Estatísticas da Wikinotícias árabe

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist

Metrics have been collected from a full archive dump, which contains all revisions of every article, meta data and raw content.
See also metrics definitions


 
Monthly counts & Quarterly rankings: fevereiro 2014
 
DataWikinoticiaristasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
fev 2014+2%   0%   0%0%0%0%0%+1%0%+1%
jan 2014+2%   +1%    +1%+1%0%0%0%0%0%
dez 2013+3%   0%    0%0%0%0%0%0%0%
nov 2013+3%   0%    0%0%0%0%0%0%0%
out 2013+3%   0%   +31%+1%0%0%0%0%0%0%
set 20130%   0%   -79%+1%0%0%+2%0%0%0%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
fev 20144211 1,5 k 6,91999386,9 Mb529 k1,1 k7071934,2 k341
jan 20144111 1,5 k16,92001386,8 Mb527 k1,1 k7071924,1 k338
dez 20134011 1,5 k 6,92014166,8 Mb524 k1,1 k7071924,1 k338
nov 20133911 1,5 k 6,92014196,8 Mb523 k1,1 k7071924,1 k338
out 20133813 1,5 k 6,92015466,8 Mb522 k1,1 k7071924,1 k337
set 201337 3 1,5 k 6,92018356,7 Mb521 k1,1 k7071924,1 k336
ago 2013371511,5 k16,920191686,7 Mb519 k1,1 k6901924,1 k336
jul 2013361311,5 k1720151576,5 Mb509 k1,1 k6561924,0 k331
jun 201335 411,4 k1720091916,4 Mb498 k1,1 k6251933,9 k329
mai 201335 111,4 k1719971646,2 Mb483 k1,1 k5841933,8 k327
abr 2013351311,4 k17,120013546,1 Mb473 k1,1 k5581933,7 k325
mar 201334 111,4 k16,919692065,9 Mb459 k1,1 k4851933,6 k295
fev 2013341211,3 k16,919632615,8 Mb449 k1,1 k4291933,5 k290
jan 201333 111,3 k16,919643845,7 Mb437 k1,1 k3791943,4 k288
dez 201233 211,3 k16,819651885,5 Mb424 k1,0 k3592023,3 k281
nov 2012332211,2 k16,919692015,4 Mb413 k1,0 k3232023,2 k279
out 201231 211,2 k16,819757395,3 Mb406 k1,0 k3142033,1 k274
set 2012311411,2 k26,319743245,1 Mb398 k1,0 k2902073,0 k271
ago 201230 311,1 k16,319861565,0 Mb384 k9932732082,9 k267
jul 2012301421,1 k26,419873414,9 Mb372 k9892702082,8 k262
jun 201229 311,0 k16,519942164,6 Mb350 k9692592082,6 k255
mai 20122912198016,519992314,4 Mb337 k9622502072,5 k246
abr 20122812 93516,62014744,3 Mb324 k9502372042,4 k238
mar 201227 1 915 6,72020124,2 Mb317 k9342342022,3 k238
fev 20122712 911 6,72024244,2 Mb317 k9342342022,3 k238
jan 201226111907 6,720171104,2 Mb314 k9342342022,3 k238
dez 201125   905 6,62020594,1 Mb314 k9342342022,3 k238
nov 201125 1 905 6,52020204,1 Mb314 k9342292022,3 k237
out 20112522 899 6,52022574,1 Mb312 k9342292012,3 k237
set 201123   895 6,52025244,1 Mb311 k9332082002,3 k228
ago 201123 1 894 6,52026204,1 Mb311 k9332082002,3 k228
jul 201123 2 893 6,520243124,0 Mb310 k9332082002,3 k226
jun 20112312 893 6,11980594,0 Mb311 k9332102102,3 k219
mai 201122 3187826,119695263,9 Mb304 k8452102092,3 k215
abr 20112212 8072616791092,8 Mb230 k2,7 k2101962,2 k215
mar 20112123274526,413755332,2 Mb174 k1,4 k2101641,6 k215
fev 201119 1 672 6,3998141,5 Mb114 k198189130880203
jan 201119   672 6,3998141,5 Mb114 k198188130880203
dez 201019   672 6,2998121,5 Mb114 k198187130880203
nov 201019   671 6,299631,5 Mb113 k198188126880203
out 201019   670 6,299721,5 Mb113 k198188125880203
set 201019   670 6,299731,5 Mb113 k198187125880203
ago 201019   670 6,299791,5 Mb113 k198187125880203
jul 201019 1 669 6,2996111,5 Mb113 k198187125879203
jun 201019 2 668 6,2997411,4 Mb113 k198187125877202
mai 201019 1 662 6,2999481,4 Mb112 k193168124871201
abr 201019   654 6,21000121,4 Mb111 k192168123863200
mar 201019   653 6,21000 1,4 Mb111 k192169123862199
fev 2010191  653 6,21000121,4 Mb111 k192169123862199
jan 201018 1 653 6,21004121,4 Mb111 k191169120862199
dez 200918 1 651 6,21004151,4 Mb111 k187169119859199
nov 200918   650 6,21005131,4 Mb111 k187166119858198
out 200918   650 6,21005261,4 Mb111 k187166119858197
set 20091813 648 6,110013841,4 Mb110 k187166119856197
ago 20091713 64115,610011611,4 Mb109 k185163120852190
jul 20091614161425,610022421,3 Mb104 k183144119821174
jun 200915 4 56215,79622031,2 Mb92 k180136109763147
mai 200915 3 53615,69551481,1 Mb87 k181114106728142
abr 20091538350055,79437701,0 Mb80 k17897107692137
mar 200912410235975,810151,3 k785 kb62 k165709655648
fev 2009822115525,21200247411 kb31 k158523534619
jan 20096   98 5,711592254 kb19 k10448122978
dez 20086   98 5,71159 255 kb19 k10448122978
nov 20086 1 98 5,7115919255 kb19 k10448122978
out 20086   97 5,511641229 kb19 k10348122978
set 20086 1 9715,5116434226 kb19 k10348122978
ago 20086   76 6,613132224 kb17 k10348111278
jul 20086   76 6,61313 224 kb17 k10348111278
jun 20086   76 6,613133224 kb17 k10348111278
mai 20086   76 6,61313 224 kb17 k10340111278
abr 20086   76 6,613133224 kb17 k10340111278
mar 20086   75 6,61322 223 kb17 k10340101268
fev 20086   75 6,613221223 kb17 k10340101268
jan 20086   75 6,613221223 kb17 k10340101268
dez 20076 1 75 6,6132226223 kb17 k10340101268
nov 20076 1 71 6,6135330215 kb16 k304010927
out 20076   70 6,213272208 kb16 k303110917
set 20076   70 6,21327 207 kb16 k303110917
ago 20076   70 6,21327 207 kb16 k303110917
jul 20076 1 7016,2132759207 kb16 k303110917
jun 20076   53 7,111732207 kb11 k303110987
mai 2007611 53 7,1117327207 kb11 k303110987
abr 2007512 51 6,81190117189 kb10 k193110767
