Estatísticas da Wikinotícias árabe

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist

Metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.
See also metrics definitions


 
Monthly counts & Quarterly rankings: junho 2015
 
DataWikinoticiaristasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
jun 2015+4%   +2%   -27%      0%
mai 20150%   +3%   +38%      +1%
abr 20150%   +2%   -8%      0%
mar 20150%   +2%   +39%+1%0%0%0% -0%0%
fev 2015+2%   +2%   -59%+1%0%0%0% 0%0%
jan 2015+4%   +2%   +150%+2%+1%+1%0% 0%0%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
jun 20155422 2,2 k15,3 72      349
mai 201552 2 2,1 k25,4 99      349
abr 201552 2 2,1 k15,5 72      347
mar 201552 1 2,0 k15,61624787,6 Mb548 k1,1 k70784,2 k347
fev 20155211 2,0 k15,61625567,6 Mb547 k1,1 k70784,2 k347
jan 20155123 2,0 k15,716251357,5 Mb546 k1,1 k70784,2 k346
dez 20144912 1,9 k15,81629547,3 Mb543 k1,1 k70784,2 k345
nov 201448 1 1,9 k15,81629367,3 Mb542 k1,1 k70744,2 k345
out 201448   1,9 k 5,8162997,3 Mb543 k1,1 k74744,2 k345
set 201448   1,9 k 5,91629137,3 Mb543 k1,1 k74744,2 k345
ago 201448 1 1,9 k 5,91728187,6 Mb576 k1,1 k74744,2 k345
jul 20144813 1,9 k15,91729467,6 Mb575 k1,1 k73734,2 k345
jun 20144722 1,8 k 5,91733347,5 Mb572 k1,1 k737 4,2 k344
mai 20144512 1,8 k161735587,5 Mb571 k1,1 k737 4,2 k343
abr 20144424 1,8 k3617451107,4 Mb569 k1,1 k737 4,2 k341
mar 20144211 1,7 k 6,31647286,9 Mb534 k1,1 k737 4,2 k341
fev 201441   1,7 k 6,31650246,8 Mb532 k1,1 k737 4,2 k341
jan 20144112 1,7 k16,31653396,8 Mb531 k1,1 k737 4,1 k338
dez 20134011 1,7 k 6,31659176,8 Mb528 k1,1 k737 4,1 k337
nov 20133911 1,7 k 6,31659196,8 Mb527 k1,1 k737 4,1 k337
out 20133813 1,7 k 6,41660466,8 Mb525 k1,1 k737 4,1 k336
set 201337 3 1,6 k 6,41661356,7 Mb524 k1,1 k737 4,1 k336
ago 2013371511,6 k16,416611686,7 Mb522 k1,1 k720 4,1 k336
jul 2013361311,6 k16,516571576,5 Mb512 k1,1 k686 4,0 k331
jun 201335 411,6 k16,516471916,4 Mb501 k1,1 k655 3,9 k329
mai 201335 111,5 k16,516321666,2 Mb486 k1,1 k614 3,8 k327
abr 2013351311,5 k16,616303546,1 Mb476 k1,1 k588 3,7 k325
mar 201334 111,5 k16,516292065,9 Mb461 k1,1 k515 3,6 k320
fev 2013341211,4 k16,516242635,8 Mb452 k1,1 k459 3,5 k316
jan 201333 111,4 k16,516183845,7 Mb439 k1,1 k409 3,4 k314
dez 201233 211,4 k16,316171905,5 Mb427 k1,1 k389 3,3 k308
nov 2012332211,3 k16,416142055,4 Mb415 k1,0 k353 3,2 k306
out 201231 211,3 k16,416187405,3 Mb409 k1,0 k344 3,1 k302
set 2012311411,2 k1616153265,1 Mb401 k1,0 k32013,0 k299
ago 201230 311,2 k15,916161565,0 Mb386 k99430312,9 k295
jul 2012301421,2 k2616133464,9 Mb374 k99030012,8 k290
jun 201229 311,1 k1616082184,6 Mb353 k97028912,6 k282
mai 2012291211,1 k1616092354,4 Mb339 k96328012,5 k273
abr 20122812 1,0 k16,11618744,3 Mb326 k95126712,4 k265
mar 201227 1 1,0 k 6,11615124,2 Mb320 k935264 2,3 k265
fev 20122712 992 6,11617244,2 Mb319 k935264 2,3 k265
jan 20122611 985 6,216101104,2 Mb316 k935264 2,3 k265
dez 201125   983 6,11612594,1 Mb316 k935264 2,3 k265
nov 201125 1 983 61613204,1 Mb316 k93525912,3 k264
out 20112522 972 6,11612574,1 Mb314 k935259 2,3 k264
set 201123   959 6,11626244,1 Mb313 k934238 2,3 k255
ago 201123 1 953 6,11626204,1 Mb313 k934238 2,3 k255
jul 201123 2 945 6,116283134,0 Mb313 k934238 2,3 k253
jun 20112312 93915,81601624,0 Mb313 k93424042,3 k246
mai 201122 3192125,915925263,9 Mb306 k84624042,3 k242
abr 20112212 84925,713371092,8 Mb232 k2,7 k24042,2 k239
mar 20112123278626,110795312,2 Mb176 k1,4 k24041,6 k239
fev 201119 1 712 6780141,5 Mb116 k199219 880227
jan 201119   704 6780131,5 Mb116 k199218 880227
dez 201019   704 6780121,5 Mb116 k199217 880227
nov 201019   703 677851,5 Mb115 k199218 880227
out 201019   702 677921,5 Mb115 k199216 880227
set 201019   702 677921,5 Mb115 k199215 880227
ago 201019   701 677991,5 Mb115 k199215 880227
jul 201019 1 695 6778111,5 Mb115 k199215 879227
jun 201019 2 692 6779421,5 Mb115 k199215 877226
mai 201019 1 685 6785481,4 Mb115 k194168 874225
abr 201019   677 6785131,4 Mb114 k193168 866223
mar 201019   676 678511,4 Mb114 k193169 865222
fev 2010191  676 6780121,4 Mb113 k193197 862222
jan 201018 1 673 6783121,4 Mb113 k192197 862222
dez 200918 1 670 6783151,4 Mb113 k188197 859219
nov 200918   669 6784131,4 Mb113 k188194 858218
out 200918   667 6785281,4 Mb113 k188194 858217
set 20091813 662 67813841,4 Mb112 k188194 856217
ago 20091713 65515,57861611,4 Mb111 k18619121852210
jul 20091614 62425,57932421,3 Mb106 k18417221821194
jun 200915 4 57015,67742031,2 Mb93 k18116420763165
mai 200915 3 54315,57661481,1 Mb88 k18214220728161
abr 20091538350755,67527731,0 Mb81 k17912526692154
mar 200912410236975,69001,3 k788 kb63 k166982755648
fev 2009822116624,91071247411 kb32 k158521034619
jan 20096   106 5,310732254 kb19 k1044892978
dez 20086   106 5,31073 255 kb19 k1044892978
nov 20086 1 106 5,3107319255 kb19 k1044892978
out 20086   99 5,410771229 kb19 k1034892978
set 20086 1 98 5,5107734226 kb19 k1034892978
ago 20086   97 5,211902224 kb17 k1034891278
jul 20086   97 5,21190 224 kb17 k1034891278
jun 20086   97 5,211903224 kb17 k1034891278
mai 20086   97 5,11190 224 kb17 k1034091278
abr 20086   97 5,111903224 kb17 k1034091278
mar 20086   96 5,21197 223 kb17 k1034081268
fev 20086   96 5,211971223 kb17 k1034081268
jan 20086   96 5,111971223 kb17 k1034081268
dez 20076 1 96 5,1119726223 kb17 k1034081268
nov 20076 1 92 5,1123430215 kb16 k30408927
out 20076   91 4,812092208 kb16 k30318917
set 20076   90 4,81209 207 kb16 k30318917
ago 20076   90 4,81209 207 kb16 k30318917
jul 20076 1 90 4,8120959207 kb16 k30318917
jun 20076   90 4,210392207 kb11 k30318987
mai 2007611 90 4,2103927207 kb11 k30318987
abr 2007512 8014,31145117189 kb10 k19318767
mar 2007411 58 4128860155 kb8,9 k7318134
fev 20073   58 2,912804152 kb9,4 k7278142
jan 20073   57 2,912693149 kb9,2 k5278142
dez 20063   55 312721141 kb9,0 k5278142
nov 20063   54 312721140 kb9,0 k5278142
out 20063   54 31272 140 kb9,0 k5278142
set 20063   54 312722140 kb9,0 k5278142
ago 20063   53 3126041137 kb8,7 k5279132
jul 20063   49 2,41319 116 kb9,0 k52710132
jun 20063   49 2,413194116 kb9,0 k52710132
mai 20063   47 2,413192114 kb9,0 k52710132
abr 20063   47 2,413194114 kb9,0 k52710132
mar 20063 1 47 2,3131411113 kb8,9 k52710132
fev 20063 1 44 2,2131514107 kb8,7 k52710122
jan 20063   42 212868101 kb8,3 k52710122
dez 2005332 3911,911157586 kb7,0 k11235182
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
The following table ranks this project in relation to projects in other languages with 1000+ articles
abr 201513 15 141015 12      18
jan 201513398141115111013141116181418
out 2014138178141115111713141116181418
jul 2014138127141115111413131116181418
abr 201415510514214111113131116181318
jan 2014157138141014111412131116181318
out 2013167108141214111412131116181218
jul 20131681210141114111212131116181218
abr 2013151014915141410912131116181218
jan 2013158171116121310712131117181318
out 2012151013816121210412141117181318
jul 2012158941681310812141117181418
abr 2012167139161213101212141117181518
jan 201216111711151315151312141017181418
out 2011168151115131515151213917181318
jul 201116111481512141481212917181218
abr 201116915101491414131214616181218
jan 201116131812141514141816161516181518
out 20101581710141413131815161516181418
jul 201015121411141313131615161516171418
abr 2010159168141213131615161516171418
jan 20101511158131212121614151316171418
out 200914101610131312121514151316171418
jul 2009141111913812121014151316151418
abr 2009146831341212515151316141518
jan 200916151510161312121616161316151518
out 200816121311161412121616161316151517
jul 200816111511161211111716161316151617
abr 2008168149161111111516161215151617
jan 200815111511151410101615151215151417
out 200715121310151210101415151415131515
jul 2007158128151010101015151415131515
abr 20071591371511991015151415131515
jan 200715101491511991515151515131515
out 200615101361511881415151515131515
jul 200615101481510881415151515131515
abr 200614101281410771214141414121415
jan 2006131113101311771313131313111314
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100ediçõesbytes
 WikinoticiaristasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikinoticiaristas (usuários registrados)
A = Wikinoticiaristas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikinoticiaristas que editaram pelo menos dez vezes desde que chegaram
C = Wikinoticiaristas que contribuíram cinco vezes ou mais este mês
D = Wikinoticiaristas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  5  10  100  1  3  5  10  25  100  250  5  10  100  1000  1  3  5  10  25  100  250  5  10  100 
jun 201515421     63211      12431      
mai 201518521     4          1421       
abr 20151562      71     222 1121    11 
mar 20151731      101     111 1852       
fev 201516311     102         23631      
jan 201516431     9311       2243       
dez 201413221     621111     1741       
nov 20141411      31         122        
out 201471      4          82        
set 20144       41         101        
ago 2014511      3          13311   211
jul 20146432     73211      7532   1  
jun 20146222     211111     7221   21 
mai 20147321     1          102        
abr 2014281042     2          1631    1  
mar 20146211     522        822    11 
fev 201484      51         1243    11 
jan 20147321     11         12432   11 
dez 2013431      6211111    1121    1  
nov 20134211     4      11  1831       
out 20138431     41         13521   11 
set 20131163      41         126321  21 
ago 2013755311    7331       92211  11 
jul 2013633211 1  211    11  1042111 331
jun 2013844211    82111  111 511111 22 
mai 2013621111 11 3111   111 1022111 221
abr 20131143311 11 105411  111 20421111221
mar 2013721111 21 73211  211 10432111431
fev 20131232211    5311   111 1022111122 
jan 20137111111   3111   111 6211111221
abr 20151562      71     222 1121    11 
jan 201516431     9311       2243       
out 201471      4          82        
jul 20146432     73211      7532   1  
abr 2014281042     2          1631    1  
jan 20147321     11         12432   11 
out 20138431     41         13521   11 
jul 2013633211 1  211    11  1042111 331
abr 20131143311 11 105411  111 20421111221
jan 20137111111   3111   111 6211111221
out 2012622211111183331  111 14533111332
jul 2012844332    75443  11  2275332122 
abr 201263211    532    111 115431  11 
jan 201222111           111 61111  11 
out 201110222     32211      111        
jul 201183211 11132221  1   104221  111
abr 201163222    3          1732    21 
jan 2011     11 11111  11  1032    22 
out 20102       1          10      32 
jul 2010411                 711       
abr 201011      51111  111 124     221
jan 2010311      111111     83331     
out 200943   11 21111      83221  1  
jul 2009125443    114321      2054441 11 
abr 20091598533111 15753111    2398541 221
jan 2009        4          642       
out 20081       1          1242       
jul 2008                   6321      
abr 20081       1          51111     
jan 2008        3          3         
out 2007        2          321       
jul 200711111    11         52111     
abr 200722221 11 62222      722221 11 
jan 2007                             
out 2006                   1         
jul 2006                   31        
abr 2006        1          4         
jan 20064       2          2         

