Estatísticas da Wikilivros galego

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist

Metrics have been collected from a full archive dump, which contains all revisions of every article, meta data and raw content.
See also metrics definitions


 
Monthly counts & Quarterly rankings: março 2013
 
DataWikiautoresArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
mar 201316   1,0 k 6,21628212,8 Mb270 k2,0 k26021716434
fev 201316   1,0 k 6,2162852,8 Mb270 k2,0 k26021716434
jan 201316   1,0 k 6,2162832,8 Mb270 k2,0 k26021716434
dez 201216   1,0 k 6,21628 2,8 Mb270 k2,0 k26021816434
nov 201216   1,0 k 6,2162842,8 Mb270 k2,0 k26021816434
out 201216   1,0 k 6,2162822,8 Mb270 k2,0 k26021816434
set 201216   1,0 k 6,2162812,8 Mb270 k2,0 k26021816434
ago 201216   1,0 k 6,2162852,8 Mb270 k2,0 k26021816434
jul 201216 1 1,0 k 6,21628822,8 Mb270 k2,0 k26021816434
jun 201216   1,0 k 6,1162892,8 Mb270 k2,0 k26021816434
mai 20121612 1,0 k 6,11628342,8 Mb270 k2,0 k26021816432
abr 201215 1 1,0 k 6,11630222,8 Mb270 k2,0 k26021816332
mar 201215   1,0 k 6,11631182,8 Mb269 k2,0 k26021816331
fev 2012151  1,0 k 6162842,8 Mb269 k2,0 k26021816331
jan 201214   1,0 k 61628192,8 Mb269 k2,0 k26021816331
dez 201114 1 1,0 k 61628262,8 Mb269 k2,0 k26021816322
nov 201114   1,0 k 6162992,8 Mb269 k2,0 k26021816322
out 201114 1 1,0 k 61629192,8 Mb269 k2,0 k26021816322
set 201114   1,0 k 6163162,8 Mb269 k2,0 k25821816322
ago 201114   1,0 k 6163132,8 Mb269 k2,0 k25821816322
jul 201114 111,0 k1616261172,8 Mb269 k2,0 k25821816319
jun 201114 1 991 61657562,8 Mb265 k2,0 k25821816319
mai 201114   978 6167072,8 Mb264 k2,0 k25821816219
abr 201114 1 978 61668292,8 Mb263 k2,0 k25821815919
mar 201114 1196756,116755142,8 Mb262 k1,9 k25821815319
fev 201114 2 809 6,61853792,6 Mb243 k1,6 k25421914619
jan 201114   797 6,6184242,6 Mb238 k1,6 k25321914619
dez 201014 1 797 6,61842352,6 Mb238 k1,6 k25321814619
nov 201014 2179536,618212362,5 Mb235 k1,6 k24921814318
out 20101412 711 71992602,5 Mb230 k1,7 k24921013818
set 201013 1 707 71947362,4 Mb224 k1,7 k24921013818
ago 201013 3 693 7,11955852,4 Mb220 k1,7 k24921013318
jul 201013 1 678 7,11934422,4 Mb213 k1,6 k24821013318
jun 20101312167217,118861912,3 Mb205 k1,6 k24321011918
mai 201012 11644 7,119161282,3 Mb200 k1,7 k24321014114
abr 201012 2163247,118365252,2 Mb188 k1,6 k24321014114
mar 201012 1151827,620165492,0 Mb169 k1,5 k23121013414
fev 201012 11444 7,619731431,7 Mb141 k1,3 k22921013114
jan 201012 1143117,519261611,7 Mb134 k1,2 k22821012914
dez 200912 1141117,519393731,6 Mb128 k1,1 k22321012514
nov 20091212138217,119332951,5 Mb119 k1,0 k22321012113
out 200911 1 358 6,71994531,4 Mb115 k88522321014313
set 200911 1 34916,81986511,4 Mb112 k82422321014213
ago 200911   331 7205821,4 Mb110 k79921521014213
jul 200911   331 7205891,4 Mb110 k79921521014213
jun 200911 2 330 72054421,4 Mb109 k79621521014213
mai 200911 1132716,920422191,4 Mb107 k77620421013913
abr 200911 1 295 6,92065481,3 Mb98 k72917521010313
mar 200911   283 7214641,3 Mb97 k6701622109913
fev 200911   283 72146101,3 Mb97 k6701622109913
jan 200911   283 7214761,3 Mb97 k6711622109912
dez 200811 2 283172147731,3 Mb97 k6711622109912
nov 200811   247 7,7244291,3 Mb96 k6241622109812
out 200811 2 247 7,62474191,3 Mb98 k6261612109812
set 200811   246 7,6247971,3 Mb97 k6251492119812
ago 200811 1 246 7,62479521,3 Mb97 k6251492119812
jul 200811 1 245 7,4236591,2 Mb92 k5981452119711
jun 200811 2 244 7,42357911,2 Mb91 k5871442119511
mai 200811 1 242 7,12317281,2 Mb89 k5721402117311
abr 200811   240 7230691,2 Mb87 k5411402115411
mar 20081112 240 72306331,2 Mb87 k5411402115311
fev 200810 1 237 6,92300301,2 Mb86 k5391302115511
jan 200810   237 6,82302111,2 Mb86 k5391302115511
dez 200710 1 237 6,72301181,2 Mb86 k5391302115611
nov 200710 2 232 6,82347241,2 Mb85 k5371302115610
out 200710   232 6,7234651,2 Mb85 k5371302115610
set 200710 1 232 6,72346421,2 Mb85 k537130211569
ago 200710   218 6,9249471,2 Mb85 k535130197568
jul 200710   218 6,9249551,2 Mb85 k535130197568
jun 200710 1 218 6,9249491,2 Mb85 k535130197568
mai 200710 1 218 6,82494181,2 Mb85 k535130197568
abr 200710   217 6,82505171,2 Mb85 k535131197568
mar 2007101  216 6,72522121,2 Mb85 k523131197568
fev 2007911 216 6,72522351,2 Mb85 k523130197568
jan 20078   215 6,52520221,2 Mb85 k520130197528
dez 20068   214 6,5252991,2 Mb85 k519130197528
nov 20068 1 214 6,42529171,2 Mb85 k519130197528
out 20068   213 6,4252771,2 Mb84 k518130197528
set 20068   213 6,3252761,2 Mb84 k518130197528
ago 20068   213 6,3252741,2 Mb84 k518130197528
jul 20068 1 213 6,32527121,2 Mb84 k518130197528
jun 20068 1 212 6,32536181,2 Mb84 k517130196528
mai 2006811 208 6,32554181,2 Mb83 k515130190428
abr 20067 1 206 6,32526281,2 Mb82 k513130185428
mar 20067 1 199 6,42458291,1 Mb77 k509130174418
