Estatísticas da Wikipédia vepsian

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Articles per size range / Records per namespace / Most edited articles / Zeitgeist

Most metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.

Some metrics have been collected from the full archive dump which runs on lower frequency than the usual monthly cycle.
These metrics are columns F,I,J,K,M,N,O,P,Q,R from the first table.


See also metrics definitions


 
Monthly counts & Quarterly rankings: julho 2015
 
DataWikipedistasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
jul 20150%   +5%      +40%      +14%
jun 2015+2%   +4%      +13%      +13%
mai 20150%   +2%      +60%      +11%
abr 2015+6%   +1%      +134%      +8%
mar 20150%   +1%      -22%      +3%
fev 20150%   +1%      +54%      +3%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P____Q____R____S__
jul 201554 324,8 k 810,1   1,4 k      1,9 k
jun 2015541324,5 k 610,4   1,0 k      1,7 k
mai 201553 524,3 k 310,5   899      1,5 k
abr 2015533514,3 k 210,5   563      1,3 k
mar 201550 214,2 k 110,5   241      1,2 k
fev 201550 214,2 k 110,6   310      1,2 k
jan 201550 3 4,1 k 110,6   201      1,2 k
dez 201450 2 4,1 k  10,6   76      1,1 k
nov 201450 3 4,1 k 110,6   145      1,1 k
out 201450 2 4,1 k  10,6   155      1,1 k
set 201450 314,1 k 110,6   226      1,1 k
ago 2014501414,1 k 110,6   389      1,1 k
jul 201449 214,0 k 110,5   183      1,0 k
jun 20144915 4,0 k 110,5   228      1,0 k
mai 201448 214,0 k 110,6   404      998
abr 201448 323,9 k 210,6   484      976
mar 201448 423,9 k 110,6   610      943
fev 201448 413,8 k2,1 k110,644521%3%2912,6 Mb228 k23 k1361921,0 k929
jan 201448 413,8 k2,1 k210,644120%3%7462,6 Mb224 k23 k137192996912
dez 2013481723,8 k2,0 k310,543120%3%8512,5 Mb216 k22 k172191975872
nov 2013472713,7 k1,9 k210,642119%3%3012,3 Mb206 k21 k175190938826
out 201345 313,6 k1,9 k210,641419%3%3312,3 Mb201 k20 k176184933815
set 201345 4 3,5 k1,8 k110,741519%3%2072,2 Mb197 k20 k175184917802
ago 201345 313,5 k1,8 k210,741319%3%2152,2 Mb195 k20 k168182913793
jul 201345 413,5 k1,8 k210,841319%3%3822,2 Mb193 k19 k205182910779
jun 2013451423,4 k1,7 k410,941118%3%6312,1 Mb188 k19 k215181895753
mai 201344 423,3 k1,6 k311,140518%3%5652,1 Mb179 k18 k281179873685
abr 201344 423,2 k1,6 k611,239918%3%8722,0 Mb171 k17 k376181791665
mar 201344 613,0 k1,5 k411,640118%3%3,8 k1,9 Mb163 k16 k1,3 k181747634
fev 201344 412,9 k1,4 k310,739719%3%1,5 k5,0 Mb156 k15 k134 k179713604
jan 201344 512,8 k1,4 k310,540019%3%1,6 k4,9 Mb153 k14 k131 k187704587
dez 2012443622,8 k1,3 k810,240319%3%2,4 k4,8 Mb149 k14 k128 k200691574
nov 2012411622,5 k1,3 k910,241720%3%2,3 k4,5 Mb141 k13 k119 k220637516
out 20124041022,3 k1,1 k610,442421%3%2,5 k4,2 Mb128 k11 k112 k241559449
set 2012361632,1 k969610,241820%3%3,3 k3,8 Mb114 k9,5 k104 k259486383
ago 201235 711,9 k85829,441020%3%1,3 k3,5 Mb102 k7,6 k98 k371399314
jul 201235 421,8 k81329,140520%3%1,4 k3,4 Mb97 k7,1 k95 k433366293
jun 2012351631,7 k784158,639920%3%2,9 k3,3 Mb93 k6,6 k93 k535376274
mai 2012342631,3 k681159,244924%4%2,0 k2,6 Mb78 k5,2 k75 k718311163
abr 201232261843573311,956332%5%8772,1 Mb64 k3,8 k60 k768203135
mar 20123027176651031255029%5%1,0 k2,0 Mb57 k3,2 k55 k837154108
fev 2012283123672442312,156932%6%2,5 k1,8 Mb52 k2,8 k50 k94914596
jan 201225 4 59338229,558233%6%2421,6 Mb47 k2,5 k46 k87412185
dez 20112516254233749,958632%7%6391,5 Mb44 k2,3 k42 k80812168
nov 201124 5 419256 11,360536%7%5831,2 Mb35 k2,0 k33 k56410952
out 201124121406252 10,261737%7%2211,2 Mb35 k1,9 k31 k55211049
set 20112327 398251 9,962838%8%1211,2 Mb35 k1,9 k30 k54810949
ago 20112157 38823819,861438%7%1741,1 Mb33 k1,9 k30 k52010445
jul 201116 11370220 9,859836%7%1251,1 Mb31 k1,8 k29 k5099545
jun 20111614 370215 9,553734%5%871,1 Mb28 k1,6 k29 k5127044
mai 201115 6 366210 9,353734%5%2691,1 Mb27 k1,6 k29 k5116944
abr 201115 5 364208 8,753433%5%1111,0 Mb27 k1,6 k28 k5066844
mar 201115 8136020218,450631%5%3121,0 Mb25 k1,5 k28 k5006144
fev 201115 61339185 845729%4%298947 kb22 k1,2 k26 k4683721
jan 20111524233217727,341927%4%622917 kb20 k1,1 k26 k4593016
dez 201013151267106 6,838019%4%216642 kb14 k95618 k3012111
nov 201012342260105 6,142120%5%298477 kb15 k89211 k2952011
out 20109   24896 5,235020%4% 260 kb12 k7824,4 k2561211
set 20109   24896 5,235020%4% 260 kb12 k7824,4 k2561211
ago 20109   24896 5,235020%4%3260 kb12 k7824,4 k2561211
jul 20109   24796 5,235120%4%7260 kb12 k7804,4 k2551211
jun 20109   24796 5,235120%4%1260 kb12 k7804,4 k2551211
mai 20109   24796 5,235120%4%5260 kb12 k7794,4 k2551211
abr 20109   24494 5,235020%4%2257 kb12 k7524,4 k2511211
mar 2010922124494 5,235020%4%169257 kb12 k7524,4 k2521211
fev 20107   23990 4,636020%4%4224 kb12 k1983,5 k247811
jan 20107   23990 4,636020%4%2224 kb12 k1983,5 k247811
dez 20097 1 23990 4,636020%4%74224 kb12 k1983,5 k246811
nov 20097 112399014,336020%4%202222 kb12 k1983,5 k246811
out 20097 112176823,828912%3%150190 kb9,2 k1793,4 k172811
set 2009712 1665414,130211%4%133163 kb7,1 k1853,3 k8588
ago 20096 1 14536 3,727410%3%692 kb5,6 k931,4 k6824
jul 20096 1 14435 3,727510%3%1491 kb5,5 k931,4 k6724
jun 20096   14232 3,726911%3% 88 kb5,3 k691,3 k6524
mai 20096   14232 3,726911%3% 88 kb5,3 k691,3 k6524
abr 2009611 14232 3,726911%3%1388 kb5,3 k691,3 k6524
mar 2009513 14130 3,625710%3%2886 kb5,1 k451,3 k6224
fev 20094 2 13628 3,525510%3%3785 kb5,0 k411,3 k6324
jan 200942411232223,62268%2%28277 kb4,1 k301,3 k6024
dez 20082 2 503 3,21334%2%1220 kb1,1 k1135516 3
nov 20082   483 3,11324%2% 16 kb1,0 k724714 3
out 20082   483 3,11324%2% 16 kb1,0 k724714 3
set 20082   483 3,11324%2% 16 kb1,0 k724714 3
ago 20082   483 3,11324%2% 16 kb1,0 k724714 3
jul 20082 1 483 3,11324%2%716 kb1,0 k724714 3
jun 20082   423 3,41465%2% 15 kb99272418 3
mai 20082 1 42313,41465%2%4215 kb99272418 3
abr 20082 2 213 4,724110%5%1510 kb88571192 3
mar 20082 1 172 4,91636% 225,1 kb4874161 3
fev 2008221 142 4,41827% 624,3 kb4592141 3
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
The following table ranks this project in relation to projects in other languages with 1000+ articles
abr 201517393126142162 122200   123      242
jan 2015175 147 164 153200   157      242
out 2014174 168 164  200   147      242
jul 2014175 157128164 142199   154      242
abr 2014174 15199162 118196   119      242
jan 2014168167134135160172124196199193193115192189177213217184242
out 2013170149151125159172115196200194193126196191180214218187242
jul 2013169138133127157173113196199195193127195191180215218185242
abr 201316914813910616417888192201195192129197196182202216187242
jan 2013167145124134169180108196196190189156191198182169214190242
out 2012170789410118018384194193188188127195202188173209196242
jul 2012177137136106186193114198193187187163200206204180194204242
abr 2012182102115137210200108208207207205191211220219197169216242
jan 2012196156140139216211121207206206204222216223226205164221242
out 2011195131170135224217159206205205203228221225226215181220242
jul 2011215150186127221218166203202202200235221223224213179221242
abr 2011215145127132220215160198197197195233219221223210178226242
jan 201121397137101220217116196195195193204223224222208179232242
out 2010225151214130221221151191190190188241230226224231195235242
jul 2010223160221140220221158185184184182240229223222230194233242
abr 2010221152210133218217160183182182181239227223222226191232242
jan 2010227142202130216218154181181181180238229223229230193234242
out 2009225142187126215221117178178178177218229226231228201234242
jul 2009224187183132219224152172172172171232231228233231218235242
abr 2009223121182144217223147170170170169233229226231230215233242
jan 200923095126121218224119164164164163201228226236228215234241
out 2008232136198127223235143158158158157236233232237231230235240
jul 2008230145181131219232147152152152150230230229236230226234239
abr 2008228145161131226230151147147146144228231230235230231232239
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
 WikipedistasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikipedistas (usuários registrados)
A = Wikipedistas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikipedistas que editaram pelo menos dez vezes desde que chegaram
C = Wikipedistas que contribuíram cinco vezes ou mais este mês
D = Wikipedistas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Artigos que contêm pelo menos uma ligação interna e 200 caracteres de texto legível, não contando códigos wiki e html,
      ligações ocultas, etc.; títulos também não contam (outras colunas são baseadas no método oficial de contagem)
G = Novos artigos por dia no mês passado
H = Número médio de revisões por artigo
I = Tamanho médio dos artigos em bytes
J = Porcentagem de artigos com pelo menos 0,5 kb de texto legível (veja F)
K = Porcentagem de artigos com pelo menos 2 kb de texto legível (veja F)