 

Distribuição de edições de artigos por wikinoticiaristas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikinoticiaristasEdições total
1354100.0%8,993100.0%
310629.9%8,65196.2%
105415.3%8,36093.0%
32174.8%7,66985.3%
10092.5%7,11779.1%
31641.1%6,26869.7%
100030.8%5,69063.3%
316210.3%3,20035.6%

 

15 wikinoticiaristas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions
agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
CommonsDelinkerUC20 030119-set 16, 20092112----
TarawnehUC24+72542231jun 01, 2014393113--
Taher2000UC46+181363213jul 05, 201435941--
Ghanooo1UC47...13131616jun 17, 20151233--
AhlcairoUC128...33--jun 14, 20151533--
Ikhlas Qassmi 13336UC171+160216963abr 12, 2015781---
Mourini omarUC178...2222jun 13, 20151611--
الداكريUC347...1122jun 03, 201526----
JoelCadle875608UC348...11--jun 05, 20152411--
Mohammed bargachUC349...11--jun 06, 20152311--
فرحان حلجيUC350...11--jun 09, 20152011--
الشبح المغربيUC351...11--jun 09, 201520----
محرر الويكي الأفضلUC352...11--jun 25, 2015411--
&kolett34UC353...11--jun 26, 20153----
Mohammad hajeerUC354...11--jun 26, 2015311--

 

20 wikinoticiaristas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
PICAWNUC13,200abr 17, 20121168jul 04, 2014360
SeHUC21,419fev 14, 20092326jun 02, 20101853
CiphersUC31,071fev 21, 20092319fev 20, 2013859
Meno25UC4578mar 22, 20073021fev 26, 2014488
خلدون شنتوتUC5279mar 05, 20111577mai 10, 20111511
AzitonyUC6177jun 23, 20121101nov 13, 2013593
عباد ديرانيةUC7148mai 11, 20111510set 15, 2013652
Mo7amedsalimUC8142mar 02, 20092310ago 19, 20092140
روخوUC9103nov 18, 20092049jan 07, 20121269
وليد شرف الدينUC1097abr 24, 20111527mai 18, 20111503
OsamaKUC1192abr 02, 20073010dez 24, 20072744
براق سالمUC1281mar 23, 20092289mar 30, 20092282
محمد أحمد عبد الفتاحUC1374dez 21, 20072747mar 05, 2014481
باسمUC1461fev 11, 2013868out 09, 2013628
Ash2005~arwikinewsUC1551dez 13, 20053485dez 20, 20053478
AvocatoUC1651mai 12, 20111509ago 11, 20121052
Mr. IbrahemUC1745mai 14, 2013776mai 30, 201530
Centrino7UC1831jul 22, 20092168jul 29, 20092161
رضاUC1931out 26, 2012976nov 17, 2012954
Beko777UC2126jan 03, 2014542fev 01, 2014513