fev 20067 2119526,324832801,1 Mb76 k501130170418
jan 20067131133 7,22358308879 kb48 k365130104418
dez 20056 1114734,42555345669 kb58 k41411758467
nov 2005611 42 7,2304189380 kb19 k2381158336
out 2005511 34 6,3245236227 kb14 k2141153314
set 20054   19 9,432784204 kb10 k341152162
ago 20054 1 19 9,2323933203 kb10 k341152162
jul 20054 1 13 10,9324032169 kb7,0 k15105 161
jun 20054   12 9,234922162 kb6,9 k10105 16 
mai 2005421 12 9342924161 kb6,8 k10105 8 
abr 20052   11 7,637163131 kb6,8 k9105 9 
mar 20052   11 7,437132131 kb6,8 k9105 9 
fev 20052   11 7,23741 131 kb6,8 k9105 11 
jan 20052   11 7,237417131 kb6,8 k9105 11 
dez 20042   11 6,53737 131 kb6,8 k9105 11 
nov 20042 1 11 6,5373741131 kb6,8 k9105 11 
out 2004211 4 7,8820227117 kb5,4 k1106 12 
set 20041   1 470632,1 kb105 106 11 
ago 20041   1 1445 1,8 kb77 106 9 
jul 200411  1 144511,8 kb77 106 9 
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
The following table ranks this project in relation to projects in other languages with 1000+ articles
jan 201338264113231321234640372735373849
out 201238193415221520224438372735373849
jul 201238223517211519212638362735373849
abr 201238223018211119213336352735373849
jan 201238253920201817194035322534373849
out 201138203317201617193735312333373849
jul 201137213911201317192035312232363749
abr 201137233113211520203234302131353549
jan 201136233115231420204234292231343649
out 201036182413241320202634292230353549
jul 201036213314261420202933292230353549
abr 20103725281526520201434282130333249
jan 201037233415271618182034342231333549
out 200940233317301918182636322830323249
jul 200939253614301316163736322830313249
abr 200935273216311716163135353033313449
jan 200934263415291615153935323033303449
out 200834212717331415153636303132303449
jul 200831203115311614143836303131273449
abr 200830223918311714144236302930253449
jan 200830283613281714143936292727253449
out 200730263814271414144128282626253449
jul 200730303419272014143828262426243349
abr 200729273217261812123328252226233149
jan 200729273615231812123326242123232949
out 200628233115211410103224242022212749
jul 2006262629181919883322241923192749
abr 2006262427141516882519211519172649
jan 200625161991616551019231617192348
out 2005261624132614442326252020332448
jul 200522182472710442224252827352847
abr 200529192552310443120222928303047
jan 200522181771811221818202229232447
out 20041815196198221614182519201842
jul 20042119113215222121191510121424
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100ediçõesbytes
 WikiautoresArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikiautores (usuários registrados)
A = Wikiautores que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikiautores que editaram pelo menos dez vezes desde que chegaram
C = Wikiautores que contribuíram cinco vezes ou mais este mês
D = Wikiautores que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1  3  5  1  3  5  10  25  100  250  5  10  100 
mar 201321    1   311    1  
fev 2013      1   511       
jan 20131         41        
dez 2012      1   42        
nov 2012          2         
out 20121     3   851       
set 2012          111       
ago 20121     2   411       
jul 201211111      41        
jun 201211        311       
mai 20125221   2   62        
abr 20123211   11  422       
mar 201221    3   531       
fev 20122     2   4211   1  
jan 201231        21     1  
dez 20113311       4211      
nov 201111    31  7211      
out 2011421    2   632       
set 201121        5211      
ago 2011      2   10         
jul 2011311111  1   532111    
jun 201122111  1   422       
mai 20113         411       
abr 201131111  1   3111      
mar 20112111111     111       
fev 201132211      511       
jan 2011          31        
jan 20131         41        
out 20121     3   851       
jul 201211111      41        
abr 20123211   11  422       
jan 201231        21     1  
out 2011421    2   632       
jul 2011311111  1   532111    
abr 201131111  1   3111      
jan 2011          31        
out 201022221  1   521       
jul 201021111  1   111       
abr 20103221111 1   5321      
jan 2010211111  3   2111      
out 200911111      1         
jul 200911        2         
abr 200922111  1   421       
jan 2009          311       
out 2008322    1   222       
jul 2008111        3         
abr 20081         2         
jan 20081     1   2         
out 20072     2   7         
jul 20072     1   211       
abr 200741                  
jan 200751    21  21        
out 200611        111       
jul 20061111       321    11 
abr 20061111   21  11        
jan 20066432111 82  63211     
out 20053311   1   2         
jul 200511111             111
abr 20051                   
jan 20054                   
out 200411111      1         
jul 20041                   

