Estatísticas da Wikipédia vepsian

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Articles per size range / Records per namespace / Most edited articles / Zeitgeist

Most metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.

Some metrics have been collected from the full archive dump which runs on lower frequency than the usual monthly cycle.
These metrics are columns F,I,J,K,M,N,O,P,Q,R from the first table.


See also metrics definitions


 
Monthly counts & Quarterly rankings: julho 2014
 
DataWikipedistasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
jul 20140%   0%      -20%      +1%
jun 2014+2%   +1%      -44%      +2%
mai 20140%   +1%      -17%      +2%
abr 20140%   +2%      -21%      +3%
mar 20140%   +1%      +110%      +2%
fev 20140%   +1%+1%     -61%+2%+2%+1%-1%0%+1%+2%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P____Q____R____S__
jul 201449 214,0 k 110,5   183      1,0 k
jun 20144915 4,0 k 110,5   228      1,0 k
mai 201448 214,0 k 110,6   404      998
abr 201448 323,9 k 210,6   484      976
mar 201448 423,9 k 110,6   610      943
fev 201448 413,8 k2,1 k110,644521%3%2912,6 Mb228 k23 k1361921,0 k929
jan 201448 413,8 k2,1 k210,644120%3%7462,6 Mb224 k23 k137192996912
dez 2013481723,8 k2,0 k310,543120%3%8512,5 Mb216 k22 k172191975871
nov 2013472713,7 k1,9 k210,642119%3%3012,3 Mb206 k21 k175190938825
out 201345 313,6 k1,9 k210,641419%3%3312,3 Mb201 k20 k176184933814
set 201345 4 3,6 k1,8 k110,741519%3%2072,2 Mb197 k20 k175184917801
ago 201345 313,5 k1,8 k210,741319%3%2152,2 Mb195 k20 k168182913792
jul 201345 413,5 k1,8 k210,841319%3%3822,2 Mb193 k19 k205182910778
jun 2013451423,4 k1,7 k410,941118%3%6312,1 Mb188 k19 k215181895752
mai 201344 423,3 k1,6 k311,140518%3%5652,1 Mb179 k18 k281179873684
abr 201344 423,2 k1,6 k611,239918%3%8722,0 Mb171 k17 k376181791664
mar 201344 613,0 k1,5 k411,640118%3%3,8 k1,9 Mb163 k16 k1,3 k181747633
fev 201344 412,9 k1,4 k310,739719%3%1,5 k5,0 Mb156 k15 k134 k179713603
jan 201344 512,8 k1,4 k310,540019%3%1,6 k4,9 Mb153 k14 k131 k187704586
dez 2012443622,8 k1,3 k810,240319%3%2,4 k4,8 Mb149 k14 k128 k200691573
nov 2012411622,5 k1,3 k910,241720%3%2,3 k4,5 Mb141 k13 k119 k220637515
out 20124041022,3 k1,1 k610,442421%3%2,5 k4,2 Mb128 k11 k112 k241559448
set 2012361632,1 k969610,241820%3%3,3 k3,8 Mb114 k9,5 k104 k259486382
ago 201235 711,9 k85829,441020%3%1,3 k3,5 Mb102 k7,6 k98 k371399313
jul 201235 421,8 k81329,140520%3%1,4 k3,4 Mb97 k7,1 k95 k433366292
jun 2012351631,7 k784158,639920%3%2,9 k3,3 Mb93 k6,6 k93 k535376273
mai 2012342631,3 k681159,244924%4%2,0 k2,6 Mb78 k5,2 k75 k718311162
abr 201232261844573311,956332%5%8772,1 Mb64 k3,8 k60 k768203134
mar 20123027176751031255029%5%1,0 k2,0 Mb57 k3,2 k55 k837154107
fev 2012283123673442312,156932%6%2,5 k1,8 Mb52 k2,8 k50 k94914595
jan 201225 4 59438229,458233%6%2421,6 Mb47 k2,5 k46 k87412184
dez 20112516254333749,958632%7%6391,5 Mb44 k2,3 k42 k80812167
nov 201124 5 420256 11,360536%7%5831,2 Mb35 k2,0 k33 k56410951
out 201124121407252 10,261737%7%2211,2 Mb35 k1,9 k31 k55211048
set 20112327 399251 9,862838%8%1211,2 Mb35 k1,9 k30 k54810948
ago 20112157 38923819,861438%7%1741,1 Mb33 k1,9 k30 k52010444
jul 201116 11371220 9,859836%7%1251,1 Mb31 k1,8 k29 k5099544
jun 20111614 371215 9,453733%5%871,1 Mb28 k1,6 k29 k5127043
mai 201115 6 367210 9,353734%5%2691,1 Mb27 k1,6 k29 k5116943
abr 201115 5 365208 8,653433%5%1111,0 Mb27 k1,6 k28 k5066843
mar 201115 8136120218,450631%5%3121,0 Mb25 k1,5 k28 k5006143
fev 201115 61340185 845729%4%298947 kb22 k1,2 k26 k4683720
jan 20111524233317727,341926%4%622917 kb20 k1,1 k26 k4593015
dez 201013151267106 6,838019%4%216642 kb14 k95618 k3012111
nov 201012342260105 6,142120%5%298477 kb15 k89211 k2952011
out 20109   24896 5,235020%4% 260 kb12 k7824,4 k2561211
set 20109   24896 5,235020%4% 260 kb12 k7824,4 k2561211
ago 20109   24896 5,235020%4%3260 kb12 k7824,4 k2561211
jul 20109   24796 5,235120%4%7260 kb12 k7804,4 k2551211
jun 20109   24796 5,235120%4%1260 kb12 k7804,4 k2551211
mai 20109   24796 5,235120%4%5260 kb12 k7794,4 k2551211
abr 20109   24494 5,235020%4%2257 kb12 k7524,4 k2511211
mar 2010922124494 5,235020%4%169257 kb12 k7524,4 k2521211
fev 20107   23990 4,636020%4%4224 kb12 k1983,5 k247811
jan 20107   23990 4,636020%4%2224 kb12 k1983,5 k247811
dez 20097 1 23990 4,636020%4%74224 kb12 k1983,5 k246811
nov 20097 112399014,336020%4%202222 kb12 k1983,5 k246811
out 20097 112176823,828912%3%150190 kb9,2 k1793,4 k172811
set 2009712 1665414,130211%4%133163 kb7,1 k1853,3 k8588
ago 20096 1 14536 3,727410%3%692 kb5,6 k931,4 k6824
jul 20096 1 14435 3,727510%3%1491 kb5,5 k931,4 k6724
jun 20096   14232 3,726911%3% 88 kb5,3 k691,3 k6524
mai 20096   14232 3,726911%3% 88 kb5,3 k691,3 k6524
abr 2009611 14232 3,726911%3%1388 kb5,3 k691,3 k6524
mar 2009513 14130 3,625710%3%2886 kb5,1 k451,3 k6224
fev 20094 2 13628 3,525510%3%3785 kb5,0 k411,3 k6324
jan 200942411232223,62268%2%28277 kb4,1 k301,3 k6024
dez 20082 2 503 3,21334%2%1220 kb1,1 k1135516 3
nov 20082   483 3,11324%2% 16 kb1,0 k724714 3
out 20082   483 3,11324%2% 16 kb1,0 k724714 3
set 20082   483 3,11324%2% 16 kb1,0 k724714 3
ago 20082   483 3,11324%2% 16 kb1,0 k724714 3
jul 20082 1 483 3,11324%2%716 kb1,0 k724714 3
jun 20082   423 3,41465%2% 15 kb99272418 3
mai 20082 1 42313,41465%2%4215 kb99272418 3
abr 20082 2 213 4,724110%5%1510 kb88571192 3
mar 20082 1 172 4,91636% 225,1 kb4874161 3
fev 2008221 142 4,41827% 624,3 kb4592141 3
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
The following table ranks this project in relation to projects in other languages with 1000+ articles
abr 2014175 153101164 120194   119      250
jan 2014172168138139162173127194197191194115196193179215225187250
out 2013172151154127161172116196199194195126200195182216225190250
jul 2013171141137132162173116196198195197127199195182216226188250
abr 201317114814210616617889192199194194131200200185204224189250
jan 2013170149126141170179110196194189191158193202185171221189250
out 2012171799410118118284193192187190129197204190174213194250
jul 2012176141140106187193118198191187189164202207202182195201250
abr 2012179102116140210199106207206206203192211220217198168215250
jan 2012194152142139215210121206205205202226215223226206163221250
out 2011192134178138223219161205204204201233220226226218181219250
jul 2011220155194133221219164202201201198241221225225216179222250
abr 2011220142127133220216159199198198195239220223226214178227250
jan 201121798138102220219118198197197194208227227226212181237250
out 2010227149212129224222152192191191189249236231229236198240250
jul 2010224164221141222222158186185185183248235228226235196238250
abr 2010223152208136217218160183182182181247231227225231191236250
jan 2010230149205131215218155181181181180245232226235235193239250
out 2009226145195132214220121178178178177220231228237232202239250
jul 2009227189186132219227150171171171170239237234240238221243250
abr 2009226128187144217228148169169169168240236232238238218241250
jan 200923697126127217231121163163163162201237233245236217241250
out 2008242136198129228243146157157157156244241240245239236243248
jul 2008240151187134225240149151151151149238238237244238231242247
abr 2008238149163130234238150146146145143235239237243238239240247
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
 WikipedistasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikipedistas (usuários registrados)
A = Wikipedistas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikipedistas que editaram pelo menos dez vezes desde que chegaram
C = Wikipedistas que contribuíram cinco vezes ou mais este mês
D = Wikipedistas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Artigos que contêm pelo menos uma ligação interna e 200 caracteres de texto legível, não contando códigos wiki e html,
      ligações ocultas, etc.; títulos também não contam (outras colunas são baseadas no método oficial de contagem)
G = Novos artigos por dia no mês passado
H = Número médio de revisões por artigo
I = Tamanho médio dos artigos em bytes
J = Porcentagem de artigos com pelo menos 0,5 kb de texto legível (veja F)
K = Porcentagem de artigos com pelo menos 2 kb de texto legível (veja F)