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 682 edições foram feitas por usuários anônimos, de um total de 11583 edições ( 5e %)
  


16 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
MenoBotUC11,170set 29, 20092099jan 23, 2014522--
CipherBotUC2191mar 27, 20092285mai 05, 20111516--
XeBotUC3181mar 23, 20092289jul 18, 20092172--
AvocatoBotUC4118jul 28, 20111432jul 26, 2013703--
TrBotUC576mar 08, 20092304mar 15, 20092297--
OKBotUC637abr 03, 20073009dez 26, 200727421-
VolkovBotUC734abr 17, 20092264abr 15, 2013805--
SahimrobotUC831mai 20, 20111501mai 20, 20111501--
GrondinBotUC922mai 17, 20092234out 31, 2013606--
MjbmrbotUC1015nov 12, 20101690mar 14, 20111568--
KamikazeBotUC1112dez 17, 20111290dez 18, 20111289--
JAnDbotUC124jun 13, 2013746ago 13, 2014320--
AlexbotUC132jun 06, 20082579jun 20, 20082565--
DorganBotUC141jun 07, 20082578jun 07, 20082578--
K.J.BotUC151jan 26, 20101980jan 26, 20101980--
AmirobotUC161mar 13, 20111569mar 13, 20111569--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110JpgOggPng
jun 20152,5 k71266610170649272,1 k42363     325
mai 20152,5 k70766110170648272,1 k42351     325
abr 20152,4 k70665910170648272,1 k42340     325
mar 20152,4 k70065810170648272,1 k42325    32325
fev 20152,3 k69265710170648272,1 k42313    39325
jan 20152,3 k68165510170643272,1 k41303    49325
dez 20142,3 k67065410170643272,1 k41286    30325
nov 20142,2 k66364910170642272,1 k41272    20325
out 20142,2 k65864810170642272,0 k41260    9325
set 20142,2 k65564810170640272,0 k41257    6325
ago 20142,2 k64864710170640272,0 k41253    11325
jul 20142,2 k64464510170640272,0 k41251    45325
jun 20142,2 k64264410170638262,0 k41247    33325
mai 20142,2 k64164310170638262,0 k41246    31325
abr 20142,1 k63964210170638262,0 k41246    77325
mar 20142,0 k63364110170638262,0 k41240    23325
fev 20142,0 k62964010170637262,0 k41239    23325
jan 20142,0 k62263310170637262,0 k41237    37325
dez 20132,0 k61363210170637262,0 k41236    16325
nov 20132,0 k61063110170637262,0 k41235    19325
out 20132,0 k60263010170636262,0 k41234    31325
set 20132,0 k59562910170636262,0 k41229    32325
ago 20132,0 k57662810170636262,0 k41226    160325
jul 20131,9 k57162710170633261,9 k41224    147325
jun 20131,9 k56462510170625251,9 k41224    188325
mai 20131,9 k56362410170617251,9 k41222    152325
abr 20131,8 k56062110168601251,8 k41218    317325
mar 20131,8 k55261710167572251,7 k41213    183325
fev 20131,7 k54061410162566251,7 k41211    253325
jan 20131,7 k53161210162553251,6 k41207    380325
dez 20121,7 k52760610160508251,5 k41202    189325
nov 20121,6 k52160010160494241,4 k41202    204325
out 20121,6 k52059610160487241,4 k41199    363325
set 20121,5 k50757910159413231,2 k41195    303325
ago 20121,5 k49456610156363221,2 k41189    156325
jul 20121,5 k48655810156349221,1 k40182    333325
jun 20121,4 k4765479154337211,1 k40175    213225
mai 20121,3 k4655449153324211,0 k40166    228225
abr 20121,3 k45654191533182094640157    72225
mar 20121,3 k45053791533172092338151    7225
fev 20121,3 k44653791533172092338151    21225
jan 20121,2 k43553791533172092238150    105225
dez 20111,2 k43053591532862091336150    2225
nov 20111,2 k42653591532862091336149    16225
out 20111,2 k41253591532862091336148    55225
set 20111,2 k40453591532862091336144    8225
ago 20111,2 k39753591532861991336142    17225
jul 20111,2 k39053591532841990036141    74225
jun 20111,2 k37553491532811987836139    37225
mai 20111,2 k36553491532791986536139    483225
abr 20111,1 k36053291532791885736138    104225
mar 20111,0 k34652891532791885235138    373225
fev 201193934251181532731884335136    10224
jan 201193133650881532731884335135     224
dez 201093133050781532731884335133    4224
nov 201093032550681532731884135130    1224
out 201092932250681532731884135127    2224
set 201092931850681532731884135125    2224
ago 201092831150681532731884135123    5224
jul 201092229450481532711884133119    9224
jun 201091829350481532711884033118    29224
mai 201091026350481532711883533110    38224
abr 201090026243081512701882733107    4224
mar 201089825342881512701882533103    1224
fev 20108982474268151270188253397    6224
jan 20108952364088151270188213394    11224
dez 20098892213908144266188203391    8224
nov 20098872163908144266188203389    7224
out 20098842143288144266188203384    12224
set 20098792142978144266188203279    55224
ago 20098652072663144266188163272    137111
jul 20098182042623144261187963255    232111
jun 20097351961913142255167722135    120111
mai 20097041911903142250167561425    139111
abr 20096611861333142247167331315    725111
mar 20094171471323142200166801110    941111
fev 2009185130571133172136009     239  1
jan 2009114116291133145101402        1
dez 200811411429113314510139         1
nov 200811411329113314410139      8  1
out 20081079829113314410139      1  1
set 20081068529113314410139      34  1
ago 20081058129113013610123      2  1
jul 20081057627111012410123         1
jun 20081057627110212410123         1
mai 2008105672714312410123         1
abr 2008105652713312410123      2  1
mar 2008104632712212310123         1
fev 2008104562712212310123         1
jan 2008104492712212310123         1
dez 2007104472712212310123      11  1
nov 200799402612212010123      28  1
out 200798402612212010120         1
set 200797392612211710120         1
ago 200797382612211710120         1
jul 200797362612211610120      59  1
jun 20079735261221031117      2  1
mai 200797352512258178      26  1
abr 200787292512141178      94  1
mar 20076224191151712      58  1
fev 2007601714131412      3  1
jan 2007591514131412         1
dez 2006571514131412         1
nov 2006561414131412         1
out 2006561414131412         1
set 2006561313131412         1
ago 2006551313131412         1
jul 2006511113131412         1
jun 200651913121411         1
mai 200649913121411         1
abr 200649913121411         1
mar 200649713121411      6  1
fev 20064671312141          1
jan 20064471212131          1
dez 2005417121213           1

