10 Team Fortress 2 , 6 9 Call of Duty: Modern Warfare 3 , 7 9 Henry VIII of England , 8 8 Intellectual disability , 9 8 Call of Duty series , 10 7 Gluten-free diet , 11 7 Hardwood , 12 7 Selena , 13 7 Paula Radcliffe , 14 7 Dragon Ball , 15 7 Osama bin Laden , 16 7 Europe , 17 7 China , 18 7 Brazil , 19 6 Sam P. Chelladurai , 20 6 Geek , 21 6 Barack Obama , 22 6 World War I , 23 6 Network card , 24 6 Moon , 25 6 Oliver Cromwell

nov 2011: 1 16 2011 Green Bay Packers season , 2 12 Nair , 3 10 Homosexuality , 4 9 Illegal drugs , 5 8 Speaker of the Australian House of Representatives , 6 8 Adolf Hitler , 7 7 William Shakespeare , 8 7 World War II , 9 6 Age of sexual consent in the United States , 10 6 Voynich manuscript , 11 6 Call of Duty: Modern Warfare 3 , 12 6 Deaths in 2011 , 13 6 Action figure , 14 6 Barack Obama , 15 6 United States , 16 6 Steve Jobs , 17 6 Thomas Edison , 18 6 Rainforest , 19 6 George Washington , 20 5 Gaslighting , 21 5 Frank Drake , 22 5 Fermi paradox , 23 5 Khedive , 24 5 Pope Adrian IV , 25 5 Minecraft

dez 2011: 1 13 2011 Green Bay Packers season , 2 11 United States , 3 8 Lady Gaga , 4 8 Thought , 5 7 Sodium , 6 6 Repeating , 7 6 Minecraft , 8 6 South Korea , 9 6 England , 10 5 American Contract Bridge League , 11 5 Pornographic actresses by decade , 12 5 Foam , 13 5 One Direction , 14 5 Age of sexual consent in the United States , 15 5 Václav Havel , 16 5 Selena , 17 5 Selena Gomez , 18 5 Ned Kelly , 19 5 Simple English Wikipedia , 20 5 N-Dubz , 21 5 Confucianism , 22 5 Cellular respiration , 23 5 Diabetes mellitus , 24 5 Michael Jackson , 25 5 Global warming

jan 2012: 1 22 2011 Green Bay Packers season , 2 20 Stop Online Piracy Act , 3 14 Barack Obama , 4 12 Adolf Hitler , 5 9 Simple English Wikipedia , 6 9 Schizophrenia , 7 9 Cheese , 8 7 PROTECT IP Act , 9 7 Nicolaus Steno , 10 7 Megaupload , 11 7 United States , 12 7 Illegal drugs , 13 7 List of Greek gods and goddesses , 14 7 Acid rain , 15 7 Cat , 16 6 Science Museum (London) , 17 6 Tommy \"Hurricane\" Jackson , 18 6 Broken Sword: The Shadow of the Templars , 19 6 Axolotl , 20 6 World War II , 21 6 World War I , 22 6 Martin Luther King, Jr. , 23 6 United Kingdom , 24 5 List of Wikipedias , 25 5 Ludwig Mies van der Rohe

fev 2012: 1 10 United States , 2 9 Barack Obama , 3 8 Streptococcal pharyngitis , 4 8 Skrillex , 5 7 S-block , 6 7 Whitney Houston , 7 7 Illegal drugs , 8 6 2011 Green Bay Packers season , 9 6 Urinary tract infection , 10 6 Morgan Oey , 11 6 Binary fission , 12 6 Electronic Arts , 13 6 Discrimination , 14 5 Oxford, Nova Scotia , 15 5 William Shakespeare , 16 5 Girl Gone Wild , 17 5 Periwinkle (color) , 18 5 Learner's permit , 19 5 Nankana Sahib , 20 5 Lardarius Webb , 21 5 Siguroardottir , 22 5 Open Season (movie series) , 23 5 Conservation of mass , 24 5 World War I , 25 5 Dengue fever

