Estatísticas da Wikipédia vepsian

Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Articles per size range / Records per namespace / Most edited articles / Zeitgeist

Most metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.

Some metrics have been collected from the full archive dump which runs on lower frequency than the usual monthly cycle.
These metrics are columns F,I,J,K,M,N,O,P,Q,R from the first table.

See also metrics definitions

Monthly counts & Quarterly rankings: dezembro 2014
DataWikipedistasArtigosBase de dadosLigações
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
Dec 20140%   0%      -48%      +1%
Nov 20140%   0%      -6%      +1%
Oct 20140%   0%      -31%      +2%
Sep 20140%   +1%      -42%      +3%
Aug 2014+2%   +1%      +113%      +4%
Jul 20140%   0%      -20%      +1%
Dec 201450 2 4,1 k  10,6   76      1,1 k
Nov 201450 3 4,1 k 110,6   146      1,1 k
Oct 201450 2 4,1 k  10,6   155      1,1 k
Sep 201450 314,1 k 110,6   226      1,1 k
Aug 2014501414,1 k 110,6   389      1,1 k
Jul 201449 214,0 k 110,5   183      1,0 k
Jun 20144915 4,0 k 110,5   228      1,0 k
May 201448 214,0 k 110,6   404      998
Apr 201448 323,9 k 210,6   484      976
Mar 201448 423,9 k 110,6   610      943
Feb 201448 413,8 k2,1 k110,644521%3%2912,6 Mb228 k23 k1361921,0 k929
Jan 201448 413,8 k2,1 k210,644120%3%7462,6 Mb224 k23 k137192996912
Dec 2013481723,8 k2,0 k310,543120%3%8512,5 Mb216 k22 k172191975871
Nov 2013472713,7 k1,9 k210,642119%3%3012,3 Mb206 k21 k175190938825
Oct 201345 313,6 k1,9 k210,641419%3%3312,3 Mb201 k20 k176184933814
Sep 201345 4 3,6 k1,8 k110,741519%3%2072,2 Mb197 k20 k175184917801
Aug 201345 313,5 k1,8 k210,741319%3%2152,2 Mb195 k20 k168182913792
Jul 201345 413,5 k1,8 k210,841319%3%3822,2 Mb193 k19 k205182910778
Jun 2013451423,4 k1,7 k410,941118%3%6312,1 Mb188 k19 k215181895752
May 201344 423,3 k1,6 k311,140518%3%5652,1 Mb179 k18 k281179873684
Apr 201344 423,2 k1,6 k611,239918%3%8722,0 Mb171 k17 k376181791664
Mar 201344 613,0 k1,5 k411,640118%3%3,8 k1,9 Mb163 k16 k1,3 k181747633
Feb 201344 412,9 k1,4 k310,739719%3%1,5 k5,0 Mb156 k15 k134 k179713603
Jan 201344 512,8 k1,4 k310,540019%3%1,6 k4,9 Mb153 k14 k131 k187704586
Dec 2012443622,8 k1,3 k810,240319%3%2,4 k4,8 Mb149 k14 k128 k200691573
Nov 2012411622,5 k1,3 k910,241720%3%2,3 k4,5 Mb141 k13 k119 k220637515
Oct 20124041022,3 k1,1 k610,442421%3%2,5 k4,2 Mb128 k11 k112 k241559448
Sep 2012361632,1 k969610,241820%3%3,3 k3,8 Mb114 k9,5 k104 k259486382
Aug 201235 711,9 k85829,441020%3%1,3 k3,5 Mb102 k7,6 k98 k371399313
Jul 201235 421,8 k81329,140520%3%1,4 k3,4 Mb97 k7,1 k95 k433366292
Jun 2012351631,7 k784158,639920%3%2,9 k3,3 Mb93 k6,6 k93 k535376273
May 2012342631,3 k681159,244924%4%2,0 k2,6 Mb78 k5,2 k75 k718311163
Apr 201232261843573311,956332%5%8772,1 Mb64 k3,8 k60 k768203135
Mar 20123027176651031255029%5%1,0 k2,0 Mb57 k3,2 k55 k837154108
Feb 2012283123672442312,156932%6%2,5 k1,8 Mb52 k2,8 k50 k94914596
Jan 201225 4 59338229,558233%6%2421,6 Mb47 k2,5 k46 k87412185
Dec 20112516254233749,958632%7%6391,5 Mb44 k2,3 k42 k80812168
Nov 201124 5 419256 11,360536%7%5831,2 Mb35 k2,0 k33 k56410952
Oct 201124121406252 10,261737%7%2211,2 Mb35 k1,9 k31 k55211049
Sep 20112327 398251 9,962838%8%1211,2 Mb35 k1,9 k30 k54810949
Aug 20112157 38823819,861438%7%1741,1 Mb33 k1,9 k30 k52010445
Jul 201116 11370220 9,859836%7%1251,1 Mb31 k1,8 k29 k5099545
Jun 20111614 370215 9,553734%5%871,1 Mb28 k1,6 k29 k5127044
May 201115 6 366210 9,353734%5%2691,1 Mb27 k1,6 k29 k5116944
Apr 201115 5 364208 8,753433%5%1111,0 Mb27 k1,6 k28 k5066844
Mar 201115 8136020218,450631%5%3121,0 Mb25 k1,5 k28 k5006144
Feb 201115 61339185 845729%4%298947 kb22 k1,2 k26 k4683721
Jan 20111524233217727,341927%4%622917 kb20 k1,1 k26 k4593016
Dec 201013151267106 6,838019%4%216642 kb14 k95618 k3012111
Nov 201012342260105 6,142120%5%298477 kb15 k89211 k2952011
Oct 20109   24896 5,235020%4% 260 kb12 k7824,4 k2561211
Sep 20109   24896 5,235020%4% 260 kb12 k7824,4 k2561211
Aug 20109   24896 5,235020%4%3260 kb12 k7824,4 k2561211
Jul 20109   24796 5,235120%4%7260 kb12 k7804,4 k2551211
Jun 20109   24796 5,235120%4%1260 kb12 k7804,4 k2551211
May 20109   24796 5,235120%4%5260 kb12 k7794,4 k2551211
Apr 20109   24494 5,235020%4%2257 kb12 k7524,4 k2511211
Mar 2010922124494 5,235020%4%169257 kb12 k7524,4 k2521211
Feb 20107   23990 4,636020%4%4224 kb12 k1983,5 k247811
Jan 20107   23990 4,636020%4%2224 kb12 k1983,5 k247811
Dec 20097 1 23990 4,636020%4%74224 kb12 k1983,5 k246811
Nov 20097 112399014,336020%4%202222 kb12 k1983,5 k246811
Oct 20097 112176823,828912%3%150190 kb9,2 k1793,4 k172811
Sep 2009712 1665414,130211%4%133163 kb7,1 k1853,3 k8588
Aug 20096 1 14536 3,727410%3%692 kb5,6 k931,4 k6824
Jul 20096 1 14435 3,727510%3%1491 kb5,5 k931,4 k6724
Jun 20096   14232 3,726911%3% 88 kb5,3 k691,3 k6524
May 20096   14232 3,726911%3% 88 kb5,3 k691,3 k6524
Apr 2009611 14232 3,726911%3%1388 kb5,3 k691,3 k6524
Mar 2009513 14130 3,625710%3%2886 kb5,1 k451,3 k6224
Feb 20094 2 13628 3,525510%3%3785 kb5,0 k411,3 k6324
Jan 200942411232223,62268%2%28277 kb4,1 k301,3 k6024
Dec 20082 2 503 3,21334%2%1220 kb1,1 k1135516 3
Nov 20082   483 3,11324%2% 16 kb1,0 k724714 3
Oct 20082   483 3,11324%2% 16 kb1,0 k724714 3
Sep 20082   483 3,11324%2% 16 kb1,0 k724714 3
Aug 20082   483 3,11324%2% 16 kb1,0 k724714 3
Jul 20082 1 483 3,11324%2%716 kb1,0 k724714 3
Jun 20082   423 3,41465%2% 15 kb99272418 3
May 20082 1 42313,41465%2%4215 kb99272418 3
Apr 20082 2 213 4,724110%5%1510 kb88571192 3
Mar 20082 1 172 4,91636% 225,1 kb4874161 3
Feb 2008221 142 4,41827% 624,3 kb4592141 3
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternas

> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
The following table ranks this project in relation to projects in other languages with 1000+ articles
Note: data for month(s) after Nov 2014 for one or more large projects are not yet known.
As a temporary approximation missing data for a project are substituted by the highest historic value for that project.
Once those missing data are available final rankings for recent months can shift one or more positions.
Oct 2014175 172 164  200   149      240
Jul 2014175 165131164 147198   152      240
Apr 2014174 152101162 120194   119      240
Jan 2014171166138138161175126194199192195115194190179214218185240
Oct 2013171149153126159174116196201195196126197191182215219188240
Jul 2013170140136132159175116195199195197127196191182215219186240
Apr 201317014614110516518088191201195195130198195184203218188240
Jan 2013169147125139169181109195196190192157192198184171215189240
Oct 2012171799410018018484192194188191128196201190175211195240
Jul 2012176138140105186194118197193188190164201205204181194201240
Apr 2012182100115138208199106206205205203190210218218197168217240
Jan 2012195153141139214209121205204204202223215222225204163222240
Oct 2011194135171135222217158204203203201228220226225215181221240
Jul 2011218149188133220218165201200200198234220224224213179223240
Apr 2011219144126132219215159196195195193232218222225210178225240
Jan 201121898136101219217117194193193191204224226224208179232240
Oct 2010225150212129222221153189188188186239231228226230197235240
Jul 2010223159218141221221158183182182180238230225223230196233240
Apr 2010221150204135218218158181180180179237227225223226192231240
Jan 2010226144198131216219154179179179178236228225228229194233240
Oct 2009223142189129215220120176176176175216228226230227200233240
Jul 2009222189185132219223149172172172171231231227233229217235240
Apr 2009221127187141217223145170170170169232229226231228214233240
Jan 200923196127126217224121164164164163200229226234226213234239
Oct 2008233135197129224234144158158158157234232232235229228234238
Jul 2008231147187133220231147152152152150229229229234228224233237
Apr 2008230143163130226229149147147146144226230230233228228231237
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
 WikipedistasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikipedistas (usuários registrados)
A = Wikipedistas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikipedistas que editaram pelo menos dez vezes desde que chegaram
C = Wikipedistas que contribuíram cinco vezes ou mais este mês
D = Wikipedistas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Artigos que contêm pelo menos uma ligação interna e 200 caracteres de texto legível, não contando códigos wiki e html,
      ligações ocultas, etc.; títulos também não contam (outras colunas são baseadas no método oficial de contagem)
G = Novos artigos por dia no mês passado
H = Número médio de revisões por artigo
I = Tamanho médio dos artigos em bytes
J = Porcentagem de artigos com pelo menos 0,5 kb de texto legível (veja F)
K = Porcentagem de artigos com pelo menos 2 kb de texto legível (veja F)

Base de dados
L = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
M = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
N = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

O = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
P = Total de ligações para outras wikipédias
Q = Total de imagens apresentadas
R = Total de ligações para outros sítios
S = Total de páginas de redirecionamento

Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  5  10  100  1000  1  3  5  10  25  100  1  3  5  10  25  100  250  5  10  100 
Monthly counts for recent history of wiki
Dec 201472222      421    71111     
Nov 2014104322      42     7421      
Oct 201494222      421    7211      
Sep 20141453321      621    93221     
Aug 201415443211     6221   104411     
Jul 20141122111      5332   42221     
Jun 2014166522      53211  73311     
May 201421721111     943211 123111     
Apr 201410332221     43211  72221     
Mar 201411642221     63211  102222     
Feb 20141054211      63321  1032111    
Jan 201414544411 11  74422  1065411 1  
Dec 201316877621     96542  137442     
Nov 20131287541      83331  175422     
Oct 20135333211     4211   6211      
Sep 2013135421      64111  10522      
Aug 2013833221  1   5211   42221  211
Jul 20131654331      53321  95411     
Jun 201316644321 1   98622  74222  1  
May 201315544321 1   54322  1354421 11 
Apr 201317544222 33  53221  97421  331
Mar 20131966421  872163221  125421  542
Feb 20131774321  1293 83221  174211  651
Jan 20131155431  15123 632111 143321  661
Quarterly counts for entire history of wiki
Oct 201494222      421    7211      
Jul 20141122111      5332   42221     
Apr 201410332221     43211  72221     
Jan 201414544411 11  74422  1065411 1  
Oct 20135333211     4211   6211      
Jul 20131654331      53321  95411     
Apr 201317544222 33  53221  97421  331
Jan 20131155431  15123 632111 143321  661
Oct 20121910108521 1383 94332  18854311762
Jul 201215644221 1083 832111 2763222 66 
Apr 20121466431  11102 9541   16642   53 
Jan 201275442      54332  32211     
Oct 2011722111      1      1111      
Jul 2011111111  1          21        
Apr 201165541      1      21        
Jan 20115444221     421    4332      
Oct 2010          1                
Jul 2010      1          111       
Apr 20101                2211      
Jan 2010                           
Oct 2009221111             11111     
Jul 20091111                        
Apr 2009221                         
Jan 2009444331      332    32222     
Oct 2008                           
Jul 2008211                         
Apr 2008222                         


Distribuição de edições de artigos por wikipedistas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...