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

dez 2005: 1 3 الصفحة الرئيسية , 2 2 صدام حسين هل يدلي بصوته بالسجن اليوم؟ , 3 2 تحت شعار \"الدفاع عن الإسلام\" قمة مكة تختتم أعمالها , 4 1 خدام ينشق عن النظام البعثي السوري

jan 2006: 1 2 حماس تحصل على أغلبية الأصوات في الانتخابات التشريعية الفلسطينية

fev 2006: 1 1 أزمة الرسوم الكاريكاتورية المسيئة للنبي محمد

mar 2006: 1 1 الجيش الإسرائيلي يحاصر سجن أريحا لمدة 11 ساعة

fev 2007: 1 1 منتدى الحوار الأمريكي الإسلامي

mar 2007: 1 1 ضغوط أميركية لإقالة وزير الداخلية العراقي بعد فضيحة تعذيبه لمئات المعتقلين

abr 2007: 1 2 جنبلاط يدعو كل اللبنانيين لصد العدوان و تحرير الأرض , 2 2 بيان قمة مجلس التعاون الخليجي يحث سوريا على التعاون مع الأمم المتحدة , 3 1 آخر الأخبار/30 أبريل 2007

mai 2007: 1 2 آخر الأخبار/16 مايو 2007 , 2 1 مايو 2007

jun 2007: 1 1 بريطانيا ترفض عرضا إسبانيا لإدارة مطاراتها

jul 2007: 1 1 مقتل نائبين في انفجار مقهى البرلمان العراقي

nov 2007: 1 1 مؤسسة ويكيميديا من بين رواد تكنولوجيا المنتدى الاقتصادي العالمي 2008

dez 2007: 1 2 ديسمبر 2007 , 2 1 آخر الأخبار/22 ديسمبر 2007

abr 2008: 1 1 مايو 2007

ago 2008: 1 1 كوريا الشمالية توافق على تعطيل أهم مفاعل نووي

set 2008: 1 2 مصر تفتح معبر رفح للفلسطينين

out 2008: 1 1 مقتل يورج هايدر في حادث سير

nov 2008: 1 1 حزب التحرير: أمريكا لا تنتظر أكثر من ضربة قاضية تسدد لها حتى تسقط عن عرشها العالمي

fev 2009: 1 3 انفجار في حي الحسين بالقاهرة , 2 2 تحطم طائرة تركية في الأراضي الهولندية , 3 2 إيران على بعد خطوات من تشغيل محطة بوشهر النووية , 4 2 أوباما يلقي كلمة في الكونجرس ويعد بتغيير سياسي واقتصادي قريب , 5 2 اتصالات الجزائر تطلق خدمة موجات , 6 2 محكمة الجنايات الدولة ستصدر قرارها بشأن الرئيس السوداني عمر البشير , 7 2 جوجل تنفي أن تكون قد اكتشفت مدينة \"أطلانطس\" الأسطورية , 8 2 تصاعد اللهجة من جديد بين حركتي حماس و فتح , 9 2 ألمانيا تحدد شروطا لاستقبال معتقلين من غوانتنامو , 10 1 نوري المالكي يؤكد أن بإمكان قواته الحفاظ على الأمن في العراق

mar 2009: 1 3 السجن لضابط مصري بتهمة التعذيب حتى الموت , 2 3 مدعي الجنائية الدولية قدم معلومات مغلوطة عن دارفور , 3 3 مقتل أربعة في ضربة صاروخية في شمال غرب باكستان , 4 3 حماس تقول أنها استأنفت مفاوضات تبادل الأسرى , 5 3 انتهاء مواجهات أم الفحم و الإفراج عن رائد صلاح , 6 3 انتخابات اليابان قد تأتي بسياسات مناخية أكثر صرامة , 7 3 حزب العمل يصوت بالموافقة للانضمام إلى حكومة نتنياهو , 8 3 البابا يحث الزعماء الأفارقة على مساعدة المعوزين , 9 3 تحطم طائرة شحن قرب طوكيو , 10 3 إبطال مفعول قنبلة كانت في سيارة ملغمة في مركز تجاري في حيفا , 11 3 حزب التحرير يعقد ندوة سياسية في قلقيلية , 12 3 مزارعون في الأرجنتين يقيمون إضراب احتجاجا على الضرائب , 13 3 اصطدام لسفينتين حربيتين أمريكيتين في مضيق هرمز , 14 3 الاتحاد الأفريقي يحظر عضوية مدغشقر بسبب التوتر الحكومي هناك , 15 3 استعادة اللوحات المسروقة من قصر محمد علي , 16 3 اختطاف 4 عمال إغاثة في الصومال , 17 3 البرلمان الكويتي يستقيل من جديد والأمير يقبل بذلك , 18 3 انطلاق المنتدى العالمي للمياه في إسطنبول , 19 3 الإفراج عن 3 من منتسبي منظمة أطباء بلا حدود في دارفور , 20 3 اغتيال رئيس غينيا بيساو , 21 3 الصفحة الرئيسية , 22 2 دعوة الأسد للقادة العرب برفض اعتقال البشير , 23 2 البشير يتهم إسرائيل بدعم متمردي دارفور , 24 2 القذافي :الجنائية شكل جديد من \"الإرهاب الدولي\" , 25 2 مساندة البشير وتخفيف الانقسام بشأن إيران من أولويات قمة الدوحة

abr 2009: 1 3 استطلاع: غالبية الإسرائيليين يخفون هويتهم بالخارج , 2 3 مركبة \"سويوز\" تعود إلى الأرض بعد انتهاء مهمتها , 3 3 مسلح يقتل 13 شخصا بنيويورك وينتحر , 4 3 الصفحة الرئيسية , 5 2 معاناة التجمعات البدوية في فلسطين , 6 2 انطلاق تظاهرة بيروت عاصمة للكتاب العالمي , 7 2 إطلاق قناة سورية معارضة جديدة , 8 2 السعودية تعترف باستقلال كوسوفو , 9 2 نجاد يثير موجة من الاستياء في صفوف حضور مؤتمر العنصرية في جنيف إثر حديثه عن العنصرية التي تمارسها إسرائيل في فلسطين , 10 2 إطلاق الهند قمر صناعي للتجسس اشترته من إسرائيل , 11 2 سقوط طائرة صغيرة في فلوريدا , 12 2 الأمير نايف يقول أن تنشئة الجيل الصاعد على منهج أهل السنة حماية لهم من الأهواء , 13 2 كلينتون تدعو لرفع الحظر عن جزر كوبا , 14 2 مسلمو القدس يمنعون اليهود من اقتحام المسجد الأقصى , 15 2 العثور على تمثال قناع وجه يعتقد أنه لكليوباترا , 16 2 إسرائيل و الولايات المتحدة الأمريكية تقومان بإجراء مناورات جوية في ما يبدو أنه تحذير لإيران , 17 2 إيفو مورالس ينهي إضرابه عن الطعام بعد استجابة الكونجرس البوليفي لمطالبه حول قانون الانتخاب , 18 2 حركات و دعاة إسلاميون يحذرون من اقتحام المستوطنين للمسجد الأقصى غدا , 19 2 أبو الغيط يوجه اتهامات لإيران بالتآمر لاغتيال مبارك , 20 2 بدأ مؤتمر العلاقات السورية اللبنانية في دمشق , 21 2 \"سامي شهاب\" يعتذر من نصرالله على فشله , 22 2 أوراسكوم تعرض على أورانج آخر فرصة للاتفاق بشأن موبينيل , 23 2 المعارضة الجورجية تدعو إلى نقل التظاهرات إلى مبنى الرئاسة , 24 2 هجوم على سائح إسرائيلي في سيناء , 25 2 إيفو مورالس يدخل في إضراب عن الطعام

mai 2009: 1 3 بايدن في بيروت يربط استمرار الدعم بنتائج الانتخابات , 2 3 مصرع 99 شخصا بتحطم طائرة عسكرية أندونيسية , 3 2 سوريا تنفي إلغاء صفقة طائرات حربية روسية , 4 2 توقيف أربعة أشخاص حاولوا تنفيذ هجمات في نيويورك , 5 2 وزير العدل البريطاني قدم استقالته إثر فضيحة مالية , 6 2 استقالة إيتشيرو أوزاوا زعيم المعارضة اليابانية , 7 2 شافيز يهدد بانسحاب بلاده من منظمة الدول الأمريكية , 8 1 ويكي الأخبار