mar 2007411 41 5,6128860155 kb8,9 k7319134
fev 20073   44 3,912804152 kb9,4 k72714142
jan 20073   43 3,912693149 kb9,2 k52714142
dez 20063   42 3,912721141 kb9,0 k52713142
nov 20063   42 3,912721140 kb9,0 k52713142
out 20063   42 3,81272 140 kb9,0 k52713142
set 20063   42 3,812722140 kb9,0 k52713142
ago 20063   41 3,9126041137 kb8,7 k52712132
jul 20063   41 2,91319 116 kb9,0 k52713132
jun 20063   41 2,913194116 kb9,0 k52713132
mai 20063   41 2,813192114 kb9,0 k52713132
abr 20063   41 2,713194114 kb9,0 k52713132
mar 20063 1 41 2,6131411113 kb8,9 k52713132
fev 20063 1 40 2,4131514107 kb8,7 k52712122
jan 20063   39 2,112868101 kb8,3 k52711122
dez 2005332 381211157586 kb7,0 k11235181
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
The following table ranks this project in relation to projects in other languages with 1000+ articles
jan 201414815814913101613131016171318
out 2013156118141313101512131016171318
jul 2013167138141013101212131016171218
abr 2013159148141413101012131016171218
jan 2013151016814101110712131017161318
out 2012151112715101110412141017161418
jul 2012157841581110912141017161418
abr 20121561310161215151312141017161518
jan 20121510151015131414131214917161418
out 2011157131115141414141213817161418
jul 20111581191513141471211817161318
abr 201115913101571414121316617161318
jan 201115131712151414141717171617161718
out 20101571710151413131716171517161618
jul 201015121512151312121616171517161618
abr 20101511178151312121716171517161618
jan 20101511148141112121716161417161618
out 200915111611141412121515161417161518
jul 200915911914811111015161416151518
abr 2009156831441111516161416151618
jan 20091614159161311111616161417151618
out 200816131410161410101616161317151617
jul 200816111511161310101716161317151617
abr 2008168148161210101516161216151617
jan 2008151316111515991615151216151517
out 200714121491413991414141316141416
jul 20071491191410991014141315131416
abr 2007149117141099914141415131416
jan 200714101591411991514141515131416
out 20061491361410881314141414131415
jul 20061491381410881314141414131415
abr 2006139117139771213131313121314
jan 2006131213101311771313131213121314
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100ediçõesbytes
 WikinoticiaristasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikinoticiaristas (usuários registrados)
A = Wikinoticiaristas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikinoticiaristas que editaram pelo menos dez vezes desde que chegaram
C = Wikinoticiaristas que contribuíram cinco vezes ou mais este mês
D = Wikinoticiaristas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  5  10  100  1  3  5  10  25  100  250  5  10  100  1000  1  3  5  10  25  100  250  5  10  100 
fev 20149511     51         1663    11 
jan 20148311     11         14533   11 
dez 2013431      6211111    1631    1  
nov 20134211     5      11  1931       
out 20138431     41         14521   11 
set 20131163      41         136321  21 
ago 2013755311    7331       92211  11 
jul 2013633211 1  211    11  1042111 331
jun 2013844211    82111  111 711111 22 
mai 2013521111 11 3111   111 1142111 221
abr 20131143311 11 105411  111 20421111221
mar 2013721111 21 73211  211 10432111431
fev 20131132211    5311   111 1322111122 
jan 20137111111   3111   111 8211111221
dez 2012522111    64321  221 1253111111 
nov 2012522221    74111  111 1374111111 
out 2012622211111183331  111 14533111332
set 20121144211111 95321  22211966321133 
ago 2012943211    13531   111 2375311121 
jul 2012844332    75443  11  2375332122 
jun 2012863321    85431  111 1676421111 
mai 20121042211    721    111 1642111111 
abr 201263211    532    111 135431  11 
mar 2012311      2      11  93     11 
fev 20125221     4      11  15422   11 
jan 2012221111           111 72111  11 
jan 20148311     11         14533   11 
out 20138431     41         14521   11 
jul 2013633211 1  211    11  1042111 331
abr 20131143311 11 105411  111 20421111221
jan 20137111111   3111   111 8211111221
out 2012622211111183331  111 14533111332
jul 2012844332    75443  11  2375332122 
abr 201263211    532    111 135431  11 
jan 2012221111           111 72111  11 
out 201110222     32211      1121       
jul 201183211 11132221  1   114321  111
abr 201163222    3          17321   21 
jan 2011     11 11111  11  1032    22 
out 20102       1          12      32 
jul 2010411                 711       
abr 201011      51111  111 1351    221
jan 2010311      111111     83331     
out 200942   11 21111      83221  1  
jul 20091254431    114321      2054441 11 
abr 20091598533111 15753111    2498541 221
jan 2009        4          742       
out 20081       1          1242       
jul 2008                   6321      
abr 20081       1          51111     
jan 2008        3          3         
out 2007        2          321       
jul 200711111    11         52111     
abr 200722221 11 62222      722221 11 
jan 2007                             
out 2006                   1         
jul 2006                   31        
abr 2006        1          4         
jan 20064       2          2         