Edições >=WikipedistasEdições total


5 wikipedistas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias

 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
30 dias
30 dias
30 dias
30 dias
KoiravvaUC4+11,5303958531Oct 21, 20128001275--
Adriano MorelliUC11+126828487May 12, 20142327---
Jerzyjan1UC56+7811-Aug 11, 20141411---
МеридианецUC101+7332--Mar 22, 20121013----
1yurokUC294...11--Dec 07, 201423----


20 wikipedistas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

  Primeira ediçãoúltima edição
Tamara UstinovaUC19,044Oct 19, 20111168May 26, 2014218
SebranikUC22,578May 15, 2012959Nov 29, 201431
SihlaineUC32,213Nov 05, 2013420Sep 05, 2014116
МаксимUC51,503Dec 29, 20111097Jul 07, 2014176
IgriksUC61,461Sep 18, 20091929May 14, 2013595
Игорь БродскийUC71,261Feb 23, 20092136Jan 13, 2014351
IketsiUC81,165Jun 15, 20111294Jul 30, 2014153
Andrijko Z.UC9769Nov 08, 20101513Nov 20, 20111136
MF-WarburgUC10680Feb 01, 20121063Feb 07, 2013691
SuraUC12264Feb 19, 20082506Mar 29, 2014276
Midnight GreenUC13202Aug 24, 20111224Jun 25, 2012918
Triple-ADHD-ASUC14156Jan 17, 20092173Dec 09, 20091847
PorbóllettUC15152Nov 24, 2013401Jun 25, 2014188
U.SteeleUC16139Aug 11, 20111237Jul 20, 2012893
RomaineBotUC17130Mar 30, 20101736Mar 30, 20101736
Connection 3UC18108Jun 27, 2013551Sep 21, 2013465
BudelbergerUC1990Dec 11, 20082210Feb 22, 20092137
CastellumUC2086Oct 15, 2012806Oct 20, 2012801
O'zqonUC2185Aug 25, 2012857Oct 25, 2012796
Gleb BorisovUC2283Nov 30, 20101491May 16, 20111324


Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 778 edições foram feitas por usuários anônimos, de um total de 43499 edições ( 1e %)

41 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
EmausBotUC14,375Feb 03, 20121061Jan 16, 2014348--
MerlIwBotUC23,510May 10, 20111330Aug 09, 2013508--
AddbotUC32,947Mar 07, 2013663Aug 19, 2013498--
XqbotUC41,791Apr 16, 2012988Mar 06, 2013664--
GerakibotUC5559May 24, 2012950Mar 06, 2013664--
JackieBotUC6555Feb 09, 20121055Mar 02, 2013668--
AvocatoBotUC7542Feb 08, 20121056Jul 10, 2012903--
LegobotUC8411Mar 11, 2013659Apr 02, 2013637--
RedBotUC9381Apr 21, 2012983Aug 21, 2012861--
JAnDbotUC10354Feb 03, 20121061Jul 02, 2013546--
Idioma-botUC11229Feb 03, 20121061Mar 05, 2013665--
YFdyh-botUC12204Jun 24, 2012919Feb 27, 2013671--
Makecat-botUC13185Oct 26, 2012795Mar 05, 2013665--
HiW-BotUC14173Feb 05, 20121059Nov 08, 2012782--
LaaknorBotUC15134Feb 04, 20121060Mar 03, 2013667--
Justincheng12345-botUC16129Jun 23, 2012920Jan 08, 2013721--
Luckas-botUC17115Apr 01, 20121003May 20, 2012954--
VolkovBotUC18107Feb 14, 20121050Mar 04, 2013666--
AvicBotUC1992Jun 01, 2012942Dec 09, 2012751--
EscarbotUC2072Mar 06, 20121029Mar 03, 2013667--
KLBot2UC2169Apr 13, 2013626Jul 07, 2013541--
VagobotUC2253Feb 29, 20121035Sep 04, 2012847--
SantoshBotUC2341Oct 24, 2012797Mar 04, 2013666--
PixelBotUC2433Feb 20, 20121044Mar 03, 2013667--
KamikazeBotUC2533Feb 29, 20121035Jan 26, 2013703--
CarsracBotUC2630Feb 12, 20121052Feb 24, 2013674--
SynthebotUC2725May 16, 2012958Dec 30, 2012730--
WikitanvirBotUC2820Feb 04, 20121060Apr 05, 2012999--
RobbotUC2919Feb 04, 20121060Sep 02, 2012849--
JotterbotUC3014Jan 15, 2013714Jan 26, 2013703--
DragonBotUC3111Jan 12, 2013717Jan 14, 2013715--
タチコマ robotUC3210Dec 28, 20111098Oct 21, 2012800--
SassoBotUC339May 29, 2012945Mar 04, 2013666--
GhalyBotUC348Dec 27, 2012733Jan 31, 2013698--
CompBotUC357Mar 24, 20121011May 21, 2012953--
CocuBotUC367Nov 30, 2012760Feb 11, 2013687--
CommonsDelinkerUC376Sep 30, 20091917Jan 04, 20121091--
NjardarBotUC384Jun 16, 2012927Oct 27, 2012794--
MastiBotUC392Feb 26, 2013672Feb 28, 2013670--
MalarzBOTUC401Aug 18, 2012864Aug 18, 2012864--
TXiKiBoTUC411Dec 20, 2012740Dec 20, 2012740--


Artigos que contêm pelo menos uma ligação interna e .. caracteres de texto legível, não contando códigos wiki e html,
ligações ocultas, etc.; títulos também não contam  (excluindo páginas de redirecionamento)

 < 32 ch< 64 ch< 128 ch< 256 ch< 512 ch< 1 k ch< 2 k ch< 4 k ch< 8 k ch< 16 k ch< 32 k ch< 64 k ch


Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.

categorizados 1
Dec 20145,2 k5036152740811,3 k       502
Nov 20145,2 k4996152740811,3 k       502
Oct 20145,2 k4966152740711,2 k       502
Sep 20145,2 k4946052740711,2 k       502
Aug 20145,1 k4886052740311,2 k       502
Jul 20145,1 k4795952738011,1 k       502
Jun 20145,0 k4785852737211,1 k       502
May 20145,0 k4775252637211,1 k       502
Apr 20144,9 k4695052636711,1 k       502
Mar 20144,8 k4664752636411,1 k       502
Feb 20144,8 k4604652635711,1 k      280502
Jan 20144,7 k4554552635611,0 k      722502
Dec 20134,6 k443405263481991      839502
Nov 20134,5 k438395263471970      298502
Oct 20134,4 k431385263391967      328502
Sep 20134,4 k428375263391959      144502
Aug 20134,3 k407365263391958      197502
Jul 20134,3 k405365263381950      361502
Jun 20134,2 k398365263331949      610502
May 20134,0 k396361763331944      530152
Apr 20133,9 k387351663181920      723142
Mar 20133,7 k376331663141913      378142
Feb 20133,5 k250321663141907      276142
Jan 20133,4 k237311663141903      240142
Dec 20123,3 k229281663081899      1003142
Nov 20123,0 k218281563031871      1170141
Oct 20122,7 k21225742981788      142761
Sep 20122,4 k20423642771648      22046 
Aug 20122,2 k19323642591440      4396 
Jul 20122,1 k18121642571398      5856 
Jun 20122,0 k16315642331349      16966 
May 20121,5 k1439641491225      11136 
Apr 20129781287 21421207      365  
Mar 20128741137 21411206      313  
Feb 2012768985 2140 190      1723  
Jan 2012678 4  131 179      239  
Dec 2011610 4  131 176      464  
Nov 2011471 3  128 170      222  
Oct 2011455 3  128 170      219  
Sep 2011447 3  128 170      118  
Aug 2011433 3  123 167      172  
Jul 2011415 3  123 166      115  
Jun 2011414 3  123 164      71  
May 2011410 3  123 164      65  
Apr 2011408 3  119 164      110  
Mar 2011404 3  119 164      310  
Feb 2011359 3  91 161      295  
Jan 2011347 3  90 157      620  
Dec 2010277 3  90 155      211  
Nov 2010270 3  89 155      289  
Oct 2010258 3  88 155         
Sep 2010258 3  88 155         
Aug 2010258 3  88 155      2  
Jul 2010257 3  88 155         
Jun 2010257 3  85 155         
May 2010257 3  85 155      4  
Apr 2010254 3  85 154      1  
Mar 2010254 3  84 154      161  
Feb 2010249 3  63 103      2  
Jan 2010249 3  63 103         
Dec 2009249 3  63 103      14  
Nov 2009249 3  63 103      189  
Oct 2009227 1  56 98      138  
Sep 2009173    54 85      101  
Aug 2009149    43 35      5  
Jul 2009148    43 35      14  
Jun 2009146    43 35         
May 2009146    43 35         
Apr 2009146    43 35      12  
Mar 2009145    43 35      27  
Feb 2009140    39 33      36  
Jan 2009127    39 32      280  
Dec 200853    4 12      12  
Nov 200851    2 11         
Oct 200851    2 11         
Sep 200851    2 11         
Aug 200851    2 11         
Jul 200851    2 11      7  
Jun 200845    2 11         
May 200845    2 11      42  
Apr 200824    1 5      15  
Mar 200820    1 5      21  
Feb 200817    1 2      58  


Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons



For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

Feb 2008: 1 2 Piter , 2 1 Pätnič

Mar 2008: 1 1 Šoutjärv'

Apr 2008: 1 1 Šoutjärv'

May 2008: 1 1 Šoutjärv'

Jul 2008: 1 1 Mecoi

Dec 2008: 1 1 Vingl

Jan 2009: 1 4 Meiden Tat , 2 4 Kos'kenaluižen rajon , 3 3 Kühkjaine , 4 3 Kuruv , 5 3 Kana , 6 3 Jerusalim , 7 3 Jablokpu , 8 3 Hel'sinki , 9 3 Hab , 10 3 Biblii , 11 2 Šušt , 12 2 Šoutjärv' , 13 2 Mecantaga , 14 2 Zaiceva Nina , 15 2 Vologdan agj , 16 2 Vingl , 17 2 Vil'häl , 18 2 Vepsän rahvahaline volost' , 19 2 Vepsän , 20 2 Venäma , 21 2 Vaugedvenäma , 22 2 Uz' Zavet , 23 2 Tihvinan rajon , 24 2 Tervoil , 25 2 Suomen kel'

Feb 2009: 1 2 Pälehtpol’ , 2 2 Karjalan Tazovaldkundan gimn , 3 1 Litvanma

Mar 2009: 1 2 Zaiceva Nina , 2 1 Šoutjärv'

Apr 2009: 1 2 Suomenma , 2 1 Vepsän

Jul 2009: 1 1 Zverin lugu

Aug 2009: 1 1 Suomenma

Sep 2009: 1 2 Pälehtpol’ , 2 1 Meiden Tat

Oct 2009: 1 2 Vepsän rahvahaline volost' , 2 2 Venäma , 3 2 Kuld , 4 1 Šoutjärv'

Nov 2009: 1 2 Suomenma , 2 1 Zverin lugu

Dec 2009: 1 2 Grekanma , 2 1 Mal't

Feb 2010: 1 1 Pälehtpol’

Mar 2010: 1 2 Sur' Britanii , 2 2 Pu , 3 2 Ispanii , 4 2 Hristofor Kolumb , 5 2 Saksanma , 6 2 Lönnrot Elias , 7 2 Avstrii , 8 1 Šušt

Apr 2010: 1 1 Einštein Al'bert

May 2010: 1 1 Kaliningradan agj

Aug 2010: 1 1 Pol'šanma

Nov 2010: 1 3 Kaliningradan agj , 2 2 Mecoi , 3 2 Litvanma , 4 2 Änine , 5 2 Podporožj , 6 2 Kaunas , 7 2 Karjalan keled , 8 2 Karjalan Tazovaldkund , 9 2 Kant Immanuel' , 10 2 Kaliningrad , 11 2 Kalevala , 12 2 Kajag , 13 2 Jurij Gagarin , 14 2 Italii , 15 2 Ispanii , 16 2 Irlandii , 17 2 Hel'sinki , 18 2 Haitmann Fridrih , 19 2 Grekanma , 20 2 Gent , 21 2 Flevoland , 22 2 Eva , 23 2 Estinma , 24 1 Zverin lugu

Dec 2010: 1 4 Vasilii Surikov , 2 3 Vologdan agj , 3 3 Vinsent van Gog , 4 3 Tu-154 , 5 2 Čehov Anton , 6 2 Änižröunan rajon , 7 2 Migel' de Servantes Saavedra , 8 2 Mal't , 9 2 Lüksemburg , 10 2 Mocart Vol'fgang Amadeus , 11 2 Zaiceva Nina , 12 2 Gügo Viktor , 13 2 Vaugedvenäma , 14 2 Šeikspir Uil'jam , 15 2 Tervoil , 16 2 Suomalaiž-ugrilaine škol , 17 2 Sodjärv , 18 2 Päiväine , 19 2 Portugalii , 20 2 Podporožj , 21 2 Petroskoi , 22 2 Orav , 23 2 Nemž , 24 2 Leonardo da Vinči , 25 2 Kettunen Lauri

Jan 2011: 1 3 Vengrii , 2 3 Ukrain , 3 3 Kazahstan , 4 3 Italijan kel' , 5 2 Ženevan järv , 6 2 Šoutjärv' , 7 2 Čehanma , 8 2 Änižröunan rajon , 9 2 Lüksemburg , 10 2 Vepsän kul'turan muzei , 11 2 Vepsän kel' , 12 2 Venäma , 13 2 Vaugedvenäma , 14 2 Vatikan , 15 2 Suomenma , 16 2 Slovenii , 17 2 Slovakii , 18 2 Serbii , 19 2 San Marino , 20 2 Pälehtpol’ , 21 2 Piter , 22 2 Petroskoi , 23 2 Nevondkundaližiden Socialistižiden Tazovaldkundoiden Ühtištuz , 24 2 Moskv , 25 2 Monak

Feb 2011: 1 3 Kazahan kel' , 2 3 Kazahalaižed , 3 3 Händikaz , 4 2 Änižröunan rajon , 5 2 Litvanma , 6 2 Vepsän rahvahaline volost' , 7 2 Totaran kel' , 8 2 Suomenma , 9 2 Ročinma , 10 2 Petroskoi , 11 2 Kaži , 12 2 Kaleig , 13 2 Irlandii , 14 2 Grekanma , 15 2 Saksanma , 16 2 Estin kel' , 17 2 Daugavpils , 18 1 Šveicarii