jun 2009: 1 4 منظمة الصحة العالمية تعلن تحول وباء إنفلونزة الخنازير إلى وباء عالمي , 2 3 مقتل وزير الأمن الصومالي في هجوم انتحاري , 3 2 تخصيص نصف مليار دولار لإعادة إعمار غزة , 4 2 منتخب الفراعنة يقهر أبطال العالم و يفجر مفاجأة من العيار الثقيل في كأس القرات , 5 2 الخطوط الجوية البريطانية تطلب من موظفيها العمل مجانا , 6 2 إنفلونزا الخنازير تودي بأول ضحاياها في المملكة المتحدة , 7 2 في مباراة مثيرة منتخب البرازيل يفوز على مصر بفرق هدف واحد , 8 2 قطر تتعادل مع اليابان في طوكيو , 9 2 نصر الله يعترف بهزيمة قوى المعارضة في الانتخابات النيابية في لبنان , 10 1 أسعار النفط تتراجع عن مستوى 70 دولار

jul 2009: 1 3 50 فيلما من 14 بلدا تتنافس في مهرجان الهواة , 2 3 حدوث أطول كسوف للشمس خلال القرن الواحد والعشرين , 3 3 محمد ولد عبد العزيز يفوز بالانتخابات الرئاسية الموريتانية بفارق كبير عن منافسيه , 4 3 تفجيرات تستهدف فندقين في جاكرتا وتخلف أكثر من 10 قتلى و50 جريحا , 5 3 صدور كتاب جديد في نقد عبد الوهاب المسيري , 6 2 انفجار في مايوركا في إسبانيا يودي بحياة شرطيين , 7 2 آثار معبد جوبيتير تظهر أثناء ترميم أحد البيوت , 8 2 عدة أسئلة لا تزال من دون رد بعد شهر على رحيل مايكل جاكسون , 9 2 انطلاق الانتخابات الرئاسية والبرلمانية في إقليم كردستان العراق , 10 2 مايلي سايروس \"ممنوعة\" من الخضوع لعمليات التجميل , 11 2 شيرين تتفوق على فضل أمام 14 ألف متفرج قرطاجي , 12 2 الشرطة تقتحم عيادة طبيب جاكسون , 13 2 كارول سماحة بين المغرب ومصر ولبنان , 14 2 شمال و جنوب السودان يرحبون بقرار المحكمة الدولية حول أبيي , 15 2 حركة حماس تنتج أول فيلم سينمائي في قطاع غزة , 16 2 مصر تسجل أول حالة وفاة بإنفلونزا الخنازير , 17 1 إنفجار في مايوركا في إسبانيا يودي بحياة شرطيين

ago 2009: 1 4 ويكيبيديا الإنجليزية تتجاوز 3 ملايين مقالة , 2 2 إسكتلندا تطلق سراح عبد الباسط المقرحي لأسباب إنسانية , 3 2 المنتخب المصري لكرة اليد يحتل المركز الرابع في كأس العالم لكرة اليد للشباب , 4 2 الإعصار بيل يزيد قوة فوق الأطلنطي , 5 2 النائبة عن حزب الإينويت في البرلمان الدنماركي تطالب الحكومة بالاعتذار لجرينلاند , 6 2 افتتاح مهرجان الإسكندرية السنمائي بحضور عدد قليل من نجوم السينما , 7 2 اندلاع معركة بين جزائريين وصينيين في الجزائر العاصمة , 8 2 الإفراج عن الصحفيتين الأمريكيتين في كوريا الشمالية والإدارة الأمريكية تبارك جهود كلينتون , 9 2 تمساح بطول قدم يثير الرعب بين ركاب طائرة مصر للطيران , 10 1 سرقة حساب بنك الاحتياط الفيدرالي الأمريكي

set 2009: 1 4 1.9 مليون مواطن يترددون علي موائد الرحمن في مصر , 2 3 أدلة علي قتل مروة الشربيني عمدا، واستبعاد شبهة المرض النفسي , 3 2 المؤتمر التاسيسي لتشكيل ائتلاف العمل والإنقاذ الوطني , 4 2 انتقادات شعبية لأداء الحكومة البريطانية في أفغانستان , 5 1 وزير خارجية مصر يدعوا إسرائيل للقبول بحل الدولتين

out 2009: 1 1 استقبال حافل لأبطال أزرق الناشئين

nov 2009: 1 2 معرض الكتاب في الكويت والدور النسوي في تنمية البلد , 2 1 دورهنّ في تنمية الكويت

dez 2009: 1 1 المملكة العربية السعودية

jan 2010: 1 1 مؤتمر دولي لدعم اليمن في حربه ضد تنظيم القاعدة

fev 2010: 1 2 \"صفقة شاليط\" تنتهي بالفشل , 2 1 اعدام مدنين في نيجيريا

mar 2010: 1 1 أفتتاح معرض القاهرة الدولى للكتاب الدورة 46

abr 2010: 1 1 ماستريو

mai 2010: 1 2 انفجار في مايوركا في إسبانيا يودي بحياة شرطيين , 2 1 جوزيه مورينهو يوقع عقدا لتدريب ريال مدريد

jun 2010: 1 2 محكمة مصرية عليا تؤيد سحب جنسية متزوجو إسرائيليات , 2 2 استقالة رئيس الوزراء الياباني بعد تسعة أشهر من الحكم , 3 2 مهاجمة أسطول الحرية بواسطة البحرية الإسرائيلية

jul 2010: 1 2 سكر يستورد من اسرائيل ليهرب عبر المغرب ويباع في الجزائر , 2 1 حريق في فندق في السليمانية شمال العراق

ago 2010: 1 1 الضغط يتصاعد ضد كنيسة فلوريدا التي تخطط لحرق القرآن

set 2010: 1 1 الراسينغ الى نصف نهائي كأس النخبة للمرة الأولى

out 2010: 1 1 كاسترو يقلل من خطوات أوباما تجاه كوبا و يطالبه بالرفع النهائي للحصار

nov 2010: 1 1 تواصل محاكمة المتهم بمقتل الجندي ماجدا المقبولي في اليمن

dez 2010: 1 1 اختفاء الحزام الجنوبي لكوكب المشتري

fev 2011: 1 1 خلل في التنسيق بين إصداري مايكروسوفت أوفيس 2007 و2010

mar 2011: 1 2 أحداث يوم السبت 5/3/2011 م من ثورة 17 فبراير الليبية , 2 2 أحداث يوم الجمعة 11/3/2011 م من ثورة 17 فبراير الليبية , 3 2 أحداث يوم الثلاثاء 8/3/2011 م من ثورة 17 فبراير الليبية , 4 2 أحداث يوم الثلاثاء 1/3/2011 م من ثورة 17 فبراير الليبية , 5 2 أحداث يوم الإثنين 21/2/2011 م من ثورة 17 فبراير الليبية , 6 2 أحداث يوم الإثنين 14/3/2011 م من ثورة 17 فبراير الليبية , 7 2 أخبار زلزال اليابان 18-3-2011 22:00 , 8 1 أحداث يوم الأربعاء 9/3/2011 م من ثورة 17 فبراير الليبية

abr 2011: 1 2 أحداث يوم الجمعة 25/3/2011 م من الاحتجاجات السورية 2011 , 2 1 أحداث يوم السبت 26/3/2011 م من الاحتجاجات السورية 2011