 

Distribuição de edições de artigos por wikinoticiaristas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikinoticiaristasEdições total
1199100.0%8,435100.0%
37336.7%8,25697.9%
104221.1%8,07695.7%
32168.0%7,58589.9%
10094.5%7,07983.9%
31642.0%6,23173.9%
100031.5%5,65967.1%
316210.5%3,17337.6%

 

9 wikinoticiaristas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions
agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
PICAWNUC1 03,17346,63211abr 17, 2012681432---
Meno25UC4 057244,4823mar 22, 200725341---
Beko777UC19+2263--jan 03, 201455172--
Kuwaity26UC20+2254377out 30, 2009158161--
CommonsDelinkerUC21-224118-set 16, 20091625----
ساسوكي أوتشيهاUC38...1414--fev 23, 2014411--
Shbib Al-SubaieUC73...44--fev 18, 2014922--
BachoundaUC112...22--fev 23, 20144----
Wail belkhebatUC199...11--fev 12, 201415----

 

20 wikinoticiaristas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
SeHUC21,418fev 14, 20091839jun 02, 20101366
CiphersUC31,068fev 21, 20091832fev 20, 2013372
خلدون شنتوتUC5279mar 05, 20111090mai 10, 20111024
AzitonyUC6176jun 23, 2012614nov 13, 2013106
عباد ديرانيةUC7148mai 11, 20111023set 15, 2013165
Mo7amedsalimUC8142mar 02, 20091823ago 19, 20091653
روخوUC9103nov 18, 20091562jan 07, 2012782
وليد شرف الدينUC1097abr 24, 20111040mai 18, 20111016
OsamaKUC1192abr 02, 20072523dez 24, 20072257
براق سالمUC1281mar 23, 20091802mar 30, 20091795
محمد أحمد عبد الفتاحUC1373dez 21, 20072260nov 25, 201394
باسمUC1461fev 11, 2013381out 09, 2013141
Ash2005UC1551dez 13, 20052998dez 20, 20052991
AvocatoUC1651mai 12, 20111022ago 11, 2012565
Centrino7UC1731jul 22, 20091681jul 29, 20091674
رضاUC1831out 26, 2012489nov 17, 2012467
Mohamedessam047UC2223ago 23, 2013188set 01, 2013179
AlmuhammediUC2321jun 05, 2011998jun 05, 2011998
محمد الفلسطينيUC2421abr 02, 2013331abr 25, 2013308
Yusuf AlsheikhUC2521jun 27, 2013245out 15, 2013135

 

usuários anônimos, ordenados por número de contribuições
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
196.202.91.4935
Ahmad.aea.9912

No total 305 edições foram feitas por usuários anônimos, de um total de 10640 edições ( 2e %)
  