Base de dados
L = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
M = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
N = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
O = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
P = Total de ligações para outras wikipédias
Q = Total de imagens apresentadas
R = Total de ligações para outros sítios
S = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  5  10  100  1000  1  3  5  10  25  100  1  3  5  10  25  100  250  5  10  100 
Monthly counts for recent history of wiki
jul 20141122111      5332   42221     
jun 2014166522      53211  73311     
mai 201421721111     943211 123111     
abr 201410332221     43211  92221     
mar 201411642221     63211  102222     
fev 20141054211      63321  1144111    
jan 201414544411 11  74422  1065411 1  
dez 201316877621     96542  137442     
nov 20131287541      83331  185422     
out 20135333211     4211   7211      
set 2013135421      64111  115221     
ago 2013833221  1   5211   42221  211
jul 20131654331      53321  95411     
jun 201316644321 1   98622  74222  1  
mai 201315544321 1   54322  1354421 11 
abr 201317544222 33  53221  97421  331
mar 20131966421  872163221  125421  542
fev 20131774321  1293 83221  174311  651
jan 20131155431  15123 632111 153321  661
dez 201217765322 16134 53332  1554321 861
nov 201217764222 12122 85422  14554411961
out 20121910108521 1383 94332  18854311762
set 20121866533211083 965321 21553311642
ago 201216874211 1172 114311  1874311 541
jul 201215644221 1083 832111 2763222 66 
jun 201224666632 11103 954421 2176622175 
mai 201218865531 12103 1410852  268833  64 
abr 20121466431  11102 9541   17642   53 
mar 20122797631  982 154221  22973   43 
fev 20124218128732 1083 3210764  7022137511641
jan 201275442      54332  32211     
Quarterly counts for entire history of wiki
jul 20141122111      5332   42221     
abr 201410332221     43211  92221     
jan 201414544411 11  74422  1065411 1  
out 20135333211     4211   7211      
jul 20131654331      53321  95411     
abr 201317544222 33  53221  97421  331
jan 20131155431  15123 632111 153321  661
out 20121910108521 1383 94332  18854311762
jul 201215644221 1083 832111 2763222 66 
abr 20121466431  11102 9541   17642   53 
jan 201275442      54332  32211     
out 2011722111      1      1111      
jul 2011111111  1          21        
abr 201165541      1      21        
jan 20115444221     421    4332      
out 2010          1                
jul 2010      1          111       
abr 20101                2211      
jan 2010                           
out 2009221111             11111     
jul 20091111                        
abr 2009221                         
jan 2009444331      332    32222     
out 2008                           
jul 2008211                         
abr 2008222                         

 

Distribuição de edições de artigos por wikipedistas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikipedistasEdições total
1271100.0%24,490100.0%
38431.0%24,21798.9%
104918.1%24,02098.1%
323211.8%23,69396.7%
100176.3%22,73792.8%
316103.7%21,58688.1%
100072.6%19,18778.3%
316210.4%9,04436.9%

 

11 wikipedistas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdições 
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
 agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
SihlaineUC3 02,187101,07230nov 05, 20132671701--
МаксимUC4 01,50313772dez 29, 2011944709---
IketsiUC7 01,1651579-jun 15, 2011114117---
KoiravvaUC8 095016035843out 21, 20126477317--
Adriano MorelliUC62+371--mai 12, 201479----
RacconishUC81+24411-jan 13, 2014198----
FlorsteinUC94+7232--mai 20, 2012801----
Hmarskiy IIUC102+3031--abr 13, 2013473----
MardusUC144...22--jul 09, 201421----
VelirandUC145...22--jul 12, 201418----
DanlqUC271...11--jul 09, 201421----