mar 2012: 1 37 Ludwig Mies van der Rohe , 2 9 Crater Lake , 3 8 Justin Bieber , 4 8 Kim Kardashian , 5 8 Football , 6 7 Mayra Verónica , 7 7 Carolus Linnaeus , 8 6 Cincinnati Zoo and Botanical Garden , 9 6 Bidsar , 10 6 Jason Witten , 11 6 Fermionic condensate , 12 6 Sperm Whale , 13 6 Illegal drugs , 14 6 Sun , 15 6 List of Greek gods and goddesses , 16 6 Human rights , 17 6 Samurai , 18 6 Leonardo da Vinci , 19 6 Bird , 20 6 Albert Einstein , 21 5 Orc , 22 5 West Gate Bridge , 23 5 Kuch Toh Log Kahenge , 24 5 Hines Ward , 25 5 Torrey Smith

abr 2012: 1 13 Snail , 2 12 Brine shrimp , 3 11 Flatworm , 4 9 2012 Green Bay Packers season , 5 9 List of Greek gods and goddesses , 6 9 Goldfish , 7 8 Rick Santorum , 8 8 Drosophila melanogaster , 9 8 Wikipedia , 10 7 Waheed Murad , 11 7 Christianity , 12 7 The Nutcracker , 13 7 Evolution , 14 7 China , 15 6 Ludwig Mies van der Rohe , 16 6 Daphnia , 17 6 Cincinnati Zoo and Botanical Garden , 18 6 Bidsar , 19 6 Selena (movie) , 20 6 Ronnie Radke , 21 6 World War II , 22 6 Ryōta Tsuzuki , 23 6 Ryūji Bando , 24 6 Simple English Wikipedia , 25 6 Aung San Suu Kyi

mai 2012: 1 10 Plausible Prejudices: Essays on American Writing , 2 9 Osama bin Laden , 3 8 François Hollande , 4 8 World War II , 5 8 Illegal drugs , 6 8 Hacker , 7 7 Jesus , 8 7 France , 9 6 French Civil Aviation University , 10 6 Electrical circuit , 11 6 Tiger , 12 6 Cat , 13 6 Albert Einstein , 14 5 Diana Dors , 15 5 Samantha Mumba , 16 5 Stranger with My Face , 17 5 Mario Vargas Llosa , 18 5 The Assault on Truth: Freud's Suppression of the Seduction Theory , 19 5 Maggie Grace , 20 5 Yu Gamdong , 21 5 Le Spectre de la rose , 22 5 Ronnie Radke , 23 5 Junior Seau , 24 5 Tosh.0 , 25 5 Particle theory of matter

jun 2012: 1 18 Tokyo Medical and Dental University , 2 13 UEFA Euro 2012 , 3 10 Detective Conan (manga) , 4 9 Shōten , 5 9 Fukuoka SoftBank Hawks , 6 8 Kikuō Hayashiya , 7 8 Hiroshima Toyo Carp , 8 8 Sleep apnea , 9 8 Snoopy , 10 7 Croatian Liberation Movement , 11 7 Hepatitis C , 12 7 Pancake , 13 7 Flute , 14 6 Heckler & Koch G36 , 15 6 Pope Alexander VI , 16 6 Mount Tate , 17 6 Botan nabe , 18 6 The Last Emperor , 19 6 Japanese calligraphy , 20 6 Lego big morl , 21 6 Tororo , 22 6 Moyashimon , 23 6 Kathryn Joosten , 24 6 Oort cloud , 25 6 Erebos

jul 2012: 1 9 Higgs Boson , 2 8 Deaths in 2012 , 3 7 Hiro Arikawa , 4 6 Tomihiko Morimi , 5 6 Call of Duty: Modern Warfare 3 , 6 6 List of countries by continents , 7 5 List of SpongeBob SquarePants episodes , 8 5 Atsushi Sato , 9 5 First Hull Trains , 10 5 William Shakespeare , 11 5 Rin Nakai , 12 5 Pandora Hearts , 13 5 E-learning , 14 5 Polandball , 15 5 Higgs field , 16 5 Katy Perry , 17 5 Cristiano Ronaldo , 18 5 Roman Polanski , 19 5 Mourning Dove , 20 5 Communism , 21 4 Chuck Grassley , 22 4 Northern Rail , 23 4 Southeastern (train operating company) , 24 4 First TransPennine Express , 25 4 Wickham Market railway station