16 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
MenoBotUC11,170set 29, 20091612jan 23, 201435--
CipherBotUC2191mar 27, 20091798mai 05, 20111029--
XeBotUC3180mar 23, 20091802jul 18, 20091685--
AvocatoBotUC4118jul 28, 2011945jul 26, 2013216--
TrBotUC576mar 08, 20091817mar 15, 20091810--
OKBotUC637abr 03, 20072522dez 26, 200722551-
VolkovBotUC734abr 17, 20091777abr 15, 2013318--
SahimrobotUC831mai 20, 20111014mai 20, 20111014--
GrondinBotUC922mai 17, 20091747out 31, 2013119--
MjbmrbotUC1013jan 08, 20111146mar 14, 20111081--
KamikazeBotUC1112dez 17, 2011803dez 18, 2011802--
AlexbotUC122jun 06, 20082092jun 20, 20082078--
DorganBotUC131jun 07, 20082091jun 07, 20082091--
K.J.BotUC141jan 26, 20101493jan 26, 20101493--
AmirobotUC151mar 13, 20111082mar 13, 20111082--
JAnDbotUC161jun 13, 2013259jun 13, 2013259--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110JpgOggPng
fev 20142,0 k76164118170637262,0 k41239    373213
jan 20142,0 k75163418170637262,0 k41237    363213
dez 20132,0 k73763318170637262,0 k41236    163213
nov 20132,0 k73063218170637262,0 k41235    193213
out 20132,0 k71963118170636262,0 k41234    313213
set 20132,0 k70963018170636262,0 k41229    323213
ago 20132,0 k68362918170636262,0 k41226    1603213
jul 20131,9 k67862818170633261,9 k41224    1473213
jun 20131,9 k67162618170625251,9 k41224    1883213
mai 20131,9 k66862518170617251,9 k41222    1503213
abr 20131,8 k66362218168601251,8 k41218    3173213
mar 20131,8 k65561818167572251,7 k41213    1833213
fev 20131,7 k64161518162566251,7 k41211    2513213
jan 20131,7 k62961318162553251,6 k41207    3803213
dez 20121,7 k62260718160508251,5 k41202    1873213
nov 20121,6 k61560118160494241,4 k41202    2003213
out 20121,6 k61459718160487241,4 k41199    3623213
set 20121,5 k60158018159413231,2 k41195    3013213
ago 20121,5 k58756718156363221,2 k41189    1563213
jul 20121,5 k57455918156349221,1 k40182    3283213
jun 20121,4 k56254817154337211,1 k40175    2112213
mai 20121,3 k54954517153324211,0 k40166    2242213
abr 20121,3 k539542171533182094640157    722213
mar 20121,3 k528538171533172092338151    72213
fev 20121,3 k523538171533172092338151    212213
jan 20121,2 k505538171533172092238150    1052213
dez 20111,2 k496536171532862091336150    22213
nov 20111,2 k491536171532862091336149    162213
out 20111,2 k476536171532862091336148    552213
set 20111,2 k465536171532862091336144    82213
ago 20111,2 k457536171532861991336142    172213
jul 20111,2 k447536171532841990036141    742213
jun 20111,2 k426535171532811987836139    352213
mai 20111,2 k415535171532791986536139    4832213
abr 20111,1 k404533171532791885736138    1042213
mar 20111,0 k388529171532791885235138    3742213
fev 2011939384512161532731884335136    102212
jan 2011931374509161532731884335135     2212
dez 2010931368508161532731884335133    42212
nov 2010930363507161532731884135130    12212
out 2010929358507161532731884135127    22212
set 2010929351507161532731884135125    22212
ago 2010927344507161532731884135123    52212
jul 2010921326505161532711884133119    92212
jun 2010917325505161532711884033118    282212
mai 2010909287505161532711883533110    382212
abr 2010899285431161512701882733107    42212
mar 2010897270429161512701882533103     2212
fev 201089726342716151270188253397    62212
jan 201089425240916151270188213394    112212
dez 200988823439116144266188203391    82212
nov 200988622939116144266188203389    72212
out 200988322732916144266188203384    112212
set 200987822729816144266188203279    552212
ago 20098642172679144266188163272    137117
jul 20098172142639144261187963255    232117
jun 20097342061929142255167722135    120117
mai 20097032011913142250167561425    139111
abr 20096601961343142247167331315    722111
mar 20094161551333142200166801110    939111
fev 2009185135571133172136009     239  1
jan 2009114121291133145101402        1
dez 200811411929113314510139         1
nov 200811411829113314410139      8  1
out 20081079829113314410139      1  1
set 20081068529113314410139      34  1
ago 20081058129113013610123      2  1
jul 20081057627111012410123         1
jun 20081057627110212410123         1
mai 2008105672714312410123         1
abr 2008105652713312410123      2  1
mar 2008104632712212310123         1
fev 2008104562712212310123         1
jan 2008104492712212310123         1
dez 2007104472712212310123      11  1
nov 200799402612212010123      28  1
out 200798402612212010120         1
set 200797392612211710120         1
ago 200797382612211710120         1
jul 200797362612211610120      59  1
jun 20079735261221031117      2  1
mai 200797352512258178      26  1
abr 200787292512141178      94  1
mar 20076224191151712      58  1
fev 2007601714131412      3  1
jan 2007591414131412         1
dez 2006571414131412         1
nov 2006561314131412         1
out 2006561314131412         1
set 2006561213131412         1
ago 2006551213131412         1
jul 2006511113131412         1
jun 200651913121411         1
mai 200649913121411         1
abr 200649913121411         1
mar 200649713121411      6  1
fev 20064671312141          1
jan 20064471212131          1
dez 2005417121213           1

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

dez 2005: 1 3 الصفحة الرئيسية , 2 2 صدام حسين هل يدلي بصوته بالسجن اليوم؟ , 3 2 تحت شعار \"الدفاع عن الإسلام\" قمة مكة تختتم أعمالها , 4 1 خدام ينشق عن النظام البعثي السوري

jan 2006: 1 2 حماس تحصل على أغلبية الأصوات في الانتخابات التشريعية الفلسطينية

fev 2006: 1 1 أزمة الرسوم الكاريكاتورية المسيئة للنبي محمد

mar 2006: 1 1 الجيش الإسرائيلي يحاصر سجن أريحا لمدة 11 ساعة

fev 2007: 1 1 منتدى الحوار الأمريكي الإسلامي

mar 2007: 1 1 ضغوط أميركية لإقالة وزير الداخلية العراقي بعد فضيحة تعذيبه لمئات المعتقلين

abr 2007: 1 2 جنبلاط يدعو كل اللبنانيين لصد العدوان و تحرير الأرض , 2 2 بيان قمة مجلس التعاون الخليجي يحث سوريا على التعاون مع الأمم المتحدة , 3 1 آخر الأخبار/30 أبريل 2007

mai 2007: 1 2 آخر الأخبار/16 مايو 2007 , 2 1 مايو 2007

jun 2007: 1 1 بريطانيا ترفض عرضا إسبانيا لإدارة مطاراتها

jul 2007: 1 1 مقتل نائبين في انفجار مقهى البرلمان العراقي

nov 2007: 1 1 مؤسسة ويكيميديا من بين رواد تكنولوجيا المنتدى الاقتصادي العالمي 2008

dez 2007: 1 2 ديسمبر 2007 , 2 1 آخر الأخبار/22 ديسمبر 2007

abr 2008: 1 1 مايو 2007

ago 2008: 1 1 كوريا الشمالية توافق على تعطيل أهم مفاعل نووي

set 2008: 1 2 مصر تفتح معبر رفح للفلسطينين

out 2008: 1 1 مقتل يورج هايدر في حادث سير

nov 2008: 1 1 حزب التحرير: أمريكا لا تنتظر أكثر من ضربة قاضية تسدد لها حتى تسقط عن عرشها العالمي