 

20 wikipedistas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
  Primeira ediçãoúltima edição
 posiçãototaldatadias
atrás
datadias
atrás
Tamara UstinovaUC19,044out 19, 20111015mai 26, 201465
SebranikUC22,566mai 15, 2012806dez 29, 2013213
IgriksUC51,461set 18, 20091776mai 14, 2013442
Игорь БродскийUC61,261fev 23, 20091983jan 13, 2014198
Andrijko Z.UC9769nov 08, 20101360nov 20, 2011983
MF-WarburgUC10680fev 01, 2012910fev 07, 2013538
SuraUC11264fev 19, 20082353mar 29, 2014123
Midnight GreenUC12202ago 24, 20111071jun 25, 2012765
Triple-ADHD-ASUC13156jan 17, 20092020dez 09, 20091694
PorbóllettUC14152nov 24, 2013248jun 25, 201435
U.SteeleUC15139ago 11, 20111084jul 20, 2012740
RomaineBotUC16130mar 30, 20101583mar 30, 20101583
Connection 3UC17108jun 27, 2013398set 21, 2013312
BudelbergerUC1890dez 11, 20082057fev 22, 20091984
CastellumUC1986out 15, 2012653out 20, 2012648
O'zqonUC2085ago 25, 2012704out 25, 2012643
Gleb BorisovUC2183nov 30, 20101338mai 16, 20111171
KaiyrUC2282nov 13, 20101355set 05, 20111059
KneiphofUC2376fev 24, 20082348dez 22, 2011951
Aig mest ei varastaUC2461nov 26, 2012611mai 12, 2013444

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 744 edições foram feitas por usuários anônimos, de um total de 42507 edições ( 1e %)
  


41 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições 
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
 datadias
atrás
datadias
atrás
EmausBotUC14,375fev 03, 2012908jan 16, 2014195--
MerlIwBotUC23,510mai 10, 20111177ago 09, 2013355--
AddbotUC32,947mar 07, 2013510ago 19, 2013345--
XqbotUC41,788abr 16, 2012835mar 06, 2013511--
GerakibotUC5559mai 24, 2012797mar 06, 2013511--
JackieBotUC6555fev 09, 2012902mar 02, 2013515--
AvocatoBotUC7542fev 08, 2012903jul 10, 2012750--
LegobotUC8411mar 11, 2013506abr 02, 2013484--
RedBotUC9381abr 21, 2012830ago 21, 2012708--
JAnDbotUC10354fev 03, 2012908jul 02, 2013393--
Idioma-botUC11229fev 03, 2012908mar 05, 2013512--
YFdyh-botUC12204jun 24, 2012766fev 27, 2013518--
Makecat-botUC13185out 26, 2012642mar 05, 2013512--
HiW-BotUC14173fev 05, 2012906nov 08, 2012629--
LaaknorBotUC15134fev 04, 2012907mar 03, 2013514--
Justincheng12345-botUC16129jun 23, 2012767jan 08, 2013568--
Luckas-botUC17115abr 01, 2012850mai 20, 2012801--
VolkovBotUC18107fev 14, 2012897mar 04, 2013513--
AvicBotUC1992jun 01, 2012789dez 09, 2012598--
EscarbotUC2072mar 06, 2012876mar 03, 2013514--
KLBot2UC2169abr 13, 2013473jul 07, 2013388--
VagobotUC2253fev 29, 2012882set 04, 2012694--
SantoshBotUC2341out 24, 2012644mar 04, 2013513--
PixelBotUC2433fev 20, 2012891mar 03, 2013514--
KamikazeBotUC2533fev 29, 2012882jan 26, 2013550--
CarsracBotUC2630fev 12, 2012899fev 24, 2013521--
SynthebotUC2725mai 16, 2012805dez 30, 2012577--
WikitanvirBotUC2820fev 04, 2012907abr 05, 2012846--
RobbotUC2919fev 04, 2012907set 02, 2012696--
JotterbotUC3014jan 15, 2013561jan 26, 2013550--
DragonBotUC3111jan 12, 2013564jan 14, 2013562--
タチコマ robotUC3210dez 28, 2011945out 21, 2012647--
SassoBotUC339mai 29, 2012792mar 04, 2013513--
GhalyBotUC348dez 27, 2012580jan 31, 2013545--
CompBotUC357mar 24, 2012858mai 21, 2012800--
CocuBotUC367nov 30, 2012607fev 11, 2013534--
CommonsDelinkerUC376set 30, 20091764jan 04, 2012938--
NjardarBotUC384jun 16, 2012774out 27, 2012641--
MastiBotUC392fev 26, 2013519fev 28, 2013517--
MalarzBOTUC401ago 18, 2012711ago 18, 2012711--
TXiKiBoTUC411dez 20, 2012587dez 20, 2012587--

 

Artigos que contêm pelo menos uma ligação interna e .. caracteres de texto legível, não contando códigos wiki e html,
ligações ocultas, etc.; títulos também não contam  (excluindo páginas de redirecionamento)

DataArtigos
 < 32 ch< 64 ch< 128 ch< 256 ch< 512 ch< 1 k ch< 2 k ch< 4 k ch< 8 k ch< 16 k ch< 32 k ch< 64 k ch