Mar 2011: 1 3 Venäma , 2 3 Moskv , 3 3 Kaunas , 4 2 Šokš , 5 2 Medvedev Dmitrii , 6 2 Rim , 7 2 Repin Il'ja , 8 2 Pälehtpol’ , 9 2 Putin Vladimir , 10 2 Piter , 11 2 Peitsemnižed , 12 2 Abramov Nikolai , 13 2 Kuz' , 14 2 Kuld , 15 2 Kolumb Hristofor , 16 2 Kazmused , 17 2 Karjalan Tazovaldkundan gimn , 18 2 Karjalan Tazovaldkund , 19 2 Kant Immanuel' , 20 2 Kaliningrad , 21 2 Jel'cin Boris , 22 2 Immanuel Kant , 23 2 Haitmann Fridrih , 24 2 Germanijan kel' , 25 2 Gagarin Jurii

Apr 2011: 1 2 Venäma , 2 2 Kazahstan , 3 2 Bel'gii , 4 1 Šveicarii

May 2011: 1 3 Süvär' , 2 2 Päiväine , 3 2 Pifagoran teorem , 4 2 Kolumb Hristofor , 5 2 Karjalan Tazovaldkundan Rahvahaline teatr , 6 1 Marok

Jun 2011: 1 2 Karjalan Tazovaldkund , 2 2 Danii , 3 2 Bolgarii , 4 2 Alma-At , 5 1 Čehanma

Jul 2011: 1 1 Ženevan järv

Aug 2011: 1 3 Vezi , 2 3 Süvär' , 3 2 Šrenkan kuz' , 4 2 Venäma , 5 2 Vauged kuz' , 6 2 Tän'-šanine kuz' , 7 2 Turkmenistan , 8 2 Taškent , 9 2 Serbine kuz' , 10 2 Saratov , 11 2 Pifagoran teorem , 12 2 Peitsemnižed

Sep 2011: 1 5 Lezgin kel' , 2 3 Dagestan , 3 2 Ženevan järv , 4 2 Volgograd , 5 2 Samara , 6 2 Orenburg , 7 2 Omsk , 8 2 Kurgan , 9 2 Kaliningradan agj , 10 1 Zverin lugu

Oct 2011: 1 2 Vil'nüs , 2 2 Pälehtpol’ , 3 2 Lakan kel' , 4 2 Korsik , 5 1 Šušt

Nov 2011: 1 3 Tähtaz , 2 3 Tu-154 , 3 3 Pälehtpol’ , 4 2 Vinsent van Gog , 5 2 Vikipedii , 6 2 Vikimedii , 7 2 Vezi , 8 2 Rim , 9 2 Pol'šanma , 10 2 Pifagoran teorem , 11 2 Petroskoi , 12 2 Pariž , 13 2 Paltog , 14 2 Moskv , 15 2 Kuruv , 16 2 Karjalan Tazovaldkund , 17 1 Šoutarv

Dec 2011: 1 5 Vaugedpert' (Vašington) , 2 4 Amerikan Ühtenzoittud Valdkundad , 3 3 Mel'burn , 4 3 Lüblän , 5 3 Pälehtpol’ , 6 3 Pil'ved , 7 3 Oper , 8 3 Natrii , 9 3 Kundlimed , 10 3 Konstebl Džon , 11 3 Džasper (lidn, Minnesot) , 12 3 Bratislav , 13 3 Ankar , 14 2 Šur , 15 2 Šrödinger Ervin , 16 2 Šanhai , 17 2 Čuvašan kel' , 18 2 Čai , 19 2 Mafii , 20 2 MP3-plejer , 21 2 Lüblin , 22 2 Avrora (kreiser) , 23 2 Zagreb , 24 2 Vintaž , 25 2 Vepsän kel'

Jan 2012: 1 4 Venäman Tazovaldkundad , 2 4 Opera , 3 4 Internet Explorer , 4 3 Čerkessk , 5 3 Čeboksarad , 6 3 Petr I Sur' , 7 3 Mozilla Firefox , 8 3 Groznii , 9 3 Google Chrome , 10 2 Čeläbinsk , 11 2 Microsoft Windows , 12 2 Microsoft Office Word , 13 2 Microsoft Office Excel , 14 2 Vašington (lidn) , 15 2 Uraližed keled , 16 2 Skopje , 17 1 Vepsän kelen aigad

Feb 2012: 1 14 Pälehtpol’ , 2 5 Sarapul , 3 5 Dagestanan Tazovaldkund , 4 4 Zaiceva Nina , 5 4 Venäma , 6 4 Särg , 7 4 Petr I Sur' , 8 4 San Francisko , 9 4 Podporožj , 10 4 Petroskoi , 11 4 Orav , 12 4 Korol' i Šut , 13 4 Kijev , 14 4 Baškiran kel' , 15 4 Azerbaidžan , 16 3 Vepsän kelen aigad , 17 3 Bolgarijan kel' , 18 3 Antofagast , 19 3 Val'paraiso , 20 3 Santjago , 21 3 Konseps'jon , 22 3 Mrongovo , 23 3 , 24 3 Lacuna Coil , 25 3 Šveicarii

Mar 2012: 1 4 Soči , 2 4 Pälehtpol’ , 3 3 Buranovon Baboid , 4 3 Narv (lidn) , 5 3 Tartu , 6 3 Linkin Park , 7 3 Čehanma , 8 2 Bardan rajon , 9 2 Šeki , 10 2 Nahičevan , 11 2 Gändž , 12 2 Gai (lidn) , 13 2 Orenburgan agj , 14 2 Moščen , 15 2 Kautokeino , 16 2 Ostrav , 17 2 Himižiden elementoiden periodine tablut , 18 2 Udmurtan kelen kändod , 19 2 Rio-de-Žaneiro , 20 2 San Paulu , 21 1 Orsk

Apr 2012: 1 4 Pälehtpol’ , 2 3 Vepsän nimed , 3 3 Pol'šanman administrativiž-territorialine jagand , 4 2 666 (lugu) , 5 2 Vepsän Vikipedii , 6 2 IPod , 7 2 Vodin kel' , 8 2 Lantanoidad , 9 2 Korrea Rafael' , 10 2 Ščecin , 11 2 Abdulino , 12 2 Himižiden elementoiden periodine tablut , 13 2 Melent'jeva Marija , 14 2 Zaiceva Marja , 15 2 Lämoi , 16 2 Votkinsk , 17 2 Vobl , 18 2 Jašov Viktor , 19 2 Vepsän kel' , 20 2 Šeikspir Uil'jam , 21 2 Udmurtan kel' , 22 2 Portlend (Oregon) , 23 2 Kühkjaine , 24 2 Kur'ged , 25 2 Kalitkad

May 2012: 1 7 Pälehtpol’ , 2 6 Party for Everybody , 3 5 Piter , 4 4 Piterin metropoliten , 5 4 Vepsän Vikii , 6 4 Buranovon Baboid , 7 3 MySpace , 8 3 Euphoria , 9 3 Lorin , 10 3 Should've Known Better , 11 3 Evrovizii-2012 , 12 3 Venäman lidnad-millionerad , 13 3 Ogeruz i aznoičend , 14 3 Teräsbetoni , 15 3 Rabat , 16 3 Glittertind , 17 3 Viski , 18 3 Unheilig , 19 3 Üebermutter , 20 3 Rammstein , 21 3 Tatarstanan Tazovaldkund , 22 3 Udmurtijan Tazovaldkund , 23 3 12 (lugu) , 24 3 11 (lugu) , 25 3 10 (lugu)