mai 2011: 1 4 أحداث يوم الخميس 28/4/2011 م من الاحتجاجات السورية 2011 , 2 3 أحداث يوم الجمعة 6/5/2011 م من الاحتجاجات السورية 2011 , 3 3 أحداث يوم الجمعة 29/4/2011 م من الاحتجاجات السورية 2011 , 4 3 أحداث يوم الأحد 8/5/2011 م من الاحتجاجات السورية 2011 , 5 3 أحداث يوم الأربعاء 23/2/2011 م من ثورة الشباب اليمنية , 6 3 شركة \"مايكروسوفت\" تشتري \"سكايب\" مقابل 8.5 مليار دولار , 7 2 ثورة الشباب اليمنية , 8 2 الاحتجاجات السورية 2011 , 9 2 ثورة 17 فبراير , 10 2 أحداث يوم السبت 9/4/2011 م من الاحتجاجات السورية 2011 , 11 2 أحداث يوم السبت 7/5/2011 م من الاحتجاجات السورية 2011 , 12 2 أحداث يوم السبت 30/4/2011 م من الاحتجاجات السورية 2011 , 13 2 أحداث يوم السبت 26/3/2011 م من الاحتجاجات السورية 2011 , 14 2 أحداث يوم السبت 23/4/2011 م من الاحتجاجات السورية 2011 , 15 2 أحداث يوم السبت 16/4/2011 م من الاحتجاجات السورية 2011 , 16 2 أحداث يوم الخميس 7/4/2011 م من الاحتجاجات السورية 2011 , 17 2 أحداث يوم الخميس 5/5/2011 م من الاحتجاجات السورية 2011 , 18 2 أحداث يوم الخميس 21/4/2011 م من الاحتجاجات السورية 2011 , 19 2 أحداث يوم الخميس 14/4/2011 م من الاحتجاجات السورية 2011 , 20 2 أحداث يوم الجمعة 8/4/2011 م من الاحتجاجات السورية 2011 , 21 2 أحداث يوم الجمعة 25/3/2011 م من الاحتجاجات السورية 2011 , 22 2 أحداث يوم الجمعة 22/4/2011 م من الاحتجاجات السورية 2011 , 23 2 أحداث يوم الجمعة 15/4/2011 م من الاحتجاجات السورية 2011 , 24 2 أحداث يوم الثلاثاء 3/5/2011 م من الاحتجاجات السورية 2011 , 25 2 أحداث يوم الثلاثاء 26/4/2011 م من الاحتجاجات السورية 2011

jun 2011: 1 2 البيضاء (ليبيا) , 2 1 الاهلي يتوج بطلا لكاس السعودية

jul 2011: 1 3 انفجار وإطلاق رصاص في النرويج , 2 2 ملثمون يثيرون الذعر في العريش , 3 2 العثور على جثة من زلزل عرش ميردوخ , 4 2 شرف يعلن تشكيل الحكومة اليوم، وبقاء وزراء الثقافة والتربية والعدل والسياحة والداخلية , 5 2 حاخام يهودي يقول أن وجود الأقصى مسألة وقت والهيكل سيبنى , 6 1 ملثمون يثيرون الذعر فى العريش

ago 2011: 1 3 مقتل قائد المعارضة الليبية , 2 2 استشهاد ضابط ومجندين في إطلاق نار على الحدود المصرية الإسرائيلية , 3 1 صحيفة لي فيغارو الفرنسية:\" إيران قد أدارت ظهرها فعلاً للرئيس السوري بشار الأسد\"

set 2011: 1 1 وفاة النجل الأكبر لجمال عبد الناصر في بعد تدهور حالته بإحدى مستشفيات القاهرة

out 2011: 1 4 مقتل معمر القذافي , 2 2 وفاة ولي العهد السعودي الأمير سلطان بن عبد العزيز , 3 1 الولايات المتحدة الأمريكية تقطع مساعداتها المالية لليونسكو إثر منحها مقعداً لفلسطين

nov 2011: 1 1 الملاكم فراس زيداني من الناصرة يستعد للمشاركة في بطولة عالمية في المانيا

dez 2011: 1 1 1.9 مليون مواطن يترددون علي موائد الرحمن فى مصر

jan 2012: 1 1 مسيرة بميدان التحرير للمطالبة بالقصاص من قتلة الثوار

fev 2012: 1 1 الامم المتحدة: عدد القتلى المدنيين في سوريا \"أعلى بكثير من 7500

mar 2012: 1 2 التلفزيون السوري: سكان باب عمرو بدأوا العودة , 2 1 بوينج وايرباص ،،، تجدد أزمة الدعم

abr 2012: 1 2 نقل مكوك الفضاء «ديسكفري» إلى المتحف الجوي , 2 2 تحطم طائرة ركاب قرب مطار إسلام آباد , 3 1 حملة الدعاية الانتخابية تنطلق رسمياً في مصر

mai 2012: 1 3 مقتل أكثر من خمسين جندي في تفجير انتحاري بصنعاء , 2 2 41 قتيلا بسوريا ومهلة للنظام , 3 2 إعلان نتائج الانتخابات الرئاسية المصرية 2012 , 4 2 عشرات القتلى في مجزرة الحولة بسوريا , 5 2 النتائج غير الرسمية لانتخابات الرئاسة المصرية , 6 2 انطلاق انتخابات الرئاسة المصرية لأول مرة عقب ثورة 25 يناير وسقوط نظام حسني مبارك , 7 2 وفاة وردة الجزائرية , 8 2 الأردن تبعد 50 لاجئاً سورياً , 9 2 فرانسوا أولاند يتسلم رئاسة فرنسا من ساركوزي , 10 2 فرانسوا أولاند يتقدم على ساركوزي في النتائج المبدئية للانتخابات الرئاسية , 11 2 سكان الحدود التونسية يخترقون الحدود الجزائرية , 12 2 حزب التحرير: من يترقب الفرج من نتائج انتخابات العدو كمن يترقب الماء من النار , 13 1 ميدان السبعين 2012/5/21

jun 2012: 1 4 إعلان محمد مرسي رئيسًا لمصر , 2 3 صدور حكم على مبارك ووزير داخليته بالسجن المؤبد , 3 2 مسيرة شموع في الكرك , 4 2 الحكومة الأردنية تعتقل ناشطين سوريين , 5 2 وفاة السلحفاة العملاقة لونسام جورج , 6 2 تونس تسلم ليبيا رئيس الوزراء السابق , 7 2 فرار ثلاثة طيارين سوريين منشقين إلى الأردن , 8 2 محمد مرسي رئيسًا لجمهورية مصر العربية بعد الثورة , 9 2 الرئيس الأسد يشكل الحكومة السورية الجديدة برئاسة رياض حجاب , 10 2 طائرة مقاتلة تركية تختفي فوق المياه السورية , 11 2 أسانج يطلب اللجوء السياسي في سفارة الإكوادور بلندن , 12 2 الجيش الليبي يدخل بلدات غربي البلاد لوقف الاشتباكات , 13 2 النتائج غير الرسمية لجولة الإعادة في الانتخابات الرئاسية المصرية تظهر تقدم مرسي , 14 1 اليونسكو تضيف كنيسة المهد إلى قائمة التراث العالمي

jul 2012: 1 4 بدء الاقتراع بأول انتخابات ليبية منذ أكثر من نصف قرن , 2 3 تفجير مبنى الأمن القومي بدمشق يودي بحياة قادة أمنيين , 3 3 الرئيس المصري يعيد البرلمان المنحل , 4 2 تفاقم الأزمة بين بغداد وأربيل , 5 2 المرشح الجمهوري ميت رومني في إسرائيل وإيران على رأس المباحثات , 6 2 سيدا في أبو ظبي والمجلس الوطني يبحث تشكيل حكومة انتقالية , 7 2 أردوغان: من حق تركيا ملاحقة حزب العمال الكردستاني على الأراضي السورية , 8 2 واشنطن تتخوف من مجزرة في حلب , 9 2 الاتحاد الأوروبي: حزب الله ليس تنظيماً إرهابياً , 10 2 تركيا تستدعي قنصلها في حلب للتشاور , 11 2 بعد البوكمال، الجيش السوري الحر يسيطر على معبر ربيعة الحدودي بين سوريا والعراق , 12 2 جوبا تتهم الخرطوم بالاعتداء على أراضيها , 13 2 تمديد عمل بعثة المراقبيين في سوريا , 14 2 تعيين العماد فهد جاسم الفريج وزيرًا للدفاع السوري , 15 2 الحكومة السورية ترفع سعر زيت التدفئة (الديزل) , 16 2 الإمارات بدأت بشحن النفط بعيداً عن مضيق هرمز , 17 2 استمرار تهديد إيران بإغلاق مضيق هرمز , 18 2 الأركان التركية تستبعد أن المقاتلة أسقطها صاروخ سوري , 19 2 الإخوان المسلمون بالأردن يقاطعون الانتخابات البرلمانية , 20 2 أكثر من 200 قتيل في مجزرة التريمسة بسوريا , 21 2 هيومن رايتس واتش تشتبه باستخدام قنابل عنقودية في سوريا , 22 2 إيقاف التمويل الحكومي لعلاج اللاجئين في لبنان , 23 1 خلية طوارئ بالعراق لمساعدة اللاجئين السوريين