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110JpgPng
jul 20145,1 k5256052738011,1 k       502
jun 20145,0 k5245952737211,1 k       502
mai 20145,0 k5235352637211,1 k       502
abr 20144,9 k5155152636711,1 k       502
mar 20144,8 k5104852636411,1 k       502
fev 20144,8 k5044752635711,1 k      280502
jan 20144,7 k4974552635611,0 k      722502
dez 20134,6 k482405263481991      839502
nov 20134,5 k477395263471970      298502
out 20134,4 k466385263391967      328502
set 20134,4 k460375263391959      144502
ago 20134,3 k432365263391958      197502
jul 20134,3 k430365263381950      361502
jun 20134,2 k422365263331949      610502
mai 20134,0 k419361763331944      530152
abr 20133,9 k410351663181920      723142
mar 20133,7 k399331663141913      378142
fev 20133,5 k272321663141907      276142
jan 20133,4 k257311663141903      240142
dez 20123,3 k248281663081899      1003142
nov 20123,0 k236281563031871      1170141
out 20122,7 k23025742981788      142761
set 20122,4 k22223642771648      22046 
ago 20122,2 k21023642591440      4396 
jul 20122,1 k19321642571398      5856 
jun 20122,0 k17515642331349      16966 
mai 20121,5 k1559641491225      11136 
abr 20129781407 21421207      365  
mar 20128741247 21411206      313  
fev 20127681045 2140 190      1723  
jan 2012678 4  131 179      239  
dez 2011610 4  131 176      464  
nov 2011471 3  128 170      222  
out 2011455 3  128 170      219  
set 2011447 3  128 170      118  
ago 2011433 3  123 167      172  
jul 2011415 3  123 166      115  
jun 2011414 3  123 164      71  
mai 2011410 3  123 164      65  
abr 2011408 3  119 164      110  
mar 2011404 3  119 164      310  
fev 2011359 3  91 161      295  
jan 2011347 3  90 157      620  
dez 2010277 3  90 155      211  
nov 2010270 3  89 155      289  
out 2010258 3  88 155         
set 2010258 3  88 155         
ago 2010258 3  88 155      2  
jul 2010257 3  88 155         
jun 2010257 3  85 155         
mai 2010257 3  85 155      4  
abr 2010254 3  85 154      1  
mar 2010254 3  84 154      161  
fev 2010249 3  63 103      2  
jan 2010249 3  63 103         
dez 2009249 3  63 103      14  
nov 2009249 3  63 103      189  
out 2009227 1  56 98      138  
set 2009173    54 85      101  
ago 2009149    43 35      5  
jul 2009148    43 35      14  
jun 2009146    43 35         
mai 2009146    43 35         
abr 2009146    43 35      12  
mar 2009145    43 35      27  
fev 2009140    39 33      36  
jan 2009127    39 32      280  
dez 200853    4 12      12  
nov 200851    2 11         
out 200851    2 11         
set 200851    2 11         
ago 200851    2 11         
jul 200851    2 11      7  
jun 200845    2 11         
mai 200845    2 11      42  
abr 200824    1 5      15  
mar 200820    1 5      21  
fev 200817    1 2      58  

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

fev 2008: 1 2 Piter , 2 1 Pätnič

mar 2008: 1 1 Šoutjärv'

abr 2008: 1 1 Šoutjärv'

mai 2008: 1 1 Šoutjärv'

jul 2008: 1 1 Mecoi

dez 2008: 1 1 Vingl

jan 2009: 1 4 Meiden Tat , 2 4 Kos'kenaluižen rajon , 3 3 Kühkjaine , 4 3 Kuruv , 5 3 Kana , 6 3 Jerusalim , 7 3 Jablokpu , 8 3 Hel'sinki , 9 3 Hab , 10 3 Biblii , 11 2 Šušt , 12 2 Šoutjärv' , 13 2 Mecantaga , 14 2 Zaiceva Nina , 15 2 Vologdan agj , 16 2 Vingl , 17 2 Vil'häl , 18 2 Vepsän rahvahaline volost' , 19 2 Vepsän , 20 2 Venäma , 21 2 Vaugedvenäma , 22 2 Uz' Zavet , 23 2 Tihvinan rajon , 24 2 Tervoil , 25 2 Suomen kel'

fev 2009: 1 2 Pälehtpol’ , 2 2 Karjalan Tazovaldkundan gimn , 3 1 Litvanma

mar 2009: 1 2 Zaiceva Nina , 2 1 Šoutjärv'

abr 2009: 1 2 Suomenma , 2 1 Vepsän

jul 2009: 1 1 Zverin lugu

ago 2009: 1 1 Suomenma

set 2009: 1 2 Pälehtpol’ , 2 1 Meiden Tat

out 2009: 1 2 Vepsän rahvahaline volost' , 2 2 Venäma , 3 2 Kuld , 4 1 Šoutjärv'

nov 2009: 1 2 Suomenma , 2 1 Zverin lugu

dez 2009: 1 2 Grekanma , 2 1 Mal't

fev 2010: 1 1 Pälehtpol’

mar 2010: 1 2 Sur' Britanii , 2 2 Pu , 3 2 Ispanii , 4 2 Hristofor Kolumb , 5 2 Saksanma , 6 2 Lönnrot Elias , 7 2 Avstrii , 8 1 Šušt

abr 2010: 1 1 Einštein Al'bert

mai 2010: 1 1 Kaliningradan agj

ago 2010: 1 1 Pol'šanma

nov 2010: 1 3 Kaliningradan agj , 2 2 Mecoi , 3 2 Litvanma , 4 2 Änine , 5 2 Podporožj , 6 2 Kaunas , 7 2 Karjalan keled , 8 2 Karjalan Tazovaldkund , 9 2 Kant Immanuel' , 10 2 Kaliningrad , 11 2 Kalevala , 12 2 Kajag , 13 2 Jurij Gagarin , 14 2 Italii , 15 2 Ispanii , 16 2 Irlandii , 17 2 Hel'sinki , 18 2 Haitmann Fridrih , 19 2 Grekanma , 20 2 Gent , 21 2 Flevoland , 22 2 Eva , 23 2 Estinma , 24 1 Zverin lugu

dez 2010: 1 4 Vasilii Surikov , 2 3 Vologdan agj , 3 3 Vinsent van Gog , 4 3 Tu-154 , 5 2 Čehov Anton , 6 2 Änižröunan rajon , 7 2 Migel' de Servantes Saavedra , 8 2 Mal't , 9 2 Lüksemburg , 10 2 Mocart Vol'fgang Amadeus , 11 2 Zaiceva Nina , 12 2 Gügo Viktor , 13 2 Vaugedvenäma , 14 2 Šeikspir Uil'jam , 15 2 Tervoil , 16 2 Suomalaiž-ugrilaine škol , 17 2 Sodjärv , 18 2 Päiväine , 19 2 Portugalii , 20 2 Podporožj , 21 2 Petroskoi , 22 2 Orav , 23 2 Nemž , 24 2 Leonardo da Vinči , 25 2 Kettunen Lauri

jan 2011: 1 3 Vengrii , 2 3 Ukrain , 3 3 Kazahstan , 4 3 Italijan kel' , 5 2 Ženevan järv , 6 2 Šoutjärv' , 7 2 Čehanma , 8 2 Änižröunan rajon , 9 2 Lüksemburg , 10 2 Vepsän kul'turan muzei , 11 2 Vepsän kel' , 12 2 Venäma , 13 2 Vaugedvenäma , 14 2 Vatikan , 15 2 Suomenma , 16 2 Slovenii , 17 2 Slovakii , 18 2 Serbii , 19 2 San Marino , 20 2 Pälehtpol’ , 21 2 Piter , 22 2 Petroskoi , 23 2 Nevondkundaližiden Socialistižiden Tazovaldkundoiden Ühtištuz , 24 2 Moskv , 25 2 Monak

fev 2011: 1 3 Kazahan kel' , 2 3 Kazahalaižed , 3 3 Händikaz , 4 2 Änižröunan rajon , 5 2 Litvanma , 6 2 Vepsän rahvahaline volost' , 7 2 Totaran kel' , 8 2 Suomenma , 9 2 Ročinma , 10 2 Petroskoi , 11 2 Kaži , 12 2 Kaleig , 13 2 Irlandii , 14 2 Grekanma , 15 2 Saksanma , 16 2 Estin kel' , 17 2 Daugavpils , 18 1 Šveicarii