 

Distribuição de edições de artigos por wikiautores
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikiautoresEdições total
165100.0%5,716100.0%
32741.5%5,66399.1%
101523.1%5,59197.8%
3269.2%5,45095.3%
10034.6%5,23691.6%
31623.1%5,08088.9%
100023.1%5,08088.9%
316211.5%3,97969.6%

 

2 wikiautores recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions
agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
FuragaitasUC7 03123-jun 24, 20101010----
JaviP96UC27...44--mar 18, 201312----

 

20 wikiautores recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
GallaecioUC13,979mar 02, 20081854jul 16, 2012257
LmbugaUC21,101nov 21, 20052686mar 17, 2012378
SobreiraUC3156fev 24, 20072226ago 09, 2012233
AgremonUC498set 03, 20043130fev 01, 20062614
RocasteloUC581mai 14, 20052877dez 01, 20052676
PrevertUC635jan 24, 20052987mai 24, 20091406
Xelo2004UC826out 16, 20052722jan 20, 20072261
Xoán Carlos FragaUC920out 16, 20052722out 15, 20071993
Quentinv57UC1013out 23, 2010889out 23, 2010889
ElvireUC1111abr 19, 20091441out 16, 2011531
AlguénUC1210mai 17, 20052874jun 13, 20062482
ModeradorUC1310mai 08, 20062518mai 27, 20072134
MorzaUC1410mai 28, 20101037nov 16, 2010865
HombreDHojalataUC1510mar 09, 2011752out 13, 2012168
XoséUC169abr 12, 20052909fev 29, 20081856
BasilioUC179nov 16, 20062326mar 19, 20072203
PmlineditorUC189nov 09, 20091237nov 09, 20091237
SherpardUC197mar 07, 20101119jun 16, 20101018
Cagar é soltar merdaUC207ago 19, 2010954ago 19, 2010954
Viravento2UC215abr 06, 20101089abr 06, 20101089