Base de dados
L = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
M = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
N = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
O = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
P = Total de ligações para outras wikipédias
Q = Total de imagens apresentadas
R = Total de ligações para outros sítios
S = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  5  10  100  1000  1  3  5  10  25  100  1  3  5  10  25  100  250  5  10  100 
jul 201515333222     422    3222222   
jun 201514532222 1   221    422222    
mai 201517755321     7321   5332211   
abr 20151665541      643    53211     
mar 2015632211      4      42211     
fev 20151022111  1   432    7211111   
jan 2015124332      6311   844111    
dez 201472222      421    51111     
nov 2014104322      42     7421      
out 201494222      421    6211      
set 20141453321      621    72221     
ago 201415443211     6221   104411     
jul 20141122111      5332   42221     
jun 2014166522      53211  73311     
mai 201421721111     943211 123111     
abr 201410332221     43211  52221     
mar 201411642221     63211  92222     
fev 20141054211      63321  822111    
jan 201414544411 11  74422  955311 1  
dez 201316877621     96542  97442     
nov 20131287541      83331  155422     
out 20135333211     4211   6211      
set 2013135421      64111  10522      
ago 2013833221  1   5211   42221  211
jul 20131654331      53321  95411     
jun 201316644321 1   98622  74222  1  
mai 201315544321 1   54322  1354421 11 
abr 201317544222 33  53221  97421  331
mar 20131966421  872163221  114321  542
fev 20131774321  1293 83221  164211  651
jan 20131155431  15123 632111 133321  661
jul 201515333222     422    3222222   
abr 20151665541      643    53211     
jan 2015124332      6311   844111    
out 201494222      421    6211      
jul 20141122111      5332   42221     
abr 201410332221     43211  52221     
jan 201414544411 11  74422  955311 1  
out 20135333211     4211   6211      
jul 20131654331      53321  95411     
abr 201317544222 33  53221  97421  331
jan 20131155431  15123 632111 133321  661
out 20121910108521 1383 94332  18854311762
jul 201215644221 1083 832111 2653222 66 
abr 20121466431  11102 9541   16632   53 
jan 201275442      54332  32211     
out 2011722111      1      1111      
jul 2011111111  1          21        
abr 201165541      1      21        
jan 20115444221     421    4332      
out 2010          1                
jul 2010      1          111       
abr 20101                2211      
jan 2010                           
out 2009221111             11111     
jul 20091111                        
abr 2009221                         
jan 2009444331      332    32222     
out 2008                           
jul 2008211                         
abr 2008222                         

 

Distribuição de edições de artigos por wikipedistas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikipedistasEdições total
1336100.0%30,025100.0%
39829.2%29,69398.9%
105416.1%29,44498.1%
323510.4%29,07996.8%
100195.7%28,05893.4%
316123.6%26,91289.6%
100092.7%24,97483.2%
316220.6%13,19644.0%

 

15 wikipedistas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdições 
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
 agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
KoiravvaUC2 04,1526172,081378out 21, 201210122815--
SebranikUC3 02,5791825-mai 15, 20121171777---
K9re11UC5+41,597768560263fev 03, 2014542490235--
GhiutunUC12 0489201061mai 12, 201444410---
KmoksyUC34 04117-ago 12, 2011144811---
DENAMAXUC40 026110-abr 18, 20151031---
MoengUC74+361--mar 14, 2013868----
Olivier LPBUC329...11--jul 10, 201520----
LotjeUC330...11--jul 14, 201516----
KopiersperreUC331...11--jul 15, 201515----
व्लादिस्लावUC332...11--jul 19, 201511----
ChumwaUC333...11--jul 22, 20158----
WilbysuffolkUC334...11--jul 23, 20157----
Keete 37UC335...11--jul 27, 20153----
Андрей РоманенкоUC336...11--jul 31, 2015 ----

 