mar 2011: 1 3 Venäma , 2 3 Moskv , 3 3 Kaunas , 4 2 Šokš , 5 2 Medvedev Dmitrii , 6 2 Rim , 7 2 Repin Il'ja , 8 2 Pälehtpol’ , 9 2 Putin Vladimir , 10 2 Piter , 11 2 Peitsemnižed , 12 2 Abramov Nikolai , 13 2 Kuz' , 14 2 Kuld , 15 2 Kolumb Hristofor , 16 2 Kazmused , 17 2 Karjalan Tazovaldkundan gimn , 18 2 Karjalan Tazovaldkund , 19 2 Kant Immanuel' , 20 2 Kaliningrad , 21 2 Jel'cin Boris , 22 2 Immanuel Kant , 23 2 Haitmann Fridrih , 24 2 Germanijan kel' , 25 2 Gagarin Jurii

abr 2011: 1 2 Venäma , 2 2 Kazahstan , 3 2 Bel'gii , 4 1 Šveicarii

mai 2011: 1 3 Süvär' , 2 2 Päiväine , 3 2 Pifagoran teorem , 4 2 Kolumb Hristofor , 5 2 Karjalan Tazovaldkundan Rahvahaline teatr , 6 1 Marok

jun 2011: 1 2 Karjalan Tazovaldkund , 2 2 Danii , 3 2 Bolgarii , 4 2 Alma-At , 5 1 Čehanma

jul 2011: 1 1 Ženevan järv

ago 2011: 1 3 Vezi , 2 3 Süvär' , 3 2 Šrenkan kuz' , 4 2 Venäma , 5 2 Vauged kuz' , 6 2 Tän'-šanine kuz' , 7 2 Turkmenistan , 8 2 Taškent , 9 2 Serbine kuz' , 10 2 Saratov , 11 2 Pifagoran teorem , 12 2 Peitsemnižed

set 2011: 1 5 Lezgin kel' , 2 3 Dagestan , 3 2 Ženevan järv , 4 2 Volgograd , 5 2 Samara , 6 2 Orenburg , 7 2 Omsk , 8 2 Kurgan , 9 2 Kaliningradan agj , 10 1 Zverin lugu

out 2011: 1 2 Vil'nüs , 2 2 Pälehtpol’ , 3 2 Lakan kel' , 4 2 Korsik , 5 1 Šušt

nov 2011: 1 3 Tähtaz , 2 3 Tu-154 , 3 3 Pälehtpol’ , 4 2 Vinsent van Gog , 5 2 Vikipedii , 6 2 Vikimedii , 7 2 Vezi , 8 2 Rim , 9 2 Pol'šanma , 10 2 Pifagoran teorem , 11 2 Petroskoi , 12 2 Pariž , 13 2 Paltog , 14 2 Moskv , 15 2 Kuruv , 16 2 Karjalan Tazovaldkund , 17 1 Šoutarv

dez 2011: 1 5 Vaugedpert' (Vašington) , 2 4 Amerikan Ühtenzoittud Valdkundad , 3 3 Mel'burn , 4 3 Lüblän , 5 3 Pälehtpol’ , 6 3 Pil'ved , 7 3 Oper , 8 3 Natrii , 9 3 Kundlimed , 10 3 Konstebl Džon , 11 3 Džasper (lidn, Minnesot) , 12 3 Bratislav , 13 3 Ankar , 14 2 Šur , 15 2 Šrödinger Ervin , 16 2 Šanhai , 17 2 Čuvašan kel' , 18 2 Čai , 19 2 Mafii , 20 2 MP3-plejer , 21 2 Lüblin , 22 2 Avrora (kreiser) , 23 2 Zagreb , 24 2 Vintaž , 25 2 Vepsän kel'

jan 2012: 1 4 Venäman Tazovaldkundad , 2 4 Opera , 3 4 Internet Explorer , 4 3 Čerkessk , 5 3 Čeboksarad , 6 3 Petr I Sur' , 7 3 Mozilla Firefox , 8 3 Groznii , 9 3 Google Chrome , 10 2 Čeläbinsk , 11 2 Microsoft Windows , 12 2 Microsoft Office Word , 13 2 Microsoft Office Excel , 14 2 Vašington (lidn) , 15 2 Uraližed keled , 16 2 Skopje , 17 1 Vepsän kelen aigad

fev 2012: 1 14 Pälehtpol’ , 2 5 Sarapul , 3 5 Dagestanan Tazovaldkund , 4 4 Zaiceva Nina , 5 4 Venäma , 6 4 Särg , 7 4 Petr I Sur' , 8 4 San Francisko , 9 4 Podporožj , 10 4 Petroskoi , 11 4 Orav , 12 4 Korol' i Šut , 13 4 Kijev , 14 4 Baškiran kel' , 15 4 Azerbaidžan , 16 3 Vepsän kelen aigad , 17 3 Bolgarijan kel' , 18 3 Antofagast , 19 3 Val'paraiso , 20 3 Santjago , 21 3 Konseps'jon , 22 3 Mrongovo , 23 3 Vk.com , 24 3 Lacuna Coil , 25 3 Šveicarii

mar 2012: 1 4 Soči , 2 4 Pälehtpol’ , 3 3 Buranovon Baboid , 4 3 Narv (lidn) , 5 3 Tartu , 6 3 Linkin Park , 7 3 Čehanma , 8 2 Bardan rajon , 9 2 Šeki , 10 2 Nahičevan , 11 2 Gändž , 12 2 Gai (lidn) , 13 2 Orenburgan agj , 14 2 Moščen , 15 2 Kautokeino , 16 2 Ostrav , 17 2 Himižiden elementoiden periodine tablut , 18 2 Udmurtan kelen kändod , 19 2 Rio-de-Žaneiro , 20 2 San Paulu , 21 1 Orsk

abr 2012: 1 4 Pälehtpol’ , 2 3 Vepsän nimed , 3 3 Pol'šanman administrativiž-territorialine jagand , 4 2 666 (lugu) , 5 2 Vepsän Vikipedii , 6 2 IPod , 7 2 Vodin kel' , 8 2 Lantanoidad , 9 2 Korrea Rafael' , 10 2 Ščecin , 11 2 Abdulino , 12 2 Himižiden elementoiden periodine tablut , 13 2 Melent'jeva Marija , 14 2 Zaiceva Marja , 15 2 Lämoi , 16 2 Votkinsk , 17 2 Vobl , 18 2 Jašov Viktor , 19 2 Vepsän kel' , 20 2 Šeikspir Uil'jam , 21 2 Udmurtan kel' , 22 2 Portlend (Oregon) , 23 2 Kühkjaine , 24 2 Kur'ged , 25 2 Kalitkad