 

usuários anônimos, ordenados por número de contribuições
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
213.60.229.16034
85.91.87.25031
83.165.98.11721
85.91.95.24419
88.16.135.18013
213.60.77.1813
213.60.77.11111
83.49.69.24610

No total 652 edições foram feitas por usuários anônimos, de um total de 6371 edições ( 10e %)
 


Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110GifJpgPng
mar 20131,3 k427151101,1 k153 210      6166133
fev 20131,3 k418151101,1 k153 210       166133
jan 20131,3 k409151101,1 k153 210      1166133
dez 20121,3 k405151101,1 k153 210       166133
nov 20121,3 k399151101,1 k153 210       166133
out 20121,3 k398151101,1 k153 210      2166133
set 20121,3 k393151101,1 k152 208       166133
ago 20121,3 k387151101,1 k152 208      1166133
jul 20121,3 k378151101,1 k152 208      36166133
jun 20121,3 k374151101,1 k152 208      5166133
mai 20121,3 k364151101,1 k152 208      22166133
abr 20121,3 k357151101,1 k152 208      15166133
mar 20121,3 k346151101,1 k152 201      5166133
fev 20121,3 k339151101,1 k152 201      3166133
jan 20121,3 k321151101,1 k152 201      15166133
dez 20111,3 k316151101,1 k152 201      17166133
nov 20111,3 k312151101,1 k152 196      3166133
out 20111,3 k297151101,1 k152 196      10166133
set 20111,3 k288151101,1 k152 191      5166133
ago 20111,3 k283151101,1 k152 183       166133
jul 20111,3 k275151101,1 k152 183      114166133
jun 20111,3 k261151101,1 k145 99      48166133
mai 20111,3 k256151101,1 k141 99      4166133
abr 20111,3 k247151101,1 k140 99      28166133
mar 20111,2 k235151101,1 k140 98      499166133
fev 20111,1 k235151101,1 k136 96      60166133
jan 20111,1 k226151101,1 k136 94       166133
dez 20101,1 k221151101,1 k136 94      17166133
nov 20101,1 k220151101,1 k136 92      217166133
out 2010992216151101,1 k136 75      57166133
set 2010987213151101,1 k136 74      33166133
ago 2010974206151101,1 k136 72      84166133
jul 2010958188151101,1 k136 72      40166133
jun 2010949188151101,1 k136 71      185166133
mai 2010917162151101,1 k136 68      116166133
abr 2010905160151101,1 k136 66      519166133
mar 2010831151151101,1 k136 55      538166133
fev 2010717148151101,1 k136 39      133166133
jan 2010670144151101,1 k135 39      158166133
dez 2009630127151101,1 k135 39      363166133
nov 2009585126151101,1 k135 37      262166133
out 2009536125151101,1 k135 37      45166133
set 2009521125151101,1 k135 37      48166133
ago 2009501118151101,1 k135 25      1166133
jul 2009501118151101,1 k135 25      4166133
jun 2009500116151101,1 k135 25      37166133
mai 2009495115151101,1 k134 24      213166133
abr 2009470113151101,1 k133 17      47166133
mar 2009457103151101,1 k133 17      1166133
fev 200945796151101,1 k133 17       166133
jan 200945692151101,1 k133 17       166133
dez 200845692151101,1 k133 17      73166133
nov 200844891151101,1 k106 16      1166133
out 200844874141101,1 k106 16      15166133
set 200844665141101,1 k106 16      4166133
ago 200844665141101,1 k106 16      51166133
jul 200844363141101,1 k106 16      9166133
jun 200844262141101,1 k106 16      80166133
mai 200842258141101,1 k99 16      14166133
abr 200841952141101,1 k98 16      1166133
mar 200841952141101,1 k98 16      17166133
fev 200841644131101,1 k98 11      26166133
jan 200840344131101,1 k67 9      1166133
dez 200740343131101,1 k67 9      15166133
nov 20073974013841,1 k63 9      1216617
out 20073973310841,1 k52 4      216617
set 20073962910841,1 k52 4      3516617
ago 20073802610841,1 k51 4      216617
jul 20073802510841,1 k51 4      216617
jun 2007380257841,1 k50 4      716617
mai 2007380247841,1 k50 4      1116617
abr 2007379247841,1 k50 4      816617
mar 2007378247841,1 k50 4      616617
fev 2007378237841,1 k50 4      2916617
jan 2007373177841,1 k34 3      816617
dez 2006373167841,1 k32 3      616617
nov 2006372147841,1 k32 3      1116617
out 2006370147841,1 k32 3      316617
set 2006370147841,1 k32 3      116617
ago 2006370147841,1 k32 3      416617
jul 2006370137841,1 k32 3      1216617
jun 2006366137841,0 k31 3      1416617
mai 2006362137841,0 k31 3      1416617
abr 2006361137841,0 k31 3      2116617
mar 2006354136841,0 k30 3      1616617
fev 2006350136841,0 k30 3      25916617
jan 2006269116661,0 k26 3      30516473
dez 200520586491,0 k8 3      332 463
nov 2005866361,0 k4 2      86 33
out 2005462 49814 1      30 13
set 2005291 39814 1      4  3
ago 2005291 39664 1      19  3
jul 2005211 19614 1      32  1
jun 2005181 17814 1      1  1
mai 2005181 17754 1      24  1
abr 2005151  7751            
mar 2005141  7751            
fev 2005141  7751            
jan 2005141  7751            
dez 2004141  7751            
nov 2004141   1            
out 200451                
set 20041                 
ago 20041                 
jul 20041                 