20 wikipedistas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
  Primeira ediçãoúltima edição
 posiçãototaldatadias
atrás
datadias
atrás
Tamara UstinovaUC19,044out 19, 20111380mai 26, 2014430
SihlaineUC42,213nov 05, 2013632set 05, 2014328
МаксимUC61,502dez 29, 20111309jul 07, 2014388
IgriksUC71,461set 18, 20092141mai 14, 2013807
Игорь БродскийUC81,261fev 23, 20092348jan 13, 2014563
IketsiUC91,165jun 15, 20111506jul 30, 2014365
Andrijko Z.UC10769nov 08, 20101725nov 20, 20111348
MF-WarburgUC11680fev 01, 20121275fev 07, 2013903
SuraUC13259fev 19, 20082718mar 31, 20111582
Midnight GreenUC14202ago 24, 20111436jun 25, 20121130
Triple-ADHD-ASUC15156jan 17, 20092385dez 09, 20092059
PorbóllettUC16152nov 24, 2013613jun 25, 2014400
U.SteeleUC17139ago 11, 20111449jul 20, 20121105
RomaineBotUC18130mar 30, 20101948mar 30, 20101948
Connection 3UC19108jun 27, 2013763set 21, 2013677
BudelbergerUC2090dez 11, 20082422fev 22, 20092349
CastellumUC2186out 15, 20121018out 20, 20121013
O'zqonUC2285ago 25, 20121069out 25, 20121008
KaiyrUC2383nov 13, 20101720mai 07, 201584
Gleb BorisovUC2483nov 30, 20101703mai 16, 20111536

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 819 edições foram feitas por usuários anônimos, de um total de 48154 edições ( 1e %)
  


42 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições 
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
 datadias
atrás
datadias
atrás
EmausBotUC14,375fev 03, 20121273jan 16, 2014560--
MerlIwBotUC23,510mai 10, 20111542ago 09, 2013720--
AddbotUC32,947mar 07, 2013875ago 19, 2013710--
XqbotUC41,799abr 16, 20121200mar 06, 2013876--
GerakibotUC5559mai 24, 20121162mar 06, 2013876--
JackieBotUC6555fev 09, 20121267mar 02, 2013880--
AvocatoBotUC7542fev 08, 20121268jul 10, 20121115--
LegobotUC8411mar 11, 2013871abr 02, 2013849--
RedBotUC9381abr 21, 20121195ago 21, 20121073--
JAnDbotUC10354fev 03, 20121273jul 02, 2013758--
Idioma-botUC11229fev 03, 20121273mar 05, 2013877--
YFdyh-botUC12204jun 24, 20121131fev 27, 2013883--
Makecat-botUC13185out 26, 20121007mar 05, 2013877--
HiW-BotUC14173fev 05, 20121271nov 08, 2012994--
LaaknorBotUC15134fev 04, 20121272mar 03, 2013879--
Justincheng12345-botUC16129jun 23, 20121132jan 08, 2013933--
Luckas-botUC17115abr 01, 20121215mai 20, 20121166--
VolkovBotUC18107fev 14, 20121262mar 04, 2013878--
AvicBotUC1992jun 01, 20121154dez 09, 2012963--
EscarbotUC2072mar 06, 20121241mar 03, 2013879--
KLBot2UC2169abr 13, 2013838jul 07, 2013753--
VagobotUC2253fev 29, 20121247set 04, 20121059--
SantoshBotUC2341out 24, 20121009mar 04, 2013878--
PixelBotUC2433fev 20, 20121256mar 03, 2013879--
KamikazeBotUC2533fev 29, 20121247jan 26, 2013915--
CarsracBotUC2630fev 12, 20121264fev 24, 2013886--
SynthebotUC2725mai 16, 20121170dez 30, 2012942--
CommonsDelinkerUC2823set 30, 20092129jul 15, 201515--
WikitanvirBotUC2920fev 04, 20121272abr 05, 20121211--
RobbotUC3019fev 04, 20121272set 02, 20121061--
JotterbotUC3114jan 15, 2013926jan 26, 2013915--
タチコマ robotUC3212dez 28, 20111310out 21, 20121012--
DragonBotUC3311jan 12, 2013929jan 14, 2013927--
SassoBotUC349mai 29, 20121157mar 04, 2013878--
GhalyBotUC358dez 27, 2012945jan 31, 2013910--
CompBotUC367mar 24, 20121223mai 21, 20121165--
CocuBotUC377nov 30, 2012972fev 11, 2013899--
OctraBotUC387jan 28, 2015183fev 02, 2015178--
NjardarBotUC394jun 16, 20121139out 27, 20121006--
MastiBotUC402fev 26, 2013884fev 28, 2013882--
MalarzBOTUC411ago 18, 20121076ago 18, 20121076--
TXiKiBoTUC421dez 20, 2012952dez 20, 2012952--

 

Artigos que contêm pelo menos uma ligação interna e .. caracteres de texto legível, não contando códigos wiki e html,
ligações ocultas, etc.; títulos também não contam  (excluindo páginas de redirecionamento)

DataArtigos
 < 32 ch< 64 ch< 128 ch< 256 ch< 512 ch< 1 k ch< 2 k ch< 4 k ch< 8 k ch< 16 k ch< 32 k ch< 64 k ch

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110JpgPng
jul 20156,7 k4586052756411,8 k       502
jun 20156,2 k4576052755511,7 k       502
mai 20155,8 k4576052754811,6 k       502
abr 20155,6 k4555952753311,5 k       502
mar 20155,4 k4545952752411,5 k       502
fev 20155,4 k4535952751611,5 k       502
jan 20155,3 k4495952740811,4 k       502
dez 20145,2 k4425952740811,3 k       502
nov 20145,2 k4405952740811,3 k       502
out 20145,2 k4375952740711,2 k       502
set 20145,2 k4355952740711,2 k       502
ago 20145,1 k4315952740311,2 k       502
jul 20145,1 k4225852738011,1 k       502
jun 20145,0 k4215752737211,1 k       502
mai 20145,0 k4205152637211,1 k       502
abr 20144,9 k4124952636711,1 k       502
mar 20144,8 k4104752636411,1 k       502
fev 20144,8 k4044652635711,1 k      280502
jan 20144,7 k4014552635611,0 k      722502
dez 20134,6 k395405263481991      839502
nov 20134,5 k393395263471970      298502
out 20134,4 k388385263391967      328502
set 20134,4 k385375263391959      144502
ago 20134,3 k370365263391958      197502
jul 20134,3 k368365263381950      361502
jun 20134,2 k361365263331949      610502
mai 20134,0 k359361763331944      530152
abr 20133,9 k350351663181920      723142
mar 20133,7 k339331663141913      378142
fev 20133,5 k217321663141907      276142
jan 20133,4 k205311663141903      240142
dez 20123,3 k199281663081899      1003142
nov 20123,0 k188281563031871      1170141
out 20122,7 k18225742981788      142761
set 20122,4 k17423642771648      22046 
ago 20122,2 k16323642591440      4396 
jul 20122,1 k15221642571398      5856 
jun 20122,0 k13715642331349      16956 
mai 20121,5 k1209641491225      11136 
abr 20129781087 21421207      365  
mar 2012874967 21411206      313  
fev 2012768825 2140 190      1723  
jan 2012678 4  131 179      239  
dez 2011610 4  131 176      464  
nov 2011471 3  128 170      222  
out 2011455 3  128 170      219  
set 2011447 3  128 170      118  
ago 2011433 3  123 167      172  
jul 2011415 3  123 166      115  
jun 2011414 3  123 164      71  
mai 2011410 3  123 164      65  
abr 2011408 3  119 164      110  
mar 2011404 3  119 164      310  
fev 2011359 3  91 161      295  
jan 2011347 3  90 157      620  
dez 2010277 3  90 155      211  
nov 2010270 3  89 155      289  
out 2010258 3  88 155         
set 2010258 3  88 155         
ago 2010258 3  88 155      2  
jul 2010257 3  88 155         
jun 2010257 3  85 155         
mai 2010257 3  85 155      4  
abr 2010254 3  85 154      1  
mar 2010254 3  84 154      161  
fev 2010249 3  63 103      2  
jan 2010249 3  63 103         
dez 2009249 3  63 103      14  
nov 2009249 3  63 103      189  
out 2009227 1  56 98      138  
set 2009173    54 85      101  
ago 2009149    43 35      5  
jul 2009148    43 35      14  
jun 2009146    43 35         
mai 2009146    43 35         
abr 2009146    43 35      12  
mar 2009145    43 35      27  
fev 2009140    39 33      36  
jan 2009127    39 32      280  
dez 200853    4 12      12  
nov 200851    2 11         
out 200851    2 11         
set 200851    2 11         
ago 200851    2 11         
jul 200851    2 11      7  
jun 200845    2 11         
mai 200845    2 11      42  
abr 200824    1 5      15  
mar 200820    1 5      21  
fev 200817    1 2      58  