mai 2012: 1 7 Pälehtpol’ , 2 6 Party for Everybody , 3 5 Piter , 4 4 Piterin metropoliten , 5 4 Vepsän Vikii , 6 4 Buranovon Baboid , 7 3 MySpace , 8 3 Euphoria , 9 3 Lorin , 10 3 Should've Known Better , 11 3 Evrovizii-2012 , 12 3 Venäman lidnad-millionerad , 13 3 Ogeruz i aznoičend , 14 3 Teräsbetoni , 15 3 Rabat , 16 3 Glittertind , 17 3 Viski , 18 3 Unheilig , 19 3 Üebermutter , 20 3 Rammstein , 21 3 Tatarstanan Tazovaldkund , 22 3 Udmurtijan Tazovaldkund , 23 3 12 (lugu) , 24 3 11 (lugu) , 25 3 10 (lugu)

jun 2012: 1 6 Lavin Avril , 2 5 Evropan futbolan čempionat 2012 , 3 5 Vikipedii , 4 4 Lorin , 5 4 Pälehtpol’ , 6 3 Bahreinan valdkundznam , 7 3 .bs , 8 3 Bagaman Sared , 9 3 Kubanin kozakišton hor , 10 3 Vepsän flag , 11 3 Norvegijan konstitucijan päiv , 12 3 Antiguan da Barbudan flag , 13 3 Belogorsk (Amuran agj) , 14 3 Blagodarnii , 15 3 Krasnodaran rand , 16 3 Jousne , 17 3 Joudjuden statui , 18 3 .us , 19 3 .dz , 20 3 FK Zenit Piter , 21 3 .al , 22 3 .nl , 23 3 Alamaiden valdkundznam , 24 3 Afganistanan valdkundznam , 25 3 .af

jul 2012: 1 4 Pohjoižsaamen Vikipedii , 2 4 Öbok , 3 3 Udmurtan Vikipedii , 4 3 Slovenijan kel' , 5 3 Evropan futbolan čempionat 2012 , 6 3 Turkanma , 7 3 Mozilla Firefox , 8 2 Centillion , 9 2 Grekan kirjamišt , 10 2 Taimir (lehtez) , 11 2 7-Zip , 12 2 Puht , 13 2 Šujan stancii , 14 2 Meliorativnii , 15 2 Bernar Sara , 16 2 Ehtbok , 17 2 Longibok , 18 2 Homendezbok , 19 2 Päivlaskm , 20 2 Päivnouzm , 21 2 Pohjoine , 22 2 Suvi , 23 2 Salavat Kupere , 24 2 Dakk , 25 2 Bangladeš

ago 2012: 1 4 Vilämovicen kel' , 2 4 Vn 2012 Kezaolimpiadan lopmižed , 3 2 Komin Vikipedii , 4 2 Ternopol' , 5 2 Fareran kel' , 6 2 Vagur , 7 2 Alitus , 8 2 Priozerskan rajon , 9 2 Priozersk , 10 2 Bugri (Vsevoložskan rajon) , 11 2 Vepsän ülüz , 12 2 Venäman flag , 13 2 Valaam , 14 2 .et , 15 2 Virrat , 16 2 Ferland Džodel' , 17 2 Hibbert Eleonor , 18 2 Nuori Karjala , 19 2 Breivik Anders Bering , 20 2 Regalado Tomas , 21 2 Windir , 22 2 Tanzwut , 23 2 Majami , 24 2 AÜV:oiden flag , 25 2 Anus (lidn)

set 2012: 1 4 Evrejan kel' , 2 4 Pälehtpol’ , 3 4 Google Chrome , 4 3 Virun kel' , 5 3 Vikingad , 6 3 Ristitun hibj , 7 3 A , 8 3 Ganter Henri , 9 3 Pussy Riot , 10 3 Ezmäine mail'man voin , 11 3 A7V , 12 3 Spalletti Lučano , 13 3 Fobijoiden nimikirjutez , 14 3 Fontanka.ru , 15 3 Modern Talking , 16 3 Polandball , 17 3 Grekan kirjamišt , 18 3 FK Zenit Piter , 19 3 Venälaižed , 20 3 Artut' , 21 3 Gändž , 22 3 Ostrav , 23 3 Brno , 24 3 Venän kel' , 25 3 Prag

out 2012: 1 4 Singapur , 2 4 Vologdan agj , 3 4 Rig , 4 3 Norvegijan Vikipedii , 5 3 Pohjoižen saldat (fil'm) , 6 3 Sar' (fil'm, Venäma, 2006) , 7 3 Dnestranrand , 8 3 Ahvenanma , 9 3 Grekanman Makedonii , 10 3 Šokolad , 11 3 Dom-2 , 12 3 Taivan' (sar') , 13 3 Pirahan (kel') , 14 3 Ternopol' , 15 3 Marti Petit Antoni , 16 3 Litvanma , 17 3 Vil'nüs , 18 3 Varšav , 19 3 Portlend (Oregon) , 20 3 Latvii , 21 3 Grekanma , 22 3 Evropan valdkundad , 23 3 Budapešt , 24 3 Berlin , 25 3 Albanii

nov 2012: 1 4 Vepsän rahvahan hor , 2 3 Lodehline aviabaz , 3 3 Kurgiden aig , 4 3 Kalarand , 5 3 «Ö»-kirjamen muštpacaz , 6 3 Mi? Kus? Konz? , 7 3 Tedr , 8 2 Pirgaine , 9 2 Randaine , 10 2 Duty free , 11 2 Jablonovskii-sild (Piter) , 12 2 Jablonovskii-sild (Krasnodar) , 13 2 Kegonpaniilind , 14 2 Pähkim , 15 2 Merikukoi , 16 2 Nug , 17 2 Habobatk , 18 2 In a Reverie , 19 2 Kodipühüt , 20 2 Kodipulo , 21 2 Jälinduine , 22 2 Kärg , 23 2 Näk , 24 2 Zor'alinduine , 25 2 Küuki

dez 2012: 1 3 Livin Vikipedii , 2 3 Gamburger , 3 3 Hot-dog , 4 3 Venäma Evrovizijas , 5 3 MySpace , 6 3 Naberežnije Čelni , 7 2 Ronson Šarlotta , 8 2 Mir (orbitine stancii) , 9 2 Bleeding Souls , 10 2 Ethereal (demo) , 11 2 Plazm , 12 2 Sleep of Right , 13 2 Lumenšur , 14 2 Hobednitid , 15 2 Kuzut om sündnu mecha , 16 2 Maseru , 17 2 Kindhad , 18 2 Truganini , 19 2 Happy Tree Friends , 20 2 Letsie III , 21 2 Suomalaine veič , 22 2 Tüp , 23 2 Nin' , 24 2 Britanijan Kuldrand , 25 2 Renault Logan