fev 2009: 1 3 انفجار في حي الحسين بالقاهرة , 2 2 تحطم طائرة تركية في الأراضي الهولندية , 3 2 إيران على بعد خطوات من تشغيل محطة بوشهر النووية , 4 2 أوباما يلقي كلمة في الكونجرس ويعد بتغيير سياسي واقتصادي قريب , 5 2 اتصالات الجزائر تطلق خدمة موجات , 6 2 محكمة الجنايات الدولة ستصدر قرارها بشأن الرئيس السوداني عمر البشير , 7 2 جوجل تنفي أن تكون قد اكتشفت مدينة \"أطلانطس\" الأسطورية , 8 2 تصاعد اللهجة من جديد بين حركتي حماس و فتح , 9 2 ألمانيا تحدد شروطا لاستقبال معتقلين من غوانتنامو , 10 1 نوري المالكي يؤكد أن بإمكان قواته الحفاظ على الأمن في العراق

mar 2009: 1 3 السجن لضابط مصري بتهمة التعذيب حتى الموت , 2 3 مدعي الجنائية الدولية قدم معلومات مغلوطة عن دارفور , 3 3 مقتل أربعة في ضربة صاروخية في شمال غرب باكستان , 4 3 حماس تقول أنها استأنفت مفاوضات تبادل الأسرى , 5 3 انتهاء مواجهات أم الفحم و الإفراج عن رائد صلاح , 6 3 انتخابات اليابان قد تأتي بسياسات مناخية أكثر صرامة , 7 3 حزب العمل يصوت بالموافقة للانضمام إلى حكومة نتنياهو , 8 3 البابا يحث الزعماء الأفارقة على مساعدة المعوزين , 9 3 تحطم طائرة شحن قرب طوكيو , 10 3 إبطال مفعول قنبلة كانت في سيارة ملغمة في مركز تجاري في حيفا , 11 3 حزب التحرير يعقد ندوة سياسية في قلقيلية , 12 3 مزارعون في الأرجنتين يقيمون إضراب احتجاجا على الضرائب , 13 3 اصطدام لسفينتين حربيتين أمريكيتين في مضيق هرمز , 14 3 الاتحاد الأفريقي يحظر عضوية مدغشقر بسبب التوتر الحكومي هناك , 15 3 استعادة اللوحات المسروقة من قصر محمد علي , 16 3 اختطاف 4 عمال إغاثة في الصومال , 17 3 البرلمان الكويتي يستقيل من جديد والأمير يقبل بذلك , 18 3 انطلاق المنتدى العالمي للمياه في إسطنبول , 19 3 الإفراج عن 3 من منتسبي منظمة أطباء بلا حدود في دارفور , 20 3 اغتيال رئيس غينيا بيساو , 21 3 الصفحة الرئيسية , 22 2 دعوة الأسد للقادة العرب برفض اعتقال البشير , 23 2 البشير يتهم إسرائيل بدعم متمردي دارفور , 24 2 القذافي :الجنائية شكل جديد من \"الإرهاب الدولي\" , 25 2 مساندة البشير وتخفيف الانقسام بشأن إيران من أولويات قمة الدوحة

abr 2009: 1 3 استطلاع: غالبية الإسرائيليين يخفون هويتهم بالخارج , 2 3 مركبة \"سويوز\" تعود إلى الأرض بعد انتهاء مهمتها , 3 3 مسلح يقتل 13 شخصا بنيويورك وينتحر , 4 3 الصفحة الرئيسية , 5 2 معاناة التجمعات البدوية في فلسطين , 6 2 انطلاق تظاهرة بيروت عاصمة للكتاب العالمي , 7 2 إطلاق قناة سورية معارضة جديدة , 8 2 السعودية تعترف باستقلال كوسوفو , 9 2 نجاد يثير موجة من الاستياء في صفوف حضور مؤتمر العنصرية في جنيف إثر حديثه عن العنصرية التي تمارسها إسرائيل في فلسطين , 10 2 إطلاق الهند قمر صناعي للتجسس اشترته من إسرائيل , 11 2 سقوط طائرة صغيرة في فلوريدا , 12 2 الأمير نايف يقول أن تنشئة الجيل الصاعد على منهج أهل السنة حماية لهم من الأهواء , 13 2 كلينتون تدعو لرفع الحظر عن جزر كوبا , 14 2 مسلمو القدس يمنعون اليهود من اقتحام المسجد الأقصى , 15 2 العثور على تمثال قناع وجه يعتقد أنه لكليوباترا , 16 2 إسرائيل و الولايات المتحدة الأمريكية تقومان بإجراء مناورات جوية في ما يبدو أنه تحذير لإيران , 17 2 إيفو مورالس ينهي إضرابه عن الطعام بعد استجابة الكونجرس البوليفي لمطالبه حول قانون الانتخاب , 18 2 حركات و دعاة إسلاميون يحذرون من اقتحام المستوطنين للمسجد الأقصى غدا , 19 2 أبو الغيط يوجه اتهامات لإيران بالتآمر لاغتيال مبارك , 20 2 بدأ مؤتمر العلاقات السورية اللبنانية في دمشق , 21 2 \"سامي شهاب\" يعتذر من نصرالله على فشله , 22 2 أوراسكوم تعرض على أورانج آخر فرصة للاتفاق بشأن موبينيل , 23 2 المعارضة الجورجية تدعو إلى نقل التظاهرات إلى مبنى الرئاسة , 24 2 هجوم على سائح إسرائيلي في سيناء , 25 2 إيفو مورالس يدخل في إضراب عن الطعام