ago 2012: 1 11 List of Wikipedias , 2 8 Corrosive substance , 3 7 Australian War Memorial , 4 6 The Pursuit of Happyness , 5 6 2012 Summer Olympics medal table , 6 6 Deaths in 2012 , 7 6 Barack Obama , 8 6 George Clooney , 9 6 Mitt Romney , 10 6 RMS Titanic , 11 5 Re'em Ha'Cohen , 12 5 Robert Earl Jones , 13 5 Alexander Haig , 14 5 List of SpongeBob SquarePants episodes , 15 5 Hola (ethnic group) , 16 5 Tergum , 17 5 Mikoyan-Gurevich MiG-23 , 18 5 Mikoyan-Gurevich MiG-9 , 19 5 Documents on the Persian Gulf's name , 20 5 Billy Ocean , 21 5 Gore Vidal , 22 5 World War I , 23 5 Jesus , 24 5 Selena Gomez , 25 5 IPhone

set 2012: 1 14 2012 Green Bay Packers season , 2 7 One Direction , 3 7 Galba , 4 7 World War I , 5 6 Warrior (wrestler) , 6 6 Nikki Reed , 7 6 Andy Murray , 8 6 Jupiter , 9 5 List of Wikipedias , 10 5 2012 U.S. diplomatic missions attacks , 11 5 Aimee Mann , 12 5 Barry White , 13 5 Barack Obama , 14 5 Structure of the Earth , 15 5 Uyghur people , 16 5 Mitt Romney , 17 5 Victor Hugo , 18 5 Henry VIII of England , 19 5 Pollution , 20 5 Saddam Hussein , 21 5 Rickets , 22 5 United Kingdom , 23 4 Gao (surname) , 24 4 Lim Su-kyung , 25 4 Baek Ah Yeon

out 2012: 1 8 Speaker of the Australian House of Representatives , 2 8 Ludwig Mies van der Rohe , 3 8 Jared Padalecki , 4 8 Human rights , 5 8 Abraham Lincoln , 6 7 One Direction , 7 7 Particle theory of matter , 8 7 Barack Obama , 9 7 The Cranberries , 10 7 Evolution , 11 7 People's Republic of China , 12 6 OSI model , 13 6 Michael Howe (bushranger) , 14 6 Jimi Hendrix , 15 6 Doctor Who , 16 6 George Washington , 17 6 List of fruits , 18 5 Savant syndrome , 19 5 Tel Aviv Cinematheque , 20 5 William Shakespeare , 21 5 Minecraft , 22 5 Brad Paisley , 23 5 Selena , 24 5 World War I , 25 5 Selena Gomez

nov 2012: 1 9 One Direction , 2 8 Congo Rainforest , 3 8 Jesus , 4 8 Wikipedia , 5 8 Dog , 6 7 Ludwig Mies van der Rohe , 7 7 Hurricane Sandy (2012) , 8 7 America's Next Top Model, Cycle 19 , 9 7 Air pollution , 10 7 Barack Obama , 11 6 Zinc finger , 12 6 Menstrual migraine , 13 6 Benign paroxysmal vertigo of childhood , 14 6 Gangnam Style , 15 6 Baobab , 16 6 Illegal drugs , 17 6 Human rights , 18 6 Global warming , 19 6 Leonardo da Vinci , 20 6 List of diseases , 21 5 Steve Whitmire , 22 5 Angela Fong , 23 5 Kang Gyeong-ae , 24 5 Aura (symptom) , 25 5 Acromegaly