ago 2012: 1 3 انشقاق رئيس مجلس الوزراء عن نظام الأسد والمجلس الوطني يرحب , 2 3 اندلاع الاشتباكات الأعنف بين الجيشين السوري والأردني , 3 2 بورما تعلن إلغاء الرقابة على الإعلام , 4 2 سقوط طائرة مقاتلة للقوات الجوية السورية في المنطقة الشرقية , 5 2 إسرائيل توافق على طلب مصر بإدخال مروحيات قتالية إلى سيناء , 6 2 مجهولون يدمرون مسجداً بأمريكا , 7 1 الانتخابات العامة في أنغولا، والحزب الحاكم الأوفر حظاً

set 2012: 1 3 مقتل السفير الأمريكي في ليبيا بعد هجوم محتجين مسلحين على القنصلية في بنغازي , 2 3 سلسلة من التفجيرات في العراق تودي بحياة اكثر من 100 شخص , 3 3 «الحزب الكيبيكي» يفوز في الانتخابات البرلمانية العامة في ولاية كيبيك الكندية , 4 2 سيارة ذاتية القيادة في شوارع كاليفورنيا , 5 2 تايوان تدخل على الخط و تعمق الأزمة في الجزر المتنازع عليها بين الصين واليابان , 6 2 صدور مذكرات سلمان رشدي , 7 2 السجن 3 سنوات لأحمد نظيف بتهمة الكسب غير المشروع , 8 2 وفاة رائد الفضاء الأمريكي نيل آرمسترونغ عن 82 سنة , 9 2 الصفحة الرئيسية , 10 1 تركيا تهدد سوريا في حال تكرار النظام السوري تعديه على الحدود معها

out 2012: 1 3 انفجار في حي الأشرفية في قلب بيروت يوقع ثمانية قتلى على الأقل , 2 2 المعارضة الليتوانية تبدأ تشكيل الحكومة بعد فوزها في الانتخابات , 3 2 مقتل 41 شخصا على الأقل في تفجير انتحاري في مسجد في أفغانستان , 4 2 هيومن رايتس ووتش: قوات الأسد تستخدم الأسلحة العنقودية المحرمة دولياً , 5 2 جائزة نوبل للسلام يأخذها الاتحاد الأوروبي , 6 2 أمير الكويت يحل مجلس الأمة المعاد ويفتح الطريق لانتخابات برلمانية للمرة الثانية هذا العام , 7 2 البرلمان التركي يجيز التدخل العسكري في سوريا , 8 2 تفجيرات تهز حلب عاصمة سوريا الاقتصادية ووقوع أربعين قتيلاً , 9 2 مقتل قائد عمليات حزب الله في سوريا مع مجموعة من عناصره , 10 2 اختفاء الحزام الجنوبي لكوكب المشتري , 11 1 حكومة علي زيدان تنال ثقة المؤتمر الوطني العام الليبي

nov 2012: 1 3 أفتتاح معرض القاهرة الدولى للكتاب الدورة 46 , 2 2 تحطم طائرة عسكرية في صنعاء , 3 2 إسرائيل تقصف غزة , 4 2 خبراء يتوقعون ارتفاع معدلات الإصابة بسرطان الرئة بين النساء في بريطانيا , 5 2 الاتحاد الأوروبي يمنح مصر مساعدات بقيمة 6 مليار دولار , 6 2 فئران مدربة لضبط الممنوعات , 7 2 15 قتيلاً و80 جريحاً في تفجيرات في العراق , 8 1 الجمهوريون يعارضون تعيين سوزان رايس وزيرة للخارجية

dez 2012: 1 2 بارك كون هيه تفوز برئاسة كوريا الجنوبية , 2 2 إعلان الحداد في الولايات المتحدة بعد مجزرة نيوتاون , 3 2 مرسي يعطل سريان التعديلات الجديدة لقانون الضرائب على المبيعات لإتاحة فرصة أمام الحوار المجتمعي حولها , 4 2 الإعلان عن نتائج انتخابات الكويت , 5 1 هيلاري كلينتون في المستشفى إثر اشتباه إصابتها بخثرة دماغية

jan 2013: 1 3 صندوق النقد العربي يمنح السودان قرضاً لإجراء إصلاحات على القطاع المالي للحكومة , 2 2 حريق في ناد ليلي في البرازيل يقضي على أكثر من 200 شخص , 3 2 محمود عباس يوقع مراسيم باعتماد تسمية «دولة فلسطين» رسمياً , 4 2 مرسي يعطل سريان التعديلات الجديدة لقانون الضرائب على المبيعات لإتاحة فرصة أمام الحوار المجتمعي حولها , 5 2 النتائج الأولية للانتخابات الرئاسية في المكسيك , 6 1 الخارجية الإسرائيلية تسحب شريطاً دعائياً يظهر اختفاء قبة الصخرة

fev 2013: 1 5 تنحي بابا الكنيسة الكاثوليكية بندكت السادس عشر , 2 3 انفجار نيزك فوق مدينة تشيليابينسك بوسط روسيا , 3 3 تعيين خالد بن بندر أميرًا للرياض , 4 3 اغتيال المعارض التونسي شكري بلعيد : ترجيحات متعددة , 5 2 مقتل 19 شخصاً في سقوط منطاد في الأقصر من ارتفاع 300 متر , 6 2 فوز فيلم آرغو بجائزة أفضل فيلم في حفل الأوسكار لعام 2013 , 7 2 فوز نيكوس آناستاسياديس برئاسة قبرص , 8 1 البرلمان السلوفيني يسحب الثقة من الحكومة ويكلف ألينكا براتوشيك بتشكيل حكومة جديدة

mar 2013: 1 3 مقتل الشيخ سعيد رمضان البوطي و49 آخرين بينهم حفيده في تفجير انتحاري في دمشق , 2 3 الكردينال الأرجنتيني خورخه ماريو بيرغوليو يصبح أول بابا من خارج أوروبا باسم فرنسيس الأول , 3 2 سامسونج تعلن عن هاتفها الذكي الجديد جالكسي إس 4 , 4 2 تشافيز يعلن عن نكسة السرطان ويسمي خليفة محتملاً , 5 1 ميشيل دجوتوديا يقطع عهداً بتسليم السلطة في 2016

abr 2013: 1 4 وفاة رئيسة وزراء المملكة المتحدة السابقة مارغريت تاتشر , 2 3 مقتل شخصين وإصابة 22 آخرين في انفجارين قرب نهاية خط ماراثون بوسطن , 3 3 مادورو يفوز برئاسة فنزويلا بفارق طفيف، وكابريليس يطالب بإعادة فرز الأصوات , 4 3 ظهور فيديو يُظهر لحظة اغتيال محمد رمضان البوطي , 5 3 إيران تدشن مجمعات لمعالجة أكسيد اليورانيوم , 6 3 إسرائيل تواجه أكبر عمليَّة قرصنة إلكترونيَّة يشنها نشطاء فلسطينيّون , 7 2 الروائي الكويتي سعود السنعوسي يفوز بالجائزة العالمية للرواية العربية عن روايته «ساق البامبو» , 8 2 الجيش السوري الإلكتروني يتبنى مسؤولية نشر خبر كاذب عن إصابة أوباما بجروح , 9 2 القضاء الفرنسي يفتح تحقيقاً في تهمة تلقي ساركوزي تمويلاً غير قانوني من القذافي , 10 1 الملكة بياتريكس تتخلى عن العرش لصالح ابنها ويليام ألكسندر