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

fev 2008: 1 2 Piter , 2 1 Pätnič

mar 2008: 1 1 Šoutjärv'

abr 2008: 1 1 Šoutjärv'

mai 2008: 1 1 Šoutjärv'

jul 2008: 1 1 Mecoi

dez 2008: 1 1 Vingl

jan 2009: 1 4 Meiden Tat , 2 4 Kos'kenaluižen rajon , 3 3 Kühkjaine , 4 3 Kuruv , 5 3 Kana , 6 3 Jerusalim , 7 3 Jablokpu , 8 3 Hel'sinki , 9 3 Hab , 10 3 Biblii , 11 2 Šušt , 12 2 Šoutjärv' , 13 2 Mecantaga , 14 2 Zaiceva Nina , 15 2 Vologdan agj , 16 2 Vingl , 17 2 Vil'häl , 18 2 Vepsän rahvahaline volost' , 19 2 Vepsän , 20 2 Venäma , 21 2 Vaugedvenäma , 22 2 Uz' Zavet , 23 2 Tihvinan rajon , 24 2 Tervoil , 25 2 Suomen kel'

fev 2009: 1 2 Pälehtpol’ , 2 2 Karjalan Tazovaldkundan gimn , 3 1 Litvanma

mar 2009: 1 2 Zaiceva Nina , 2 1 Šoutjärv'

abr 2009: 1 2 Suomenma , 2 1 Vepsän

jul 2009: 1 1 Zverin lugu

ago 2009: 1 1 Suomenma

set 2009: 1 2 Pälehtpol’ , 2 1 Meiden Tat

out 2009: 1 2 Vepsän rahvahaline volost' , 2 2 Venäma , 3 2 Kuld , 4 1 Šoutjärv'

nov 2009: 1 2 Suomenma , 2 1 Zverin lugu

dez 2009: 1 2 Grekanma , 2 1 Mal't

fev 2010: 1 1 Pälehtpol’

mar 2010: 1 2 Sur' Britanii , 2 2 Pu , 3 2 Ispanii , 4 2 Hristofor Kolumb , 5 2 Saksanma , 6 2 Lönnrot Elias , 7 2 Avstrii , 8 1 Šušt

abr 2010: 1 1 Einštein Al'bert

mai 2010: 1 1 Kaliningradan agj

ago 2010: 1 1 Pol'šanma

nov 2010: 1 3 Kaliningradan agj , 2 2 Mecoi , 3 2 Litvanma , 4 2 Änine , 5 2 Podporožj , 6 2 Kaunas , 7 2 Karjalan keled , 8 2 Karjalan Tazovaldkund , 9 2 Kant Immanuel' , 10 2 Kaliningrad , 11 2 Kalevala , 12 2 Kajag , 13 2 Jurij Gagarin , 14 2 Italii , 15 2 Ispanii , 16 2 Irlandii , 17 2 Hel'sinki , 18 2 Haitmann Fridrih , 19 2 Grekanma , 20 2 Gent , 21 2 Flevoland , 22 2 Eva , 23 2 Estinma , 24 1 Zverin lugu

dez 2010: 1 4 Vasilii Surikov , 2 3 Vologdan agj , 3 3 Vinsent van Gog , 4 3 Tu-154 , 5 2 Čehov Anton , 6 2 Änižröunan rajon , 7 2 Migel' de Servantes Saavedra , 8 2 Mal't , 9 2 Lüksemburg , 10 2 Mocart Vol'fgang Amadeus , 11 2 Zaiceva Nina , 12 2 Gügo Viktor , 13 2 Vaugedvenäma , 14 2 Šeikspir Uil'jam , 15 2 Tervoil , 16 2 Suomalaiž-ugrilaine škol , 17 2 Sodjärv , 18 2 Päiväine , 19 2 Portugalii , 20 2 Podporožj , 21 2 Petroskoi , 22 2 Orav , 23 2 Nemž , 24 2 Leonardo da Vinči , 25 2 Kettunen Lauri

jan 2011: 1 3 Vengrii , 2 3 Ukrain , 3 3 Kazahstan , 4 3 Italijan kel' , 5 2 Ženevan järv , 6 2 Šoutjärv' , 7 2 Čehanma , 8 2 Änižröunan rajon , 9 2 Lüksemburg , 10 2 Vepsän kul'turan muzei , 11 2 Vepsän kel' , 12 2 Venäma , 13 2 Vaugedvenäma , 14 2 Vatikan , 15 2 Suomenma , 16 2 Slovenii , 17 2 Slovakii , 18 2 Serbii , 19 2 San Marino , 20 2 Pälehtpol’ , 21 2 Piter , 22 2 Petroskoi , 23 2 Nevondkundaližiden Socialistižiden Tazovaldkundoiden Ühtištuz , 24 2 Moskv , 25 2 Monak

fev 2011: 1 3 Kazahan kel' , 2 3 Kazahalaižed , 3 3 Händikaz , 4 2 Änižröunan rajon , 5 2 Litvanma , 6 2 Vepsän rahvahaline volost' , 7 2 Totaran kel' , 8 2 Suomenma , 9 2 Ročinma , 10 2 Petroskoi , 11 2 Kaži , 12 2 Kaleig , 13 2 Irlandii , 14 2 Grekanma , 15 2 Saksanma , 16 2 Estin kel' , 17 2 Daugavpils , 18 1 Šveicarii

mar 2011: 1 3 Venäma , 2 3 Moskv , 3 3 Kaunas , 4 2 Šokš , 5 2 Medvedev Dmitrii , 6 2 Rim , 7 2 Repin Il'ja , 8 2 Pälehtpol’ , 9 2 Putin Vladimir , 10 2 Piter , 11 2 Peitsemnižed , 12 2 Abramov Nikolai , 13 2 Kuz' , 14 2 Kuld , 15 2 Kolumb Hristofor , 16 2 Kazmused , 17 2 Karjalan Tazovaldkundan gimn , 18 2 Karjalan Tazovaldkund , 19 2 Kant Immanuel' , 20 2 Kaliningrad , 21 2 Jel'cin Boris , 22 2 Immanuel Kant , 23 2 Haitmann Fridrih , 24 2 Germanijan kel' , 25 2 Gagarin Jurii

abr 2011: 1 2 Venäma , 2 2 Kazahstan , 3 2 Bel'gii , 4 1 Šveicarii

mai 2011: 1 3 Süvär' , 2 2 Päiväine , 3 2 Pifagoran teorem , 4 2 Kolumb Hristofor , 5 2 Karjalan Tazovaldkundan Rahvahaline teatr , 6 1 Marok

jun 2011: 1 2 Karjalan Tazovaldkund , 2 2 Danii , 3 2 Bolgarii , 4 2 Alma-At , 5 1 Čehanma

jul 2011: 1 1 Ženevan järv

ago 2011: 1 3 Vezi , 2 3 Süvär' , 3 2 Šrenkan kuz' , 4 2 Venäma , 5 2 Vauged kuz' , 6 2 Tän'-šanine kuz' , 7 2 Turkmenistan , 8 2 Taškent , 9 2 Serbine kuz' , 10 2 Saratov , 11 2 Pifagoran teorem , 12 2 Peitsemnižed