mai 2009: 1 3 بايدن في بيروت يربط استمرار الدعم بنتائج الانتخابات , 2 3 مصرع 99 شخصا بتحطم طائرة عسكرية أندونيسية , 3 2 سوريا تنفي إلغاء صفقة طائرات حربية روسية , 4 2 توقيف أربعة أشخاص حاولوا تنفيذ هجمات في نيويورك , 5 2 وزير العدل البريطاني قدم استقالته إثر فضيحة مالية , 6 2 استقالة إيتشيرو أوزاوا زعيم المعارضة اليابانية , 7 2 شافيز يهدد بانسحاب بلاده من منظمة الدول الأمريكية , 8 1 ويكي الأخبار

jun 2009: 1 4 منظمة الصحة العالمية تعلن تحول وباء إنفلونزة الخنازير إلى وباء عالمي , 2 3 مقتل وزير الأمن الصومالي في هجوم انتحاري , 3 2 تخصيص نصف مليار دولار لإعادة إعمار غزة , 4 2 منتخب الفراعنة يقهر أبطال العالم و يفجر مفاجأة من العيار الثقيل في كأس القرات , 5 2 الخطوط الجوية البريطانية تطلب من موظفيها العمل مجانا , 6 2 إنفلونزا الخنازير تودي بأول ضحاياها في المملكة المتحدة , 7 2 في مباراة مثيرة منتخب البرازيل يفوز على مصر بفرق هدف واحد , 8 2 قطر تتعادل مع اليابان في طوكيو , 9 2 نصر الله يعترف بهزيمة قوى المعارضة في الانتخابات النيابية في لبنان , 10 1 أسعار النفط تتراجع عن مستوى 70 دولار

jul 2009: 1 3 50 فيلما من 14 بلدا تتنافس في مهرجان الهواة , 2 3 حدوث أطول كسوف للشمس خلال القرن الواحد والعشرين , 3 3 محمد ولد عبد العزيز يفوز بالانتخابات الرئاسية الموريتانية بفارق كبير عن منافسيه , 4 3 تفجيرات تستهدف فندقين في جاكرتا وتخلف أكثر من 10 قتلى و50 جريحا , 5 3 صدور كتاب جديد في نقد عبد الوهاب المسيري , 6 2 انفجار في مايوركا في إسبانيا يودي بحياة شرطيين , 7 2 آثار معبد جوبيتير تظهر أثناء ترميم أحد البيوت , 8 2 عدة أسئلة لا تزال من دون رد بعد شهر على رحيل مايكل جاكسون , 9 2 انطلاق الانتخابات الرئاسية والبرلمانية في إقليم كردستان العراق , 10 2 مايلي سايروس \"ممنوعة\" من الخضوع لعمليات التجميل , 11 2 شيرين تتفوق على فضل أمام 14 ألف متفرج قرطاجي , 12 2 الشرطة تقتحم عيادة طبيب جاكسون , 13 2 كارول سماحة بين المغرب ومصر ولبنان , 14 2 شمال و جنوب السودان يرحبون بقرار المحكمة الدولية حول أبيي , 15 2 حركة حماس تنتج أول فيلم سينمائي في قطاع غزة , 16 2 مصر تسجل أول حالة وفاة بإنفلونزا الخنازير , 17 1 إنفجار في مايوركا في إسبانيا يودي بحياة شرطيين

ago 2009: 1 4 ويكيبيديا الإنجليزية تتجاوز 3 ملايين مقالة , 2 2 إسكتلندا تطلق سراح عبد الباسط المقرحي لأسباب إنسانية , 3 2 المنتخب المصري لكرة اليد يحتل المركز الرابع في كأس العالم لكرة اليد للشباب , 4 2 الإعصار بيل يزيد قوة فوق الأطلنطي , 5 2 النائبة عن حزب الإينويت في البرلمان الدنماركي تطالب الحكومة بالاعتذار لجرينلاند , 6 2 افتتاح مهرجان الإسكندرية السنمائي بحضور عدد قليل من نجوم السينما , 7 2 اندلاع معركة بين جزائريين وصينيين في الجزائر العاصمة , 8 2 الإفراج عن الصحفيتين الأمريكيتين في كوريا الشمالية والإدارة الأمريكية تبارك جهود كلينتون , 9 2 تمساح بطول قدم يثير الرعب بين ركاب طائرة مصر للطيران , 10 1 سرقة حساب بنك الاحتياط الفيدرالي الأمريكي

set 2009: 1 4 1.9 مليون مواطن يترددون علي موائد الرحمن في مصر , 2 3 أدلة علي قتل مروة الشربيني عمدا، واستبعاد شبهة المرض النفسي , 3 2 المؤتمر التاسيسي لتشكيل ائتلاف العمل والإنقاذ الوطني , 4 2 انتقادات شعبية لأداء الحكومة البريطانية في أفغانستان , 5 1 وزير خارجية مصر يدعوا إسرائيل للقبول بحل الدولتين

out 2009: 1 1 استقبال حافل لأبطال أزرق الناشئين

nov 2009: 1 2 معرض الكتاب في الكويت والدور النسوي في تنمية البلد , 2 1 دورهنّ في تنمية الكويت

dez 2009: 1 1 المملكة العربية السعودية

jan 2010: 1 1 مؤتمر دولي لدعم اليمن في حربه ضد تنظيم القاعدة

fev 2010: 1 2 \"صفقة شاليط\" تنتهي بالفشل , 2 1 اعدام مدنين في نيجيريا

abr 2010: 1 1 ماستريو

mai 2010: 1 2 انفجار في مايوركا في إسبانيا يودي بحياة شرطيين , 2 1 جوزيه مورينهو يوقع عقدا لتدريب ريال مدريد