Jun 2012: 1 6 Lavin Avril , 2 5 Evropan futbolan čempionat 2012 , 3 5 Vikipedii , 4 4 Lorin , 5 4 Pälehtpol’ , 6 3 Bahreinan valdkundznam , 7 3 .bs , 8 3 Bagaman Sared , 9 3 Kubanin kozakišton hor , 10 3 Vepsän flag , 11 3 Norvegijan konstitucijan päiv , 12 3 Antiguan da Barbudan flag , 13 3 Belogorsk (Amuran agj) , 14 3 Blagodarnii , 15 3 Krasnodaran rand , 16 3 Jousne , 17 3 Joudjuden statui , 18 3 .us , 19 3 .dz , 20 3 FK Zenit Piter , 21 3 .al , 22 3 .nl , 23 3 Alamaiden valdkundznam , 24 3 Afganistanan valdkundznam , 25 3 .af

Jul 2012: 1 4 Pohjoižsaamen Vikipedii , 2 4 Öbok , 3 3 Udmurtan Vikipedii , 4 3 Slovenijan kel' , 5 3 Evropan futbolan čempionat 2012 , 6 3 Turkanma , 7 3 Mozilla Firefox , 8 2 Centillion , 9 2 Grekan kirjamišt , 10 2 Taimir (lehtez) , 11 2 7-Zip , 12 2 Puht , 13 2 Šujan stancii , 14 2 Meliorativnii , 15 2 Bernar Sara , 16 2 Ehtbok , 17 2 Longibok , 18 2 Homendezbok , 19 2 Päivlaskm , 20 2 Päivnouzm , 21 2 Pohjoine , 22 2 Suvi , 23 2 Salavat Kupere , 24 2 Dakk , 25 2 Bangladeš

Aug 2012: 1 4 Vilämovicen kel' , 2 4 Vn 2012 Kezaolimpiadan lopmižed , 3 2 Komin Vikipedii , 4 2 Ternopol' , 5 2 Fareran kel' , 6 2 Vagur , 7 2 Alitus , 8 2 Priozerskan rajon , 9 2 Priozersk , 10 2 Bugri (Vsevoložskan rajon) , 11 2 Vepsän ülüz , 12 2 Venäman flag , 13 2 Valaam , 14 2 .et , 15 2 Virrat , 16 2 Ferland Džodel' , 17 2 Hibbert Eleonor , 18 2 Nuori Karjala , 19 2 Breivik Anders Bering , 20 2 Regalado Tomas , 21 2 Windir , 22 2 Tanzwut , 23 2 Majami , 24 2 AÜV:oiden flag , 25 2 Anus (lidn)

Sep 2012: 1 4 Evrejan kel' , 2 4 Pälehtpol’ , 3 4 Google Chrome , 4 3 Virun kel' , 5 3 Vikingad , 6 3 Ristitun hibj , 7 3 A , 8 3 Ganter Henri , 9 3 Pussy Riot , 10 3 Ezmäine mail'man voin , 11 3 A7V , 12 3 Spalletti Lučano , 13 3 Fobijoiden nimikirjutez , 14 3 , 15 3 Modern Talking , 16 3 Polandball , 17 3 Grekan kirjamišt , 18 3 FK Zenit Piter , 19 3 Venälaižed , 20 3 Artut' , 21 3 Gändž , 22 3 Ostrav , 23 3 Brno , 24 3 Venän kel' , 25 3 Prag

Oct 2012: 1 4 Singapur , 2 4 Vologdan agj , 3 4 Rig , 4 3 Norvegijan Vikipedii , 5 3 Pohjoižen saldat (fil'm) , 6 3 Sar' (fil'm, Venäma, 2006) , 7 3 Dnestranrand , 8 3 Ahvenanma , 9 3 Grekanman Makedonii , 10 3 Šokolad , 11 3 Dom-2 , 12 3 Taivan' (sar') , 13 3 Pirahan (kel') , 14 3 Ternopol' , 15 3 Marti Petit Antoni , 16 3 Litvanma , 17 3 Vil'nüs , 18 3 Varšav , 19 3 Portlend (Oregon) , 20 3 Latvii , 21 3 Grekanma , 22 3 Evropan valdkundad , 23 3 Budapešt , 24 3 Berlin , 25 3 Albanii

Nov 2012: 1 4 Vepsän rahvahan hor , 2 3 Lodehline aviabaz , 3 3 Kurgiden aig , 4 3 Kalarand , 5 3 «Ö»-kirjamen muštpacaz , 6 3 Mi? Kus? Konz? , 7 3 Tedr , 8 2 Pirgaine , 9 2 Randaine , 10 2 Duty free , 11 2 Jablonovskii-sild (Piter) , 12 2 Jablonovskii-sild (Krasnodar) , 13 2 Kegonpaniilind , 14 2 Pähkim , 15 2 Merikukoi , 16 2 Nug , 17 2 Habobatk , 18 2 In a Reverie , 19 2 Kodipühüt , 20 2 Kodipulo , 21 2 Jälinduine , 22 2 Kärg , 23 2 Näk , 24 2 Zor'alinduine , 25 2 Küuki

Dec 2012: 1 3 Livin Vikipedii , 2 3 Gamburger , 3 3 Hot-dog , 4 3 Venäma Evrovizijas , 5 3 MySpace , 6 3 Naberežnije Čelni , 7 2 Ronson Šarlotta , 8 2 Mir (orbitine stancii) , 9 2 Bleeding Souls , 10 2 Ethereal (demo) , 11 2 Plazm , 12 2 Sleep of Right , 13 2 Lumenšur , 14 2 Hobednitid , 15 2 Kuzut om sündnu mecha , 16 2 Maseru , 17 2 Kindhad , 18 2 Truganini , 19 2 Happy Tree Friends , 20 2 Letsie III , 21 2 Suomalaine veič , 22 2 Tüp , 23 2 Nin' , 24 2 Britanijan Kuldrand , 25 2 Renault Logan

Jan 2013: 1 3 Vederistmad , 2 3 Grand Theft Auto: San Andreas , 3 3 Vologdan agj , 4 2 Evenalaižed , 5 2 Evenkalaižed , 6 2 Udinalaižed , 7 2 Lumiuk , 8 2 Darginalaižed , 9 2 De Agostini , 10 2 I'm Not Afraid , 11 2 Bela Lugosi's Dead , 12 2 Wide Awake (Lacuna Coil:an pajo) , 13 2 I Won't Tell You , 14 2 Ragozina Natal'ja , 15 2 Enjoy the Silence , 16 2 Swamped , 17 2 Vepsän mifologii , 18 1 Leonardo Forti

Feb 2013: 1 3 Jožin z bažin , 2 3 Pori , 3 3 Lihtenštein , 4 2 Nor'mik , 5 2 Norhein , 6 2 Habinod , 7 2 Bard (hibused) , 8 2 Real,- , 9 2 Raum , 10 2 Etimologii , 11 2 Kolin norvegijalaižed , 12 2 Lukumades , 13 2 Gitar , 14 2 Tofalaralaižed , 15 2 Doncova Dar'ja , 16 2 Lužkovan stil' , 17 2 Eht , 18 2 Orokalaižed , 19 2 Ö (aig) , 20 2 Ul'čilaižed , 21 2 Laškuzlidn , 22 2 Jugalaižed , 23 1 MOS Technology 6502