set 2011: 1 5 Lezgin kel' , 2 3 Dagestan , 3 2 Ženevan järv , 4 2 Volgograd , 5 2 Samara , 6 2 Orenburg , 7 2 Omsk , 8 2 Kurgan , 9 2 Kaliningradan agj , 10 1 Zverin lugu

out 2011: 1 2 Vil'nüs , 2 2 Pälehtpol’ , 3 2 Lakan kel' , 4 2 Korsik , 5 1 Šušt

nov 2011: 1 3 Tähtaz , 2 3 Tu-154 , 3 3 Pälehtpol’ , 4 2 Vinsent van Gog , 5 2 Vikipedii , 6 2 Vikimedii , 7 2 Vezi , 8 2 Rim , 9 2 Pol'šanma , 10 2 Pifagoran teorem , 11 2 Petroskoi , 12 2 Pariž , 13 2 Paltog , 14 2 Moskv , 15 2 Kuruv , 16 2 Karjalan Tazovaldkund , 17 1 Šoutarv

dez 2011: 1 5 Vaugedpert' (Vašington) , 2 4 Amerikan Ühtenzoittud Valdkundad , 3 3 Mel'burn , 4 3 Lüblän , 5 3 Pälehtpol’ , 6 3 Pil'ved , 7 3 Oper , 8 3 Natrii , 9 3 Kundlimed , 10 3 Konstebl Džon , 11 3 Džasper (lidn, Minnesot) , 12 3 Bratislav , 13 3 Ankar , 14 2 Šur , 15 2 Šrödinger Ervin , 16 2 Šanhai , 17 2 Čuvašan kel' , 18 2 Čai , 19 2 Mafii , 20 2 MP3-plejer , 21 2 Lüblin , 22 2 Avrora (kreiser) , 23 2 Zagreb , 24 2 Vintaž , 25 2 Vepsän kel'

jan 2012: 1 4 Venäman Tazovaldkundad , 2 4 Opera , 3 4 Internet Explorer , 4 3 Čerkessk , 5 3 Čeboksarad , 6 3 Petr I Sur' , 7 3 Mozilla Firefox , 8 3 Groznii , 9 3 Google Chrome , 10 2 Čeläbinsk , 11 2 Microsoft Windows , 12 2 Microsoft Office Word , 13 2 Microsoft Office Excel , 14 2 Vašington (lidn) , 15 2 Uraližed keled , 16 2 Skopje , 17 1 Vepsän kelen aigad

fev 2012: 1 14 Pälehtpol’ , 2 5 Sarapul , 3 5 Dagestanan Tazovaldkund , 4 4 Zaiceva Nina , 5 4 Venäma , 6 4 Särg , 7 4 Petr I Sur' , 8 4 San Francisko , 9 4 Podporožj , 10 4 Petroskoi , 11 4 Orav , 12 4 Korol' i Šut , 13 4 Kijev , 14 4 Baškiran kel' , 15 4 Azerbaidžan , 16 3 Vepsän kelen aigad , 17 3 Bolgarijan kel' , 18 3 Antofagast , 19 3 Val'paraiso , 20 3 Santjago , 21 3 Konseps'jon , 22 3 Mrongovo , 23 3 Vk.com , 24 3 Lacuna Coil , 25 3 Šveicarii

mar 2012: 1 4 Soči , 2 4 Pälehtpol’ , 3 3 Buranovon Baboid , 4 3 Narv (lidn) , 5 3 Tartu , 6 3 Linkin Park , 7 3 Čehanma , 8 2 Bardan rajon , 9 2 Šeki , 10 2 Nahičevan , 11 2 Gändž , 12 2 Gai (lidn) , 13 2 Orenburgan agj , 14 2 Moščen , 15 2 Kautokeino , 16 2 Ostrav , 17 2 Himižiden elementoiden periodine tablut , 18 2 Udmurtan kelen kändod , 19 2 Rio-de-Žaneiro , 20 2 San Paulu , 21 1 Orsk

abr 2012: 1 4 Pälehtpol’ , 2 3 Vepsän nimed , 3 3 Pol'šanman administrativiž-territorialine jagand , 4 2 666 (lugu) , 5 2 Vepsän Vikipedii , 6 2 IPod , 7 2 Vodin kel' , 8 2 Lantanoidad , 9 2 Korrea Rafael' , 10 2 Ščecin , 11 2 Abdulino , 12 2 Himižiden elementoiden periodine tablut , 13 2 Melent'jeva Marija , 14 2 Zaiceva Marja , 15 2 Lämoi , 16 2 Votkinsk , 17 2 Vobl , 18 2 Jašov Viktor , 19 2 Vepsän kel' , 20 2 Šeikspir Uil'jam , 21 2 Udmurtan kel' , 22 2 Portlend (Oregon) , 23 2 Kühkjaine , 24 2 Kur'ged , 25 2 Kalitkad

mai 2012: 1 7 Pälehtpol’ , 2 6 Party for Everybody , 3 5 Piter , 4 4 Piterin metropoliten , 5 4 Vepsän Vikii , 6 4 Buranovon Baboid , 7 3 MySpace , 8 3 Euphoria , 9 3 Lorin , 10 3 Should've Known Better , 11 3 Evrovizii-2012 , 12 3 Venäman lidnad-millionerad , 13 3 Ogeruz i aznoičend , 14 3 Teräsbetoni , 15 3 Rabat , 16 3 Glittertind , 17 3 Viski , 18 3 Unheilig , 19 3 Üebermutter , 20 3 Rammstein , 21 3 Tatarstanan Tazovaldkund , 22 3 Udmurtijan Tazovaldkund , 23 3 12 (lugu) , 24 3 11 (lugu) , 25 3 10 (lugu)

jun 2012: 1 6 Lavin Avril , 2 5 Evropan futbolan čempionat 2012 , 3 5 Vikipedii , 4 4 Lorin , 5 4 Pälehtpol’ , 6 3 Bahreinan valdkundznam , 7 3 .bs , 8 3 Bagaman Sared , 9 3 Kubanin kozakišton hor , 10 3 Vepsän flag , 11 3 Norvegijan konstitucijan päiv , 12 3 Antiguan da Barbudan flag , 13 3 Belogorsk (Amuran agj) , 14 3 Blagodarnii , 15 3 Krasnodaran rand , 16 3 Jousne , 17 3 Joudjuden statui , 18 3 .us , 19 3 .dz , 20 3 FK Zenit Piter , 21 3 .al , 22 3 .nl , 23 3 Alamaiden valdkundznam , 24 3 Afganistanan valdkundznam , 25 3 .af

jul 2012: 1 4 Pohjoižsaamen Vikipedii , 2 4 Öbok , 3 3 Udmurtan Vikipedii , 4 3 Slovenijan kel' , 5 3 Evropan futbolan čempionat 2012 , 6 3 Turkanma , 7 3 Mozilla Firefox , 8 2 Centillion , 9 2 Grekan kirjamišt , 10 2 Taimir (lehtez) , 11 2 7-Zip , 12 2 Puht , 13 2 Šujan stancii , 14 2 Meliorativnii , 15 2 Bernar Sara , 16 2 Ehtbok , 17 2 Longibok , 18 2 Homendezbok , 19 2 Päivlaskm , 20 2 Päivnouzm , 21 2 Pohjoine , 22 2 Suvi , 23 2 Salavat Kupere , 24 2 Dakk , 25 2 Bangladeš