dez 2012: 1 10 One Direction , 2 9 Sandy Hook Elementary School shooting , 3 8 One Piece , 4 7 Hide with Spread Beaver , 5 7 Chocolate , 6 7 George Washington , 7 7 Christmas , 8 6 Norman Rockwell Museum , 9 6 Niigata, Niigata , 10 6 Super Junior , 11 6 Migraine , 12 6 Studio Ghibli , 13 6 Naruto (manga) , 14 6 Manga , 15 6 Iran , 16 5 Pasquale J. D'Amuro , 17 5 JYJ , 18 5 The Power Within , 19 5 Tubuai , 20 5 Óscar Romero , 21 5 Tonka Tomičić , 22 5 Kokeshi , 23 5 Ed Sheeran , 24 5 Gheba tribe , 25 5 Assassination of John F. Kennedy

jan 2013: 1 12 Wikipedia , 2 11 One Direction , 3 9 Particle theory of matter , 4 8 Germany , 5 8 Boxing , 6 7 Violin , 7 7 Abraham Lincoln , 8 6 Maroda , 9 6 James M. Buchanan , 10 6 Mikey Way , 11 6 Martin Luther King, Jr. , 12 6 Mexico , 13 5 Kasabian , 14 5 Suzanne Cleary (poet) , 15 5 Estivareilles, Allier , 16 5 Richard Blanco , 17 5 Genco Gulan , 18 5 Gun control , 19 5 Daniel Tosh , 20 5 2037 , 21 5 Canada , 22 5 United States , 23 5 Girls' Generation , 24 5 Electrical circuit , 25 5 List of Miss America winners

fev 2013: 1 13 Barack Obama , 2 9 Pope Benedict XVI , 3 8 Minecraft , 4 7 Australian War Memorial , 5 7 Mikey Way , 6 7 George Washington , 7 7 Isaac Newton , 8 7 Greenhouse effect , 9 6 Rooney Mara , 10 6 LionsXII , 11 6 United States , 12 6 List of Renaissance artists , 13 6 Pocahontas , 14 6 YouTube , 15 6 Illegal drugs , 16 6 Valentine's Day , 17 6 Republican Party (United States) , 18 6 King Arthur , 19 6 Global warming , 20 6 List of planets , 21 6 Dog , 22 6 Albert Einstein , 23 5 Speaker of the Lok Sabha , 24 5 Meira Kumar , 25 5 Pencil sharpener

mar 2013: 1 21 Pope Francis , 2 13 Albert Einstein , 3 12 Justin Bieber , 4 9 Pope Benedict XVI , 5 9 Moose , 6 8 Denis Napthine , 7 8 William Shakespeare , 8 8 United States , 9 7 Minecraft , 10 7 Barack Obama , 11 7 World War II , 12 7 Hugo Chávez , 13 7 French Revolution , 14 7 List of countries by continents , 15 6 Kraft, Louisiana , 16 6 Chiton , 17 6 Event-driven programming , 18 6 Simple English Wikipedia , 19 6 Sun , 20 6 The Holocaust , 21 6 List of planets , 22 6 Schizophrenia , 23 6 English language , 24 5 Charminar , 25 5 Jay Inslee

Wikipedias are initially ordered by number of speakers of the language

Speakers: Number of speakers of a language is the estimated total of primary and secondary speakers, is in many cases a very rough estimation (based on the page on the English Wikipedia about that language)
Regions are parts of the world where the language is spoken in substantial amounts (compared to total number of speakers). Regions where a language gained presence only by a recent diaspora are generally not included.
Region codes: AF:Africa, AS:Asia, EU:Europe, NA:North America, OC:Oceania, SA:South America, W:World Wide, CL:Constructed Language

Estatísticas geradas em Quarta-feira, 24 de abril 2013 17:26

Dump file simplewiki-20130414-stub-meta-history.xml.gz (edits only), size 285 Mb as gz -> 1.8 Gb
Dump processed till Mar 31, 2013, on server stat1, ready at Sun-14/04/2013-22:49 after 19 min, 47 sec.

Versão do script:2.6
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.