jun 2010: 1 2 محكمة مصرية عليا تؤيد سحب جنسية متزوجو إسرائيليات , 2 2 استقالة رئيس الوزراء الياباني بعد تسعة أشهر من الحكم , 3 2 مهاجمة أسطول الحرية بواسطة البحرية الإسرائيلية

jul 2010: 1 2 سكر يستورد من اسرائيل ليهرب عبر المغرب ويباع في الجزائر , 2 1 حريق في فندق في السليمانية شمال العراق

ago 2010: 1 1 الضغط يتصاعد ضد كنيسة فلوريدا التي تخطط لحرق القرآن

set 2010: 1 1 الراسينغ الى نصف نهائي كأس النخبة للمرة الأولى

out 2010: 1 1 كاسترو يقلل من خطوات أوباما تجاه كوبا و يطالبه بالرفع النهائي للحصار

nov 2010: 1 1 تواصل محاكمة المتهم بمقتل الجندي ماجدا المقبولي في اليمن

dez 2010: 1 1 اختفاء الحزام الجنوبي لكوكب المشتري

fev 2011: 1 1 خلل في التنسيق بين إصداري مايكروسوفت أوفيس 2007 و2010

mar 2011: 1 2 أحداث يوم السبت 5/3/2011 م من ثورة 17 فبراير الليبية , 2 2 أحداث يوم الجمعة 11/3/2011 م من ثورة 17 فبراير الليبية , 3 2 أحداث يوم الثلاثاء 8/3/2011 م من ثورة 17 فبراير الليبية , 4 2 أحداث يوم الثلاثاء 1/3/2011 م من ثورة 17 فبراير الليبية , 5 2 أحداث يوم الإثنين 21/2/2011 م من ثورة 17 فبراير الليبية , 6 2 أحداث يوم الإثنين 14/3/2011 م من ثورة 17 فبراير الليبية , 7 2 أخبار زلزال اليابان 18-3-2011 22:00 , 8 1 أحداث يوم الأربعاء 9/3/2011 م من ثورة 17 فبراير الليبية

abr 2011: 1 2 أحداث يوم الجمعة 25/3/2011 م من الاحتجاجات السورية 2011 , 2 1 أحداث يوم السبت 26/3/2011 م من الاحتجاجات السورية 2011

mai 2011: 1 4 أحداث يوم الخميس 28/4/2011 م من الاحتجاجات السورية 2011 , 2 3 أحداث يوم الجمعة 6/5/2011 م من الاحتجاجات السورية 2011 , 3 3 أحداث يوم الجمعة 29/4/2011 م من الاحتجاجات السورية 2011 , 4 3 أحداث يوم الأحد 8/5/2011 م من الاحتجاجات السورية 2011 , 5 3 أحداث يوم الأربعاء 23/2/2011 م من ثورة الشباب اليمنية , 6 3 شركة \"مايكروسوفت\" تشتري \"سكايب\" مقابل 8.5 مليار دولار , 7 2 ثورة الشباب اليمنية , 8 2 الاحتجاجات السورية 2011 , 9 2 ثورة 17 فبراير , 10 2 أحداث يوم السبت 9/4/2011 م من الاحتجاجات السورية 2011 , 11 2 أحداث يوم السبت 7/5/2011 م من الاحتجاجات السورية 2011 , 12 2 أحداث يوم السبت 30/4/2011 م من الاحتجاجات السورية 2011 , 13 2 أحداث يوم السبت 26/3/2011 م من الاحتجاجات السورية 2011 , 14 2 أحداث يوم السبت 23/4/2011 م من الاحتجاجات السورية 2011 , 15 2 أحداث يوم السبت 16/4/2011 م من الاحتجاجات السورية 2011 , 16 2 أحداث يوم الخميس 7/4/2011 م من الاحتجاجات السورية 2011 , 17 2 أحداث يوم الخميس 5/5/2011 م من الاحتجاجات السورية 2011 , 18 2 أحداث يوم الخميس 21/4/2011 م من الاحتجاجات السورية 2011 , 19 2 أحداث يوم الخميس 14/4/2011 م من الاحتجاجات السورية 2011 , 20 2 أحداث يوم الجمعة 8/4/2011 م من الاحتجاجات السورية 2011 , 21 2 أحداث يوم الجمعة 25/3/2011 م من الاحتجاجات السورية 2011 , 22 2 أحداث يوم الجمعة 22/4/2011 م من الاحتجاجات السورية 2011 , 23 2 أحداث يوم الجمعة 15/4/2011 م من الاحتجاجات السورية 2011 , 24 2 أحداث يوم الثلاثاء 3/5/2011 م من الاحتجاجات السورية 2011 , 25 2 أحداث يوم الثلاثاء 26/4/2011 م من الاحتجاجات السورية 2011

jun 2011: 1 2 البيضاء (ليبيا) , 2 1 الاهلي يتوج بطلا لكاس السعودية

jul 2011: 1 3 انفجار وإطلاق رصاص في النرويج , 2 2 ملثمون يثيرون الذعر في العريش , 3 2 العثور على جثة من زلزل عرش ميردوخ , 4 2 شرف يعلن تشكيل الحكومة اليوم، وبقاء وزراء الثقافة والتربية والعدل والسياحة والداخلية , 5 2 حاخام يهودي يقول أن وجود الأقصى مسألة وقت والهيكل سيبنى , 6 1 ملثمون يثيرون الذعر فى العريش

ago 2011: 1 3 مقتل قائد المعارضة الليبية , 2 2 استشهاد ضابط ومجندين في إطلاق نار على الحدود المصرية الإسرائيلية , 3 1 صحيفة لي فيغارو الفرنسية:\" إيران قد أدارت ظهرها فعلاً للرئيس السوري بشار الأسد\"