ago 2012: 1 4 Vilämovicen kel' , 2 4 Vn 2012 Kezaolimpiadan lopmižed , 3 2 Komin Vikipedii , 4 2 Ternopol' , 5 2 Fareran kel' , 6 2 Vagur , 7 2 Alitus , 8 2 Priozerskan rajon , 9 2 Priozersk , 10 2 Bugri (Vsevoložskan rajon) , 11 2 Vepsän ülüz , 12 2 Venäman flag , 13 2 Valaam , 14 2 .et , 15 2 Virrat , 16 2 Ferland Džodel' , 17 2 Hibbert Eleonor , 18 2 Nuori Karjala , 19 2 Breivik Anders Bering , 20 2 Regalado Tomas , 21 2 Windir , 22 2 Tanzwut , 23 2 Majami , 24 2 AÜV:oiden flag , 25 2 Anus (lidn)

set 2012: 1 4 Evrejan kel' , 2 4 Pälehtpol’ , 3 4 Google Chrome , 4 3 Virun kel' , 5 3 Vikingad , 6 3 Ristitun hibj , 7 3 A , 8 3 Ganter Henri , 9 3 Pussy Riot , 10 3 Ezmäine mail'man voin , 11 3 A7V , 12 3 Spalletti Lučano , 13 3 Fobijoiden nimikirjutez , 14 3 Fontanka.ru , 15 3 Modern Talking , 16 3 Polandball , 17 3 Grekan kirjamišt , 18 3 FK Zenit Piter , 19 3 Venälaižed , 20 3 Artut' , 21 3 Gändž , 22 3 Ostrav , 23 3 Brno , 24 3 Venän kel' , 25 3 Prag

out 2012: 1 4 Singapur , 2 4 Vologdan agj , 3 4 Rig , 4 3 Norvegijan Vikipedii , 5 3 Pohjoižen saldat (fil'm) , 6 3 Sar' (fil'm, Venäma, 2006) , 7 3 Dnestranrand , 8 3 Ahvenanma , 9 3 Grekanman Makedonii , 10 3 Šokolad , 11 3 Dom-2 , 12 3 Taivan' (sar') , 13 3 Pirahan (kel') , 14 3 Ternopol' , 15 3 Marti Petit Antoni , 16 3 Litvanma , 17 3 Vil'nüs , 18 3 Varšav , 19 3 Portlend (Oregon) , 20 3 Latvii , 21 3 Grekanma , 22 3 Evropan valdkundad , 23 3 Budapešt , 24 3 Berlin , 25 3 Albanii

nov 2012: 1 4 Vepsän rahvahan hor , 2 3 Lodehline aviabaz , 3 3 Kurgiden aig , 4 3 Kalarand , 5 3 «Ö»-kirjamen muštpacaz , 6 3 Mi? Kus? Konz? , 7 3 Tedr , 8 2 Pirgaine , 9 2 Randaine , 10 2 Duty free , 11 2 Jablonovskii-sild (Piter) , 12 2 Jablonovskii-sild (Krasnodar) , 13 2 Kegonpaniilind , 14 2 Pähkim , 15 2 Merikukoi , 16 2 Nug , 17 2 Habobatk , 18 2 In a Reverie , 19 2 Kodipühüt , 20 2 Kodipulo , 21 2 Jälinduine , 22 2 Kärg , 23 2 Näk , 24 2 Zor'alinduine , 25 2 Küuki

dez 2012: 1 3 Livin Vikipedii , 2 3 Gamburger , 3 3 Hot-dog , 4 3 Venäma Evrovizijas , 5 3 MySpace , 6 3 Naberežnije Čelni , 7 2 Ronson Šarlotta , 8 2 Mir (orbitine stancii) , 9 2 Bleeding Souls , 10 2 Ethereal (demo) , 11 2 Plazm , 12 2 Sleep of Right , 13 2 Lumenšur , 14 2 Hobednitid , 15 2 Kuzut om sündnu mecha , 16 2 Maseru , 17 2 Kindhad , 18 2 Truganini , 19 2 Happy Tree Friends , 20 2 Letsie III , 21 2 Suomalaine veič , 22 2 Tüp , 23 2 Nin' , 24 2 Britanijan Kuldrand , 25 2 Renault Logan

jan 2013: 1 3 Vederistmad , 2 3 Grand Theft Auto: San Andreas , 3 3 Vologdan agj , 4 2 Evenalaižed , 5 2 Evenkalaižed , 6 2 Udinalaižed , 7 2 Lumiuk , 8 2 Darginalaižed , 9 2 De Agostini , 10 2 I'm Not Afraid , 11 2 Bela Lugosi's Dead , 12 2 Wide Awake (Lacuna Coil:an pajo) , 13 2 I Won't Tell You , 14 2 Ragozina Natal'ja , 15 2 Enjoy the Silence , 16 2 Swamped , 17 2 Vepsän mifologii , 18 1 Leonardo Forti

fev 2013: 1 3 Jožin z bažin , 2 3 Pori , 3 3 Lihtenštein , 4 2 Nor'mik , 5 2 Norhein , 6 2 Habinod , 7 2 Bard (hibused) , 8 2 Real,- , 9 2 Raum , 10 2 Etimologii , 11 2 Kolin norvegijalaižed , 12 2 Lukumades , 13 2 Gitar , 14 2 Tofalaralaižed , 15 2 Doncova Dar'ja , 16 2 Lužkovan stil' , 17 2 Eht , 18 2 Orokalaižed , 19 2 Ö (aig) , 20 2 Ul'čilaižed , 21 2 Laškuzlidn , 22 2 Jugalaižed , 23 1 MOS Technology 6502

mar 2013: 1 4 Venälaine literatur , 2 4 Kitai , 3 3 Merežkovskii Dmitrii , 4 3 Bad Boys Blue , 5 3 Heitämine (serial) , 6 2 Leningradalaine zoopuišt , 7 2 Obuhovan Kaičendan prospekt , 8 2 Hamid Abdul , 9 2 Klüjev Nikolai , 10 2 Antresol' , 11 2 Lindemann Till' , 12 2 C.E.B. Reas , 13 2 Zencov Roman , 14 2 C. C. Catch , 15 2 Ph. Patrikan päiv , 16 2 Buraka Som Sistema , 17 2 Vasil'jev Boris , 18 2 Kaks'nik (starin) , 19 2 Ižand Proharčin , 20 2 Vändai (roman) , 21 2 Voin i kožmuz , 22 2 Domostroi , 23 2 Adams Duglas , 24 2 Rahvahankeskeine naižiden päiv , 25 2 Dahno Vladimir

abr 2013: 1 3 Kel'tižed keled , 2 3 Kečuan kel' , 3 3 Šotlandijan kel' (kel'tine) , 4 2 Dirbal , 5 2 Puhtaz, ajatud , 6 2 Sekret Uspeha , 7 2 Birbincpühäpäiv , 8 2 Šizofrenii , 9 2 Depressii , 10 2 Sanskrit , 11 2 Ficdžeral'd Ella , 12 2 Nganasanan kel' , 13 2 Subway Surfers , 14 2 Cut the Rope , 15 2 Čukčan kel' , 16 2 Hüväd öd, čočod! , 17 2 Welcome to the Heartbreak Hotel , 18 2 Kirj , 19 2 Surman kel'dand , 20 2 Haki (kel'kanz) , 21 2 Guaranin kel' , 22 2 Eiler Leonard , 23 2 Tuskaroran kel' , 24 2 I Can Lose My Heart Tonight , 25 2 Kombinacija

mai 2013: 1 3 Evrovizii-1956 , 2 3 Odess , 3 3 You're My Heart, You're My Soul , 4 3 Vepsän kel' , 5 3 Pil'ved , 6 2 Likutimveneh , 7 2 Kater , 8 2 Veneh , 9 2 You Shot a Hole In My Soul , 10 2 Hear What I Say , 11 2 Čistalöv Veniamin , 12 2 Azartvänd , 13 2 Diamonds , 14 2 Jankulov Stojan , 15 2 Sport , 16 2 Jumal , 17 2 Džakart , 18 2 I'm No Rockefeller , 19 2 One In a Million , 20 2 Good Guys Only Win in Movies , 21 2 Tilli Džennifer , 22 2 Kannad , 23 2 Vägestusen päiv , 24 2 Vepsän grammatik , 25 2 Kulič