Mar 2013: 1 4 Venälaine literatur , 2 4 Kitai , 3 3 Merežkovskii Dmitrii , 4 3 Bad Boys Blue , 5 3 Heitämine (serial) , 6 2 Leningradalaine zoopuišt , 7 2 Obuhovan Kaičendan prospekt , 8 2 Hamid Abdul , 9 2 Klüjev Nikolai , 10 2 Antresol' , 11 2 Lindemann Till' , 12 2 C.E.B. Reas , 13 2 Zencov Roman , 14 2 C. C. Catch , 15 2 Ph. Patrikan päiv , 16 2 Buraka Som Sistema , 17 2 Vasil'jev Boris , 18 2 Kaks'nik (starin) , 19 2 Ižand Proharčin , 20 2 Vändai (roman) , 21 2 Voin i kožmuz , 22 2 Domostroi , 23 2 Adams Duglas , 24 2 Rahvahankeskeine naižiden päiv , 25 2 Dahno Vladimir

Apr 2013: 1 3 Kel'tižed keled , 2 3 Kečuan kel' , 3 3 Šotlandijan kel' (kel'tine) , 4 2 Dirbal , 5 2 Puhtaz, ajatud , 6 2 Sekret Uspeha , 7 2 Birbincpühäpäiv , 8 2 Šizofrenii , 9 2 Depressii , 10 2 Sanskrit , 11 2 Ficdžeral'd Ella , 12 2 Nganasanan kel' , 13 2 Subway Surfers , 14 2 Cut the Rope , 15 2 Čukčan kel' , 16 2 Hüväd öd, čočod! , 17 2 Welcome to the Heartbreak Hotel , 18 2 Kirj , 19 2 Surman kel'dand , 20 2 Haki (kel'kanz) , 21 2 Guaranin kel' , 22 2 Eiler Leonard , 23 2 Tuskaroran kel' , 24 2 I Can Lose My Heart Tonight , 25 2 Kombinacija

May 2013: 1 3 Evrovizii-1956 , 2 3 Odess , 3 3 You're My Heart, You're My Soul , 4 3 Vepsän kel' , 5 3 Pil'ved , 6 2 Likutimveneh , 7 2 Kater , 8 2 Veneh , 9 2 You Shot a Hole In My Soul , 10 2 Hear What I Say , 11 2 Čistalöv Veniamin , 12 2 Azartvänd , 13 2 Diamonds , 14 2 Jankulov Stojan , 15 2 Sport , 16 2 Jumal , 17 2 Džakart , 18 2 I'm No Rockefeller , 19 2 One In a Million , 20 2 Good Guys Only Win in Movies , 21 2 Tilli Džennifer , 22 2 Kannad , 23 2 Vägestusen päiv , 24 2 Vepsän grammatik , 25 2 Kulič

Jun 2013: 1 4 Moskv-Siti , 2 3 Kahtišti koumekümne koume , 3 3 Juhannus , 4 3 Mahfuz Nagib , 5 3 Psalmoiden kirj , 6 3 Lönnrot Elias , 7 3 Biblii , 8 2 Baltika (oludenkeituden kompanii) , 9 2 Hala , 10 2 Kall' (külä) , 11 2 Kobencl' Lüdvig fon , 12 2 Mišel' (pajatai) , 13 2 Petti Rajan , 14 2 Tullei , 15 2 Valendas , 16 2 Fasmer Maks , 17 2 Gar d'Aržikur P'jerrpon , 18 2 Optimal , 19 2 Virtanen Veikko , 20 2 Komiks , 21 2 Semönov Pötr , 22 2 Mompha edax , 23 2 Iče minä , 24 2 Marginal , 25 2 Eristalis intricarius

Jul 2013: 1 3 Vepsän küläd , 2 3 Rand (külä, Vepsän rahvahaline küläkund) , 3 3 Reprua , 4 3 Latinan frazoiden nimikirjutez , 5 2 C. C. Catch:an pajod , 6 2 Keimada Grandi , 7 2 Jumal! Abuta minei jäda henghe kesked necidä surmarmastust , 8 2 Zanin Artöm , 9 2 Synodontis pardalis , 10 2 Ptychogena antarctica , 11 2 Dendrilla elegans , 12 2 Heteropoda shillongensis , 13 2 Slavine neopaganuz , 14 2 Tur de Frans , 15 2 I Will Survive , 16 2 Aksintant , 17 2 Süvärensu , 18 2 Gaudi Antonio , 19 2 Znamasižiden evrodiskoedestajiden nimikirjutez , 20 1 You Suffer

Aug 2013: 1 2 Puerto Iguasu , 2 2 Ročilaine laud , 3 2 Ištui Härg , 4 2 Venä , 5 2 Kahesan nellikon identižuz , 6 2 Ruskedvauvaz vin , 7 2 Mail'manpän Sar' (ATOW1996) , 8 2 Niinistö Sauli , 9 2 Jufit Jevgenii , 10 2 Francijalaižiden fil'miden festival' Malagas , 11 2 Oksitanan kel' , 12 1 Änižen kanal

Sep 2013: 1 2 Inkeriläižed , 2 2 Karr Sara Rouz , 3 2 Žirinovskii Vladimir , 4 2 Palatoi lugu , 5 2 Mec , 6 2 Secret Star , 7 2 I Can Lose My Heart Tonight '99 , 8 2 Kitai , 9 2 Haapsalu , 10 2 You're My Heart, You're My Soul , 11 2 Vepsän ülüz , 12 2 Saha Tazovaldkund , 13 2 Afganistan , 14 2 Možg , 15 2 Vepsän Vikipedii , 16 1 Koreb Elidaspäi

Oct 2013: 1 2 Frigga pratensis , 2 2 Belisana strinatii , 3 2 Kelenmagii , 4 2 Nagriž , 5 2 Päč , 6 2 WASP-64 , 7 1 Boa

Nov 2013: 1 3 Boršod Abaui Zemplen , 2 3 Eger (lidn) , 3 3 Heveš (agj) , 4 3 Mad'jaranman lidnad , 5 3 Japonii , 6 3 Muil , 7 3 Queen , 8 2 Jas Nad'kun Sol'nok , 9 2 Kapošvar , 10 2 D'jor , 11 2 Kečkemet , 12 2 Miškol'c , 13 2 Debrecen , 14 2 Bač Kiškun , 15 2 Pešt (agj) , 16 2 Sabol'č Satmar Bereg , 17 2 .hu , 18 2 31 (lugu) , 19 2 Tok-pisin

Dec 2013: 1 4 Lindberg Čed , 2 4 Töröčik Mari , 3 3 Garipova Dina , 4 3 Blek Lukas , 5 3 Emi S'juzi , 6 3 Disnei Uolt , 7 3 Buše Viktor , 8 3 Uusberg Pärt , 9 3 Keil (lidn) , 10 3 Vas (lidn) , 11 3 Laht (lidn) , 12 3 Mad'jaranman agjad , 13 3 Peč , 14 3 Ferland Džodel' , 15 2 Itson Meri Ellen , 16 2 Volčkov Sergei Valer'jevič , 17 2 Golos , 18 2 Holodnaja Vera , 19 2 Kalašnikov Mihail , 20 2 Džerri (fil'm) , 21 2 Pekuin Anna , 22 2 Roman Pol , 23 2 Jakobi Doreen , 24 2 De Montema Damian , 25 2 Vepsläižen kodin südäin