mai 2013: 1 2 مقتل 46 في انفجار سيارتين في تركيا والقبض على 9 مشتبه بهم , 2 2 الملكة بياتريكس تتخلى عن العرش لصالح ابنها ويليم ألكساندر , 3 2 وفاة الأسير الفلسطيني ميسرة أبو حمدية في مستشفى سوروكا الإسرائيلي , 4 2 أفتتاح معرض القاهرة الدولى للكتاب الدورة 46 , 5 1 مجلس الأمن يضم «جبهة النصرة لأهل الشام» إلى قائمة المنظمات الإرهابية

jun 2013: 1 3 أمير قطر يسلم السلطة لنجله , 2 2 اكتشاف ستة كواكب منها ثلاثة على الأقل صالحة للسكنى , 3 2 رفض محكمة فرنسية ادعاء التلاعب في شريط استشهاد الطفل محمد الدرة , 4 2 الجيش اللبناني يعلن سيطرته على مسجد بلال بن رباح والمربع الأمني للشيخ أحمد الأسير , 5 2 إشتباكات مسلحة بين الجيش اللبناني وأنصار الشيخ أحمد الأسير وعناصر من حزب الله , 6 2 بشار الأسد يصدر مرسومين بزيادة رواتب العاملين المدنيين والعسكريين ومعاشات المتقاعدين , 7 2 ديلما روسيف تعد بالإصلاحات ومكافحة الفساد استجابةً للاحتجاجات

jul 2013: 1 3 قطاع غزة يترنح بعد إغلاق مصر 80% من الأنفاق , 2 2 استئناف المفاوضات الفلسطينية الإسرائيلية , 3 2 العثور على تمساح نيل يافع في نهر بيروت , 4 2 توقيف المرافق الشخصي للشيخ أحمد الأسير , 5 2 العثور على مقابر جماعية لمقاتلي حزب الله في سوريا , 6 2 الأمير ويليام وزوجته الأميرة كيت يُرزقان بمولود ذكر , 7 2 علماء آثار إسرائيليّون يعتقدون باكتشافهم قصر النبي داود , 8 2 انفجار في موكب تابع لحزب الله على طريق بيروت-دمشق الدولية , 9 2 بنما توقف سفينة كورية شمالية للاشتباه بنقلها مكونات صواريخ , 10 2 تعيين محمد البرادعي رئيسًا للوزراء في مصر

ago 2013: 1 3 مجزرة كيميائية مُسنَدَة إلى القوات النظامية السورية في غوطة دمشق , 2 3 وفاة الداعية الإسلامي الكويتي عبد الرحمن السميط , 3 2 وزير الدفاع البريطاني يعلن عدم مشاركة بريطانيا في أي عمل عسكري في سوريا , 4 2 تداعيات وردود أفعال على مقتل 3 شبان فلسطينيين في مخيم قلنديا , 5 2 وكالة الاستخبارات المركزية الأمريكية تعترف بدورها في انقلاب إيران 1953 , 6 2 نائب الحاكم العسكري بمصر يأمر بوضع مبارك قيد الإقامة الجبرية , 7 2 اكتشاف نوع جديد من الثدييات في الأنديز , 8 2 انفجار يهز الضاحية الجنوبية لبيروت , 9 2 اختتام مؤتمر ويكيمانيا 2013 في هونغ كونغ , 10 1 سكايب يعمل على توفير خدمة المحادثة ثلاثية الأبعاد

set 2013: 1 2 خروج قطار بضائع عن القضبان واصصدامه بالرصيف بعد تجاوزه السرعة المقررة , 2 2 فوياجر 1 تجتاز حافة النظام الشمسي , 3 2 مصرع 3 موظفين بإحدى شركات الاتصالات وإصابة 8 في حادث تصادم بـالصحراوي , 4 1 عقيدة المصريين عن اخر الايام

out 2013: 1 1 محافظ ينبع.. اثناء زيارته للمخيمات الشاطئية ينبع لاتقدر من يضيع وقته بالكلام

nov 2013: 1 2 الاتحاد الأوروبي يقرر تخفيض العقوبات على إيران , 2 2 الفيفا يقترب لحسم قراره بخصوص مونديال قطر , 3 1 الإتحاد الأوروبي يقرر تخفيض العقوبات على إيران

dez 2013: 1 2 ظهور جزيرة في بحر العرب بفعل زلزال الباكستان , 2 1 انفجار مديرية الأمن بالمنصورة

jan 2014: 1 2 فليتشر: لا نخاف من تشيلسي , 2 1 اليجري يرفض عرضا للتدريب في انجلترا

fev 2014: 1 2 بوتفليقة يترشح لعهدة انتخابية رابعة , 2 2 الجيش الإسرائيلي يكشف نفقا يمتد من داخل القطاع الى الأراضي الإسرائيلية , 3 1 بوتفليقة يترشح لعهدة إنتخابية رابعة

mar 2014: 1 2 السعودية والإمارات والبحرين تسحب سفرائها من الدوحة

abr 2014: 1 2 بدء الانتخابات الرئاسية في أفغانستان , 2 1 إرتفاع الاسعار بالأسواق المصرية بشكل جنونى

mai 2014: 1 1 تحوّل إجابات Google للقراءة فقط

jun 2014: 1 3 أفتتاح معرض القاهرة الدولى للكتاب الدورة 46 , 2 1 أزمات المنطقة محور لقاء العاهل السعودي والسيسي

jul 2014: 1 1 17شهيد فى جريمة جديدة فى شجاعية

ago 2014: 1 2 أفتتاح معرض القاهرة الدولى للكتاب الدورة 46 , 2 1 بعثات من ناسا لدراسة آثار التغيرات المناخية في القطب الشمالي

set 2014: 1 1 الصحفي نت

out 2014: 1 2 أفتتاح معرض القاهرة الدولى للكتاب الدورة 46 , 2 1 مفاوضات مباشرة بين الحكومة النيجيرية و\"بوكو حرام\" في تشاد لإطلاق الفتيات المختطفا

nov 2014: 1 4 أفتتاح معرض القاهرة الدولى للكتاب الدورة 46 , 2 2 المغرب يفوز على نمبي ب6 ل1 , 3 1 الشوق الى ادمان المخدرات

dez 2014: 1 5 أفتتاح معرض القاهرة الدولى للكتاب الدورة 46 , 2 2 اسرار وكودات الالعاب , 3 1 Diwaniyah / Iraq

jan 2015: 1 5 أفتتاح معرض القاهرة الدولى للكتاب الدورة 46 , 2 2 طبخ أكبر طبق كشري في العالم , 3 2 ويكيبيديا مجانا بالمغرب , 4 1 افتتاح معرض القاهرة الدولى للكتاب الدورة 46

fev 2015: 1 1 Ben10

mar 2015: 1 3 القاعدة تعلن تشكيل فرع جديد لها وهو تنظيم القاعدة الالكتروني , 2 1 تغيير وزاري محدود بمصر

abr 2015: 1 1 حمَاس: زيارة بيريز للمغرب ستجّمل وجه إسرائيل أمام العالَـم

mai 2015: 1 2 فضيحة سفيان بوهو , 2 1 ملك المملكة المغربية

jun 2015: 1 2 فيلم اثار غضب المغاربة , 2 2 SEO - Sir Thomas More Advantages Than You Lav Always Suppose , 3 2 برهامي: لم نحسم أمرنا من دعم مرشح بعينه للانتخابات الرئاسية.. وسنختار الأكثر تدينًا , 4 1 0.facebook.com

No data on this page have been normalized to 30 day months (as WMF does on certain traffic reports).
Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Quinta-feira, 30 de julho 2015 22:32

Dump file arwikinews-20150702-stub-meta-history.xml.gz (edits only), size 2.8 Mb as gz -> 21 Mb
Dump processed till Jun 30, 2015, on server stat1002, ready at Sun-05/07/2015-14:16 after 14 sec.

Versão do script:2.6
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.