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

jul 2004: 1 1 Portada

set 2004: 1 1 Portada

out 2004: 1 1 Teoría atómica

nov 2004: 1 1 EPFQ3 Gravitación

jan 2005: 1 4 Portada , 2 1 EPFQ3

abr 2005: 1 1 Formulación e Nomenclatura

mai 2005: 1 2 Lista de libros na wikilibros , 2 1 Dicionario inglés-galego de termos informáticos

jun 2005: 1 1 Tradución de programas ó galego

jul 2005: 1 1 Blender 3D: de novato a profesional/sintaxe

ago 2005: 1 1 Novela/O punto de vista

set 2005: 1 1 Blender 3D: de novato a profesional/Sistema de ventás de Blender

out 2005: 1 3 Receitas de filloas/Filloas de anís , 2 2 Receitas de filloas/Filloas de centeo , 3 2 Cociña/Filloas de caldo , 4 1 Receitas de filloas/Filloas recheas de zamburiñas

nov 2005: 1 1 Airsoft/Accesorios

dez 2005: 1 4 Portada , 2 2 Wikibooks/axuda/índice , 3 2 Dicionario inglés-galego de termos informáticos , 4 1 Nome

jan 2006: 1 3 Portada , 2 2 Cociña/Caldo galego , 3 2 Cociña/Empanada de bacallau , 4 1 Termodinámica/Entropía

fev 2006: 1 1 Exercicios de morfosintaxe en lingua galega/adxectivo

mar 2006: 1 1 Exercicios de morfosintaxe en lingua galega/demostrativo/Encrucillado 2

abr 2006: 1 1 Exercicios de morfosintaxe en lingua galega/verbo/participio 3

mai 2006: 1 1 O corpo humano

jun 2006: 1 1 Exercicios de léxico en lingua galega/Sopas/B-V

jul 2006: 1 1 Literatura/Linguaxe cotiá versus linguaxe literaria

ago 2006: 1 1 Literatura/Linguaxe científica versus linguaxe literaria

set 2006: 1 1 Alemán/Gramática/Substantivos

out 2006: 1 1 Exercicios de morfosintaxe en lingua galega/substantivo/Xénero

nov 2006: 1 2 Cociña/Polbo á feira

dez 2006: 1 1 Cociña/Revolto de cogomelos e grelos

jan 2007: 1 2 Cociña/Polbo á feira

fev 2007: 1 2 Cociña/Polbo á feira

mar 2007: 1 2 Cociña/Polbo á feira

abr 2007: 1 3 Polbo á mugardesa , 2 1 Cociña/Polbo á feira

mai 2007: 1 2 Polbo á mugardesa , 2 1 Polbo

jun 2007: 1 2 Exercicios de léxico en lingua galega/Fraseoloxía , 2 1 Exercicios de morfosintaxe en lingua galega/substantivo/Concretos e abstractos