Jan 2014: 1 3 Moskv-Siti , 2 2 Karlton Lending , 3 2 Zell' , 4 2 Uorhol Endi , 5 2 Silence , 6 2 Unborn Love , 7 2 Rait Frenk Lloid , 8 2 Le Korbüz'je , 9 2 Dürer Al'breht , 10 2 Dvoržak Antonin , 11 2 Goja Fransisko , 12 2 Rubens Piter , 13 2 Umbrine škol , 14 2 Rafael' Santi , 15 2 Tverin agj , 16 2 Lendai alamalaine , 17 2 Anomalii , 18 2 Mägi , 19 2 Kalo Frida , 20 2 Protistad , 21 2 Muiktuz , 22 2 Himine ühtnend , 23 2 Biohimii , 24 2 Himii , 25 2 Need for Speed: Pigusen himo

Feb 2014: 1 2 Armastusen tippud , 2 2 Heimolaižuz , 3 2 Mumbai , 4 2 Indijan štatad da territorijad , 5 2 Nothing Stands In Our Way , 6 2 Hameleonad (serial) , 7 2 Lapsed (serial, Brazilii, 2013) , 8 2 Brazilii-kolledž , 9 2 Satatadud südäikerad , 10 2 Japonine kanang , 11 2 Karusel' (serial, Brazilii, 2012) , 12 2 Vn 2014 Tal'volimpiadan lopmižed , 13 2 Laos , 14 2 Kudentoštkümnen nellikon identižuz

Mar 2014: 1 2 Kall'oikahad mäged , 2 2 Bangalor , 3 2 Krim (Ukrainan region) , 4 2 Korejan Tazovaldkund , 5 2 Čennai , 6 2 So , 7 2 Maim , 8 2 Need for Speed: Pigusen himo , 9 2 Vepsän küläd , 10 2 Bass Sol , 11 2 Venesuel , 12 2 Uz' Zelandii , 13 2 Avstralii (valdkund) , 14 2 Arhangel'sk , 15 2 Nikaragua (valdkund) , 16 2 Igark , 17 2 Suviamerik , 18 1 Česmen jumalanpert'

Apr 2014: 1 3 Urugvai , 2 3 The Doors , 3 3 Voihein , 4 2 Sevastopol' , 5 2 Feodosii , 6 2 Nellikod (kartankarv) , 7 2 Džomolungm , 8 2 Venäman federaližiden ümbrikod , 9 2 Suviafrikan Tazovaldkund , 10 2 Kilimandžaro , 11 2 Sabett , 12 2 Nencan kel' , 13 2 Jumalanbembel' , 14 2 Vederistmad , 15 2 Grand Theft Auto: San Andreas , 16 2 Buenos Aires , 17 2 Hristanuskond , 18 1 Koktebel'

May 2014: 1 3 Luganskan Rahvahaline Tazovaldkund , 2 3 Ukrain , 3 2 Suomen Vikipedii , 4 2 Jun Hen Sik , 5 2 Seong Dže-gi , 6 2 Marijampole , 7 2 Varghuz (lidn) , 8 2 Lund , 9 2 Viborg (Danii) , 10 2 Krim (Ukrainan region) , 11 2 Eupithecia turpis , 12 2 Takkiž , 13 2 Kislovodsk , 14 2 Mail'man valdkundad , 15 2 Rostov Donal , 16 2 Tallidn , 17 2 Suomenma , 18 1 Deborra-Li Förness

Jun 2014: 1 2 Katar , 2 2 Malaizii , 3 2 Mongolii , 4 2 Tailand , 5 2 Tadžikistan , 6 2 Kano , 7 2 Tokio , 8 2 Tün' valdmeri , 9 2 Sevastopol' , 10 2 Džeronimo , 11 2 Öhabuk , 12 2 Ortodoksine hristanuskond , 13 2 Atlantine valdmeri , 14 1 In Čžen

Jul 2014: 1 2 Egipt , 2 2 Sudan , 3 2 33 (lugu) , 4 2 Uusberg Pärt , 5 2 Novodvorskaja Valerija , 6 1 Ceilon

Aug 2014: 1 4 Marilaine veroline religii , 2 3 Saba Isak , 3 3 Master i Margarita , 4 3 Kodima , 5 2 Kostarik , 6 2 Sur' Munamägi , 7 2 Vil'jandi , 8 2 Sudan , 9 2 Moskvan prospekt (Piter) , 10 2 Dakk , 11 2 Nikaragua (znamoičendad) , 12 2 Viluku , 13 1 Madagaskar (valdkund)

Sep 2014: 1 3 Paragvai , 2 3 Ugand , 3 3 Canada , 4 3 Coca-Cola , 5 2 Järgeline pölvaz , 6 2 Kekkonen Urho , 7 2 Koivisto Mauno , 8 2 Hel'singfors , 9 2 Senegal , 10 2 Kamerun , 11 2 Bolivii , 12 2 Nauru , 13 2 Ternopol' , 14 1 Paragvain Tazovaldkund

Oct 2014: 1 2 Bol , 2 2 Abai (znamoičendad) , 3 2 Abai , 4 2 Al'tamir (mägionduz) , 5 2 Indonezii , 6 2 Antigua da Barbud , 7 2 Pol'šanma , 8 1 Abazilaižed

Nov 2014: 1 2 Kanoe Pessespäi , 2 2 Baženov Timofei , 3 2 Baženovan reiting , 4 2 Strub , 5 2 Lobez (lidn) , 6 2 Pöud (maižanduz) , 7 2 Pöud , 8 2 Marilaižiden tradicionaline uskond , 9 2 Tadžikistan , 10 1 Karbaz

Dec 2014: 1 3 Lobez (lidn) , 2 2 Strelkov Igor' , 3 2 Gladius , 4 2 Pavlodar , 5 1 Vologdan pörutügitegim

No data on this page have been normalized to 30 day months (as WMF does on certain traffic reports).
Wikipedias are initially ordered by number of speakers of the language

Speakers: Number of speakers of a language is the estimated total of primary and secondary speakers, is in many cases a very rough estimation (based on the page on the English Wikipedia about that language)
Regions are parts of the world where the language is spoken in substantial amounts (compared to total number of speakers). Regions where a language gained presence only by a recent diaspora are generally not included.
Region codes: AF:Africa, AS:Asia, EU:Europe, NA:North America, OC:Oceania, SA:South America, W:World Wide, CL:Constructed Language

Estatísticas geradas em Friday January 23, 2015 23:06

Dump file vepwiki-20150101-stub-meta-history.xml.gz (edits only), size 4.1 Mb as gz -> 28 Mb
Dump processed till Dec 31, 2014, on server stat1002, ready at Thu-01/01/2015-21:12 after 27 sec.

Versão do script:2.6
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### =
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.