jun 2013: 1 4 Moskv-Siti , 2 3 Kahtišti koumekümne koume , 3 3 Juhannus , 4 3 Mahfuz Nagib , 5 3 Psalmoiden kirj , 6 3 Lönnrot Elias , 7 3 Biblii , 8 2 Baltika (oludenkeituden kompanii) , 9 2 Hala , 10 2 Kall' (külä) , 11 2 Kobencl' Lüdvig fon , 12 2 Mišel' (pajatai) , 13 2 Petti Rajan , 14 2 Tullei , 15 2 Valendas , 16 2 Fasmer Maks , 17 2 Gar d'Aržikur P'jerrpon , 18 2 Optimal , 19 2 Virtanen Veikko , 20 2 Komiks , 21 2 Semönov Pötr , 22 2 Mompha edax , 23 2 Iče minä , 24 2 Marginal , 25 2 Eristalis intricarius

jul 2013: 1 3 Vepsän küläd , 2 3 Rand (külä, Vepsän rahvahaline küläkund) , 3 3 Reprua , 4 3 Latinan frazoiden nimikirjutez , 5 2 C. C. Catch:an pajod , 6 2 Keimada Grandi , 7 2 Jumal! Abuta minei jäda henghe kesked necidä surmarmastust , 8 2 Zanin Artöm , 9 2 Synodontis pardalis , 10 2 Ptychogena antarctica , 11 2 Dendrilla elegans , 12 2 Heteropoda shillongensis , 13 2 Slavine neopaganuz , 14 2 Tur de Frans , 15 2 I Will Survive , 16 2 Aksintant , 17 2 Süvärensu , 18 2 Gaudi Antonio , 19 2 Znamasižiden evrodiskoedestajiden nimikirjutez , 20 1 You Suffer

ago 2013: 1 2 Puerto Iguasu , 2 2 Ročilaine laud , 3 2 Ištui Härg , 4 2 Venä , 5 2 Kahesan nellikon identižuz , 6 2 Ruskedvauvaz vin , 7 2 Mail'manpän Sar' (ATOW1996) , 8 2 Niinistö Sauli , 9 2 Jufit Jevgenii , 10 2 Francijalaižiden fil'miden festival' Malagas , 11 2 Oksitanan kel' , 12 1 Änižen kanal

set 2013: 1 2 Inkeriläižed , 2 2 Karr Sara Rouz , 3 2 Žirinovskii Vladimir , 4 2 Palatoi lugu , 5 2 Mec , 6 2 Secret Star , 7 2 I Can Lose My Heart Tonight '99 , 8 2 Kitai , 9 2 Haapsalu , 10 2 You're My Heart, You're My Soul , 11 2 Vepsän ülüz , 12 2 Saha Tazovaldkund , 13 2 Afganistan , 14 2 Možg , 15 2 Vepsän Vikipedii , 16 1 Koreb Elidaspäi

out 2013: 1 2 Frigga pratensis , 2 2 Belisana strinatii , 3 2 Kelenmagii , 4 2 Nagriž , 5 2 Päč , 6 2 WASP-64 , 7 1 Boa

nov 2013: 1 3 Boršod Abaui Zemplen , 2 3 Eger (lidn) , 3 3 Heveš (agj) , 4 3 Mad'jaranman lidnad , 5 3 Japonii , 6 3 Muil , 7 3 Queen , 8 2 Jas Nad'kun Sol'nok , 9 2 Kapošvar , 10 2 D'jor , 11 2 Kečkemet , 12 2 Miškol'c , 13 2 Debrecen , 14 2 Bač Kiškun , 15 2 Pešt (agj) , 16 2 Sabol'č Satmar Bereg , 17 2 .hu , 18 2 31 (lugu) , 19 2 Tok-pisin

dez 2013: 1 4 Lindberg Čed , 2 4 Töröčik Mari , 3 3 Garipova Dina , 4 3 Blek Lukas , 5 3 Emi S'juzi , 6 3 Disnei Uolt , 7 3 Buše Viktor , 8 3 Uusberg Pärt , 9 3 Keil (lidn) , 10 3 Vas (lidn) , 11 3 Laht (lidn) , 12 3 Mad'jaranman agjad , 13 3 Peč , 14 3 Ferland Džodel' , 15 2 Itson Meri Ellen , 16 2 Volčkov Sergei Valer'jevič , 17 2 Golos , 18 2 Holodnaja Vera , 19 2 Kalašnikov Mihail , 20 2 Džerri (fil'm) , 21 2 Pekuin Anna , 22 2 Roman Pol , 23 2 Jakobi Doreen , 24 2 De Montema Damian , 25 2 Vepsläižen kodin südäin

jan 2014: 1 3 Moskv-Siti , 2 2 Karlton Lending , 3 2 Zell' , 4 2 Uorhol Endi , 5 2 Silence , 6 2 Unborn Love , 7 2 Rait Frenk Lloid , 8 2 Le Korbüz'je , 9 2 Dürer Al'breht , 10 2 Dvoržak Antonin , 11 2 Goja Fransisko , 12 2 Rubens Piter , 13 2 Umbrine škol , 14 2 Rafael' Santi , 15 2 Tverin agj , 16 2 Lendai alamalaine , 17 2 Anomalii , 18 2 Mägi , 19 2 Kalo Frida , 20 2 Protistad , 21 2 Muiktuz , 22 2 Himine ühtnend , 23 2 Biohimii , 24 2 Himii , 25 2 Need for Speed: Pigusen himo

fev 2014: 1 2 Armastusen tippud , 2 2 Heimolaižuz , 3 2 Mumbai , 4 2 Indijan štatad da territorijad , 5 2 Nothing Stands In Our Way , 6 2 Hameleonad (serial) , 7 2 Lapsed (serial, Brazilii, 2013) , 8 2 Brazilii-kolledž , 9 2 Satatadud südäikerad , 10 2 Japonine kanang , 11 2 Karusel' (serial, Brazilii, 2012) , 12 2 Vn 2014 Tal'volimpiadan lopmižed , 13 2 Laos , 14 2 Kudentoštkümnen nellikon identižuz

mar 2014: 1 2 Kall'oikahad mäged , 2 2 Bangalor , 3 2 Krim (Ukrainan region) , 4 2 Korejan Tazovaldkund , 5 2 Čennai , 6 2 So , 7 2 Maim , 8 2 Need for Speed: Pigusen himo , 9 2 Vepsän küläd , 10 2 Bass Sol , 11 2 Venesuel , 12 2 Uz' Zelandii , 13 2 Avstralii (valdkund) , 14 2 Arhangel'sk , 15 2 Nikaragua (valdkund) , 16 2 Igark , 17 2 Suviamerik , 18 1 Česmen jumalanpert'

abr 2014: 1 3 Urugvai , 2 3 The Doors , 3 3 Voihein , 4 2 Sevastopol' , 5 2 Feodosii , 6 2 Nellikod (kartankarv) , 7 2 Džomolungm , 8 2 Venäman federaližiden ümbrikod , 9 2 Suviafrikan Tazovaldkund , 10 2 Kilimandžaro , 11 2 Sabett , 12 2 Nencan kel' , 13 2 Jumalanbembel' , 14 2 Vederistmad , 15 2 Grand Theft Auto: San Andreas , 16 2 Buenos Aires , 17 2 Hristanuskond , 18 1 Koktebel'