jan 2013: 1 3 Vederistmad , 2 3 Grand Theft Auto: San Andreas , 3 3 Vologdan agj , 4 2 Evenalaižed , 5 2 Evenkalaižed , 6 2 Udinalaižed , 7 2 Lumiuk , 8 2 Darginalaižed , 9 2 De Agostini , 10 2 I'm Not Afraid , 11 2 Bela Lugosi's Dead , 12 2 Wide Awake (Lacuna Coil:an pajo) , 13 2 I Won't Tell You , 14 2 Ragozina Natal'ja , 15 2 Enjoy the Silence , 16 2 Swamped , 17 2 Vepsän mifologii , 18 1 Leonardo Forti

fev 2013: 1 3 Jožin z bažin , 2 3 Pori , 3 3 Lihtenštein , 4 2 Nor'mik , 5 2 Norhein , 6 2 Habinod , 7 2 Bard (hibused) , 8 2 Real,- , 9 2 Raum , 10 2 Etimologii , 11 2 Kolin norvegijalaižed , 12 2 Lukumades , 13 2 Gitar , 14 2 Tofalaralaižed , 15 2 Doncova Dar'ja , 16 2 Lužkovan stil' , 17 2 Eht , 18 2 Orokalaižed , 19 2 Ö (aig) , 20 2 Ul'čilaižed , 21 2 Laškuzlidn , 22 2 Jugalaižed , 23 1 MOS Technology 6502

mar 2013: 1 4 Venälaine literatur , 2 4 Kitai , 3 3 Merežkovskii Dmitrii , 4 3 Bad Boys Blue , 5 3 Heitämine (serial) , 6 2 Leningradalaine zoopuišt , 7 2 Obuhovan Kaičendan prospekt , 8 2 Hamid Abdul , 9 2 Klüjev Nikolai , 10 2 Antresol' , 11 2 Lindemann Till' , 12 2 C.E.B. Reas , 13 2 Zencov Roman , 14 2 C. C. Catch , 15 2 Ph. Patrikan päiv , 16 2 Buraka Som Sistema , 17 2 Vasil'jev Boris , 18 2 Kaks'nik (starin) , 19 2 Ižand Proharčin , 20 2 Vändai (roman) , 21 2 Voin i kožmuz , 22 2 Domostroi , 23 2 Adams Duglas , 24 2 Rahvahankeskeine naižiden päiv , 25 2 Dahno Vladimir

abr 2013: 1 3 Kel'tižed keled , 2 3 Kečuan kel' , 3 3 Šotlandijan kel' (kel'tine) , 4 2 Dirbal , 5 2 Puhtaz, ajatud , 6 2 Sekret Uspeha , 7 2 Birbincpühäpäiv , 8 2 Šizofrenii , 9 2 Depressii , 10 2 Sanskrit , 11 2 Ficdžeral'd Ella , 12 2 Nganasanan kel' , 13 2 Subway Surfers , 14 2 Cut the Rope , 15 2 Čukčan kel' , 16 2 Hüväd öd, čočod! , 17 2 Welcome to the Heartbreak Hotel , 18 2 Kirj , 19 2 Surman kel'dand , 20 2 Haki (kel'kanz) , 21 2 Guaranin kel' , 22 2 Eiler Leonard , 23 2 Tuskaroran kel' , 24 2 I Can Lose My Heart Tonight , 25 2 Kombinacija

mai 2013: 1 3 Evrovizii-1956 , 2 3 Odess , 3 3 You're My Heart, You're My Soul , 4 3 Vepsän kel' , 5 3 Pil'ved , 6 2 Likutimveneh , 7 2 Kater , 8 2 Veneh , 9 2 You Shot a Hole In My Soul , 10 2 Hear What I Say , 11 2 Čistalöv Veniamin , 12 2 Azartvänd , 13 2 Diamonds , 14 2 Jankulov Stojan , 15 2 Sport , 16 2 Jumal , 17 2 Džakart , 18 2 I'm No Rockefeller , 19 2 One In a Million , 20 2 Good Guys Only Win in Movies , 21 2 Tilli Džennifer , 22 2 Kannad , 23 2 Vägestusen päiv , 24 2 Vepsän grammatik , 25 2 Kulič

jun 2013: 1 4 Moskv-Siti , 2 3 Kahtišti koumekümne koume , 3 3 Juhannus , 4 3 Mahfuz Nagib , 5 3 Psalmoiden kirj , 6 3 Lönnrot Elias , 7 3 Biblii , 8 2 Baltika (oludenkeituden kompanii) , 9 2 Hala , 10 2 Kall' (külä) , 11 2 Kobencl' Lüdvig fon , 12 2 Mišel' (pajatai) , 13 2 Petti Rajan , 14 2 Tullei , 15 2 Valendas , 16 2 Fasmer Maks , 17 2 Gar d'Aržikur P'jerrpon , 18 2 Optimal , 19 2 Virtanen Veikko , 20 2 Komiks , 21 2 Semönov Pötr , 22 2 Mompha edax , 23 2 Iče minä , 24 2 Marginal , 25 2 Eristalis intricarius

jul 2013: 1 3 Vepsän küläd , 2 3 Rand (külä, Vepsän rahvahaline küläkund) , 3 3 Reprua , 4 3 Latinan frazoiden nimikirjutez , 5 2 C. C. Catch:an pajod , 6 2 Keimada Grandi , 7 2 Jumal! Abuta minei jäda henghe kesked necidä surmarmastust , 8 2 Zanin Artöm , 9 2 Synodontis pardalis , 10 2 Ptychogena antarctica , 11 2 Dendrilla elegans , 12 2 Heteropoda shillongensis , 13 2 Slavine neopaganuz , 14 2 Tur de Frans , 15 2 I Will Survive , 16 2 Aksintant , 17 2 Süvärensu , 18 2 Gaudi Antonio , 19 2 Znamasižiden evrodiskoedestajiden nimikirjutez , 20 1 You Suffer

ago 2013: 1 2 Puerto Iguasu , 2 2 Ročilaine laud , 3 2 Ištui Härg , 4 2 Venä , 5 2 Kahesan nellikon identižuz , 6 2 Ruskedvauvaz vin , 7 2 Mail'manpän Sar' (ATOW1996) , 8 2 Niinistö Sauli , 9 2 Jufit Jevgenii , 10 2 Francijalaižiden fil'miden festival' Malagas , 11 2 Oksitanan kel' , 12 1 Änižen kanal

set 2013: 1 2 Inkeriläižed , 2 2 Karr Sara Rouz , 3 2 Žirinovskii Vladimir , 4 2 Palatoi lugu , 5 2 Mec , 6 2 Secret Star , 7 2 I Can Lose My Heart Tonight '99 , 8 2 Kitai , 9 2 Haapsalu , 10 2 You're My Heart, You're My Soul , 11 2 Vepsän ülüz , 12 2 Saha Tazovaldkund , 13 2 Afganistan , 14 2 Možg , 15 2 Vepsän Vikipedii , 16 1 Koreb Elidaspäi