jul 2007: 1 1 Exercicios de léxico en lingua galega/Castelanismos

ago 2007: 1 1 Termodinámica/1ª lei/Termoquímica

set 2007: 1 1 Texto

out 2007: 1 1 Historia da lingua

nov 2007: 1 1 Euskara

dez 2007: 1 1 Exercicios de vocabulario romanés - galego

jan 2008: 1 1 Exercicios de morfosintaxe en lingua galega/substantivo/Xénero

fev 2008: 1 1 Euskara/Capítulo 16

mar 2008: 1 1 C/Características

abr 2008: 1 1 Administración do tempo/Desaproveitando o tempo

mai 2008: 1 1 C/Compilar un programa

jun 2008: 1 2 C , 2 1 C/Requisitos

jul 2008: 1 1 C/Estrutura e estilo

ago 2008: 1 1 C/Variables

set 2008: 1 1 C

out 2008: 1 1 Comentarios literarios de poesía/Figuras estilísticas de Chove, chove... de Celso Emilio Ferreiro

nov 2008: 1 1 Portada

dez 2008: 1 1 VirtualBox/Compartir cartafoles

mar 2009: 1 1 Alemán

abr 2009: 1 2 HTML/Introdución , 2 1 Programación en C/Variables

mai 2009: 1 1 PHP/PHP vs ASP

jun 2009: 1 2 CSS , 2 1 Lectoescritura/A lectura/Procedemento fonolóxico versus procedemento léxico

jul 2009: 1 1 Gettext/Ficheiros

ago 2009: 1 1 Curso de lingua galega/Catro normas para falar e escribir

set 2009: 1 1 Programación en linguaxes estruturadas/Algoritmo e programa

out 2009: 1 1 PhpMyAdmin/Instalación

nov 2009: 1 1 Formación e orientación laboral/O contrato de traballo

dez 2009: 1 1 Formación e orientación laboral/Salario mínimo interprofesional

jan 2010: 1 1 Bash/sort

fev 2010: 1 1 C/Historia

mar 2010: 1 2 GNU Linux/dev , 2 1 Gettext/msgfmt

abr 2010: 1 2 C/strcmp , 2 1 Rsync

mai 2010: 1 1 GNU patch

jun 2010: 1 1 HTML/Aprendizaxe

jul 2010: 1 1 C/stdint.h

ago 2010: 1 3 C/Nomear tipos , 2 2 HTML/Editores de texto , 3 2 Bash/poweroff , 4 2 GNU Linux/boot , 5 1 C/setjmp.h

set 2010: 1 1 Proxecto integrado/Ciclo superior de Desenvolvemento de aplicacións informáticas

out 2010: 1 1 Microsoft Access 2007

nov 2010: 1 2 Curso de lingua galega/A acentuación/Acentuar ditongos e hiatos , 2 1 Microsoft Visual Basic 6/Crear controis de usuario

dez 2010: 1 1 Lua

fev 2011: 1 2 Exercicios de morfosintaxe en lingua galega/persoal/te-che , 2 1 JavaScript/Operadores

mar 2011: 1 1 PHP/preg match()

abr 2011: 1 3 Curso de lingua galega/O verbo/Paradigma dos verbos regulares , 2 1 CMake/include directories

mai 2011: 1 1 C++

jun 2011: 1 1 C++/Clases

jul 2011: 1 1 Cociña/Arroz cocido

set 2011: 1 1 Cociña/Paella sen marisco

out 2011: 1 1 Wikibooks/Listado de templates

nov 2011: 1 1 Lixo

dez 2011: 1 2 SQL , 2 1 Cociña/Medidas

jan 2012: 1 1 Patacas fritidas

fev 2012: 1 1 Cociña/Fajitas

mar 2012: 1 1 Curso de lingua galega/O verbo/Morfemas dos verbos regulares

abr 2012: 1 2 Exercicios de morfosintaxe en lingua galega/persoal/Colocación , 2 2 Exercicios de morfosintaxe en lingua galega/persoal/te-che , 3 1 Cociña/Albóndegas en salsa

mai 2012: 1 2 Cociña/Proia manteigada

jun 2012: 1 1 Albóndegas

jul 2012: 1 1 Exercicios de morfosintaxe en lingua galega/verbo/participio 3

ago 2012: 1 1 Alemán/Gramática/Artigos

out 2012: 1 1 Filloa

jan 2013: 1 1 Curso de lingua galega/O persoal/Átono/Uso de \"te\" e \"che\"

mar 2013: 1 1 Exercicios de morfosintaxe en lingua galega/persoal/Colocación

Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Terça-feira, 23 de abril 2013 19:07

Dump file glwikibooks-20130408-pages-meta-history.xml.7z (full dump), size 1.6 Mb as 7z -> 35 Mb
Dump processed till Mar 31, 2013, on server stat1, ready at Tue-09/04/2013-13:20 after 15 sec.

Versão do script:2.6
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.