mai 2014: 1 3 Luganskan Rahvahaline Tazovaldkund , 2 3 Ukrain , 3 2 Suomen Vikipedii , 4 2 Jun Hen Sik , 5 2 Seong Dže-gi , 6 2 Marijampole , 7 2 Varghuz (lidn) , 8 2 Lund , 9 2 Viborg (Danii) , 10 2 Krim (Ukrainan region) , 11 2 Eupithecia turpis , 12 2 Takkiž , 13 2 Kislovodsk , 14 2 Mail'man valdkundad , 15 2 Rostov Donal , 16 2 Tallidn , 17 2 Suomenma , 18 1 Deborra-Li Förness

jun 2014: 1 2 Katar , 2 2 Malaizii , 3 2 Mongolii , 4 2 Tailand , 5 2 Tadžikistan , 6 2 Kano , 7 2 Tokio , 8 2 Tün' valdmeri , 9 2 Sevastopol' , 10 2 Džeronimo , 11 2 Öhabuk , 12 2 Ortodoksine hristanuskond , 13 2 Atlantine valdmeri , 14 1 In Čžen

jul 2014: 1 2 Egipt , 2 2 Sudan , 3 2 33 (lugu) , 4 2 Uusberg Pärt , 5 2 Novodvorskaja Valerija , 6 1 Ceilon

ago 2014: 1 4 Marilaine veroline religii , 2 3 Saba Isak , 3 3 Master i Margarita , 4 3 Kodima , 5 2 Kostarik , 6 2 Sur' Munamägi , 7 2 Vil'jandi , 8 2 Sudan , 9 2 Moskvan prospekt (Piter) , 10 2 Dakk , 11 2 Nikaragua (znamoičendad) , 12 2 Viluku , 13 1 Madagaskar (valdkund)

set 2014: 1 3 Paragvai , 2 3 Ugand , 3 3 Canada , 4 3 Coca-Cola , 5 2 Järgeline pölvaz , 6 2 Kekkonen Urho , 7 2 Koivisto Mauno , 8 2 Hel'singfors , 9 2 Senegal , 10 2 Kamerun , 11 2 Bolivii , 12 2 Nauru , 13 2 Ternopol' , 14 1 Paragvain Tazovaldkund

out 2014: 1 2 Bol , 2 2 Abai (znamoičendad) , 3 2 Abai , 4 2 Al'tamir (mägionduz) , 5 2 Indonezii , 6 2 Antigua da Barbud , 7 2 Pol'šanma , 8 1 Abazilaižed

nov 2014: 1 2 Kanoe Pessespäi , 2 2 Baženov Timofei , 3 2 Baženovan reiting , 4 2 Strub , 5 2 Lobez (lidn) , 6 2 Pöud (maižanduz) , 7 2 Pöud , 8 2 Marilaižiden tradicionaline uskond , 9 2 Tadžikistan , 10 1 Karbaz

dez 2014: 1 3 Lobez (lidn) , 2 2 Igor' Strelkov , 3 2 Gladius , 4 2 Pavlodar , 5 1 Vologdan pörutügitegim

jan 2015: 1 3 Reigan Ronal'd , 2 3 NGC 217 , 3 3 NGC 239 , 4 3 NGC 244 , 5 2 Sal'vador , 6 2 Germanii (znamoičendad) , 7 2 NGC 171 , 8 1 Suksed

fev 2015: 1 3 Modaižed sobad , 2 2 Gvinei Bisau , 3 2 Afrikan valdkundad , 4 2 Pakistan , 5 2 Heitämine (serial) , 6 2 Säs' , 7 2 Ukrain , 8 1 Grekanman Tazovaldkund

mar 2015: 1 3 Urugvai , 2 3 Sithine kuz' , 3 2 Hanko , 4 2 Uusikaupunki , 5 1 Hangö

abr 2015: 1 4 Amerikan Ühtenzoittud Valdkundad , 2 3 Lepai , 3 3 Stojalov Maksim , 4 3 Damask , 5 3 Odess , 6 3 Vagolind , 7 3 Gorodovikovsk , 8 3 Lipeck , 9 3 Venäma , 10 3 Händikaz , 11 2 Sestrikaine , 12 2 Douson Doris , 13 2 Bridgetown , 14 2 Bridžtaun (lidn, Barbados) , 15 2 Thimphu , 16 2 Lohi , 17 2 Butan , 18 2 Naip'jido , 19 2 Pasklindud , 20 2 Džordžtaun , 21 2 Bogot , 22 2 Džordžtaun (Gajan) , 23 2 Ottav , 24 2 Dušanbe , 25 2 Ulanbatar

mai 2015: 1 4 Stojalov Maksim , 2 3 Baotou , 3 3 Valans'jen , 4 3 Klivlend , 5 3 Enn Arbor (Mičigan) , 6 3 Läojuan' , 7 3 Nagoi , 8 3 Brazzavil' , 9 3 Dakar , 10 3 Painmižpästandoiden nimikirjutez materialoidenke vepsän kelel , 11 3 Los Andželes , 12 3 Gajan , 13 3 Neue Deutsche Härte , 14 3 Kizlär , 15 3 Izberbaš , 16 3 Varšav , 17 2 Tuluz , 18 2 Fort Loderdeil , 19 2 Čikago , 20 2 Milan , 21 2 Florencii , 22 2 Šäuläi , 23 2 Panevežis , 24 2 Elgav , 25 2 Sillamäe

jun 2015: 1 3 Lobez (lidn) , 2 3 Trpin' , 3 3 Zelöna Gur , 4 2 Lüneburg , 5 2 Fell'bah , 6 2 Džidd , 7 2 Štutgart , 8 2 Sanderlend , 9 2 Sanderlend (Anglii) , 10 2 Grenobl' , 11 2 Ekseter , 12 2 Hanau , 13 2 Kassel' , 14 2 Beliz (lidn) , 15 2 Remedios (Kuba) , 16 2 Sidzuok , 17 2 Piterboro (Ontario) , 18 2 Vik (Saksanma) , 19 2 Jan'tai , 20 2 Batum , 21 2 Cincinnati , 22 2 Parm , 23 2 Sekuen' , 24 2 Subotic , 25 2 Toledo (Ogajo)

jul 2015: 1 3 Ngerulmud , 2 3 Tbilis , 3 3 Danii , 4 2 Saratamat , 5 2 Lakatoro , 6 2 Isangel , 7 2 Luganvill , 8 2 Sol (Vanuatu) , 9 2 Sjudad de la Kost , 10 2 Alei , 11 2 Sidon , 12 2 Zahle , 13 2 Tripoli (Livan) , 14 2 Galle , 15 2 Džafn , 16 2 Margilan , 17 2 Kokand , 18 2 Fergan , 19 2 Namangan , 20 2 El' Ain , 21 2 Kordov , 22 2 Rosario , 23 2 Mary , 24 2 Jangon , 25 2 Haidarabad

No data on this page have been normalized to 30 day months (as WMF does on certain traffic reports).
Wikipedias are initially ordered by number of speakers of the language

Speakers: Number of speakers of a language is the estimated total of primary and secondary speakers, is in many cases a very rough estimation (based on the page on the English Wikipedia about that language)
Regions are parts of the world where the language is spoken in substantial amounts (compared to total number of speakers). Regions where a language gained presence only by a recent diaspora are generally not included.
Region codes: AF:Africa, AS:Asia, EU:Europe, NA:North America, OC:Oceania, SA:South America, W:World Wide, CL:Constructed Language

Estatísticas geradas em Segunda-feira, 24 de agosto 2015 11:57

Dump file vepwiki-20150805-stub-meta-history.xml.gz (edits only), size 4.6 Mb as gz -> 31 Mb
Dump processed till Jul 31, 2015, on server stat1002, ready at Sat-22/08/2015-02:29 after 29 sec.

Versão do script:2.6
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.