out 2013: 1 2 Frigga pratensis , 2 2 Belisana strinatii , 3 2 Kelenmagii , 4 2 Nagriž , 5 2 Päč , 6 2 WASP-64 , 7 1 Boa

nov 2013: 1 3 Boršod Abaui Zemplen , 2 3 Eger (lidn) , 3 3 Heveš (agj) , 4 3 Mad'jaranman lidnad , 5 3 Japonii , 6 3 Muil , 7 3 Queen , 8 2 Jas Nad'kun Sol'nok , 9 2 Kapošvar , 10 2 D'jor , 11 2 Kečkemet , 12 2 Miškol'c , 13 2 Debrecen , 14 2 Bač Kiškun , 15 2 Pešt (agj) , 16 2 Sabol'č Satmar Bereg , 17 2 .hu , 18 2 31 (lugu) , 19 2 Tok-pisin

dez 2013: 1 4 Lindberg Čed , 2 4 Töröčik Mari , 3 3 Garipova Dina , 4 3 Blek Lukas , 5 3 Emi S'juzi , 6 3 Disnei Uolt , 7 3 Buše Viktor , 8 3 Uusberg Pärt , 9 3 Keil (lidn) , 10 3 Vas (lidn) , 11 3 Laht (lidn) , 12 3 Mad'jaranman agjad , 13 3 Peč , 14 3 Ferland Džodel' , 15 2 Itson Meri Ellen , 16 2 Volčkov Sergei Valer'jevič , 17 2 Golos , 18 2 Holodnaja Vera , 19 2 Kalašnikov Mihail , 20 2 Džerri (fil'm) , 21 2 Pekuin Anna , 22 2 Roman Pol , 23 2 Jakobi Doreen , 24 2 De Montema Damian , 25 2 Vepsläižen kodin südäin

jan 2014: 1 3 Moskv-Siti , 2 2 Karlton Lending , 3 2 Zell' , 4 2 Uorhol Endi , 5 2 Silence , 6 2 Unborn Love , 7 2 Rait Frenk Lloid , 8 2 Le Korbüz'je , 9 2 Dürer Al'breht , 10 2 Dvoržak Antonin , 11 2 Goja Fransisko , 12 2 Rubens Piter , 13 2 Umbrine škol , 14 2 Rafael' Santi , 15 2 Tverin agj , 16 2 Lendai alamalaine , 17 2 Anomalii , 18 2 Mägi , 19 2 Kalo Frida , 20 2 Protistad , 21 2 Muiktuz , 22 2 Himine ühtnend , 23 2 Biohimii , 24 2 Himii , 25 2 Need for Speed: Pigusen himo

fev 2014: 1 2 Armastusen tippud , 2 2 Heimolaižuz , 3 2 Mumbai , 4 2 Indijan štatad da territorijad , 5 2 Nothing Stands In Our Way , 6 2 Hameleonad (serial) , 7 2 Lapsed (serial, Brazilii, 2013) , 8 2 Brazilii-kolledž , 9 2 Satatadud südäikerad , 10 2 Japonine kanang , 11 2 Karusel' (serial, Brazilii, 2012) , 12 2 Vn 2014 Tal'volimpiadan lopmižed , 13 2 Laos , 14 2 Kudentoštkümnen nellikon identižuz

mar 2014: 1 2 Kall'oikahad mäged , 2 2 Bangalor , 3 2 Krim (Ukrainan region) , 4 2 Korejan Tazovaldkund , 5 2 Čennai , 6 2 So , 7 2 Maim , 8 2 Need for Speed: Pigusen himo , 9 2 Vepsän küläd , 10 2 Bass Sol , 11 2 Venesuel , 12 2 Uz' Zelandii , 13 2 Avstralii (valdkund) , 14 2 Arhangel'sk , 15 2 Nikaragua (valdkund) , 16 2 Igark , 17 2 Suviamerik , 18 1 Česmen jumalanpert'

abr 2014: 1 3 Urugvai , 2 3 The Doors , 3 3 Voihein , 4 2 Sevastopol' , 5 2 Feodosii , 6 2 Nellikod (kartankarv) , 7 2 Džomolungm , 8 2 Venäman federaližiden ümbrikod , 9 2 Suviafrikan Tazovaldkund , 10 2 Kilimandžaro , 11 2 Sabett , 12 2 Nencan kel' , 13 2 Jumalanbembel' , 14 2 Vederistmad , 15 2 Grand Theft Auto: San Andreas , 16 2 Buenos Aires , 17 2 Hristanuskond , 18 1 Koktebel'

mai 2014: 1 3 Luganskan Tazovaldkund , 2 3 Ukrain , 3 2 Suomen Vikipedii , 4 2 Jun Hen Sik , 5 2 Seong Dže-gi , 6 2 Marijampole , 7 2 Varghuz (lidn) , 8 2 Lund , 9 2 Viborg (Danii) , 10 2 Krim (Ukrainan region) , 11 2 Eupithecia turpis , 12 2 Takkiž , 13 2 Kislovodsk , 14 2 Mail'man valdkundad , 15 2 Rostov Donal , 16 2 Tallidn , 17 2 Suomenma , 18 1 Deborra-Li Förness

jun 2014: 1 2 Katar , 2 2 Malaizii , 3 2 Mongolii , 4 2 Tailand , 5 2 Tadžikistan , 6 2 Kano , 7 2 Tokio , 8 2 Tün' valdmeri , 9 2 Sevastopol' , 10 2 Džeronimo , 11 2 Öhabuk , 12 2 Ortodoksine hristanuskond , 13 2 Atlantine valdmeri , 14 1 In Čžen

jul 2014: 1 2 Egipt , 2 2 Sudan , 3 2 33 (lugu) , 4 2 Uusberg Pärt , 5 2 Novodvorskaja Valerija , 6 1 Ceilon

No data on this page have been normalized to 30 day months (as WMF does on certain traffic reports).
Wikipedias are initially ordered by number of speakers of the language

Speakers: Number of speakers of a language is the estimated total of primary and secondary speakers, is in many cases a very rough estimation (based on the page on the English Wikipedia about that language)
Regions are parts of the world where the language is spoken in substantial amounts (compared to total number of speakers). Regions where a language gained presence only by a recent diaspora are generally not included.
Region codes: AF:Africa, AS:Asia, EU:Europe, NA:North America, OC:Oceania, SA:South America, W:World Wide, CL:Constructed Language

Estatísticas geradas em Quarta-feira, 3 de setembro 2014 22:25

Dump file vepwiki-20140821-stub-meta-history.xml.gz (edits only), size 4.0 Mb as gz -> 27 Mb
Dump processed till Jul 31, 2014, on server stat1002, ready at Thu-21/08/2014-05:01 after 27 sec.

Versão do script:2.6
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.