set 2011: 1 1 وفاة النجل الأكبر لجمال عبد الناصر في بعد تدهور حالته بإحدى مستشفيات القاهرة

out 2011: 1 4 مقتل معمر القذافي , 2 2 وفاة ولي العهد السعودي الأمير سلطان بن عبد العزيز , 3 1 الولايات المتحدة الأمريكية تقطع مساعداتها المالية لليونسكو إثر منحها مقعداً لفلسطين

nov 2011: 1 1 الملاكم فراس زيداني من الناصرة يستعد للمشاركة في بطولة عالمية في المانيا

dez 2011: 1 1 1.9 مليون مواطن يترددون علي موائد الرحمن فى مصر

jan 2012: 1 1 مسيرة بميدان التحرير للمطالبة بالقصاص من قتلة الثوار

fev 2012: 1 1 الامم المتحدة: عدد القتلى المدنيين في سوريا \"أعلى بكثير من 7500

mar 2012: 1 2 التلفزيون السوري: سكان باب عمرو بدأوا العودة , 2 1 بوينج وايرباص ،،، تجدد أزمة الدعم

abr 2012: 1 2 نقل مكوك الفضاء «ديسكفري» إلى المتحف الجوي , 2 2 تحطم طائرة ركاب قرب مطار إسلام آباد , 3 1 حملة الدعاية الانتخابية تنطلق رسمياً في مصر

mai 2012: 1 3 مقتل أكثر من خمسين جندي في تفجير انتحاري بصنعاء , 2 2 41 قتيلا بسوريا ومهلة للنظام , 3 2 إعلان نتائج الانتخابات الرئاسية المصرية 2012 , 4 2 عشرات القتلى في مجزرة الحولة بسوريا , 5 2 النتائج غير الرسمية لانتخابات الرئاسة المصرية , 6 2 انطلاق انتخابات الرئاسة المصرية لأول مرة عقب ثورة 25 يناير وسقوط نظام حسني مبارك , 7 2 وفاة وردة الجزائرية , 8 2 الأردن تبعد 50 لاجئاً سورياً , 9 2 فرانسوا أولاند يتسلم رئاسة فرنسا من ساركوزي , 10 2 فرانسوا أولاند يتقدم على ساركوزي في النتائج المبدئية للانتخابات الرئاسية , 11 2 سكان الحدود التونسية يخترقون الحدود الجزائرية , 12 2 حزب التحرير: من يترقب الفرج من نتائج انتخابات العدو كمن يترقب الماء من النار , 13 1 ميدان السبعين 2012/5/21

jun 2012: 1 4 إعلان محمد مرسي رئيسًا لمصر , 2 3 صدور حكم على مبارك ووزير داخليته بالسجن المؤبد , 3 2 مسيرة شموع في الكرك , 4 2 الحكومة الأردنية تعتقل ناشطين سوريين , 5 2 وفاة السلحفاة العملاقة لونسام جورج , 6 2 تونس تسلم ليبيا رئيس الوزراء السابق , 7 2 فرار ثلاثة طيارين سوريين منشقين إلى الأردن , 8 2 محمد مرسي رئيسًا لجمهورية مصر العربية بعد الثورة , 9 2 الرئيس الأسد يشكل الحكومة السورية الجديدة برئاسة رياض حجاب , 10 2 طائرة مقاتلة تركية تختفي فوق المياه السورية , 11 2 أسانج يطلب اللجوء السياسي في سفارة الإكوادور بلندن , 12 2 الجيش الليبي يدخل بلدات غربي البلاد لوقف الاشتباكات , 13 2 النتائج غير الرسمية لجولة الإعادة في الانتخابات الرئاسية المصرية تظهر تقدم مرسي , 14 1 اليونسكو تضيف كنيسة المهد إلى قائمة التراث العالمي

jul 2012: 1 4 بدء الاقتراع بأول انتخابات ليبية منذ أكثر من نصف قرن , 2 3 تفجير مبنى الأمن القومي بدمشق يودي بحياة قادة أمنيين , 3 3 الرئيس المصري يعيد البرلمان المنحل , 4 2 تفاقم الأزمة بين بغداد وأربيل , 5 2 المرشح الجمهوري ميت رومني في إسرائيل وإيران على رأس المباحثات , 6 2 سيدا في أبو ظبي والمجلس الوطني يبحث تشكيل حكومة انتقالية , 7 2 أردوغان: من حق تركيا ملاحقة حزب العمال الكردستاني على الأراضي السورية , 8 2 واشنطن تتخوف من مجزرة في حلب , 9 2 الاتحاد الأوروبي: حزب الله ليس تنظيماً إرهابياً , 10 2 تركيا تستدعي قنصلها في حلب للتشاور , 11 2 بعد البوكمال، الجيش السوري الحر يسيطر على معبر ربيعة الحدودي بين سوريا والعراق , 12 2 جوبا تتهم الخرطوم بالاعتداء على أراضيها , 13 2 تمديد عمل بعثة المراقبيين في سوريا , 14 2 تعيين العماد فهد جاسم الفريج وزيرًا للدفاع السوري , 15 2 الحكومة السورية ترفع سعر زيت التدفئة (الديزل) , 16 2 الإمارات بدأت بشحن النفط بعيداً عن مضيق هرمز , 17 2 استمرار تهديد إيران بإغلاق مضيق هرمز , 18 2 الأركان التركية تستبعد أن المقاتلة أسقطها صاروخ سوري , 19 2 الإخوان المسلمون بالأردن يقاطعون الانتخابات البرلمانية , 20 2 أكثر من 200 قتيل في مجزرة التريمسة بسوريا , 21 2 هيومن رايتس واتش تشتبه باستخدام قنابل عنقودية في سوريا , 22 1 خلية طوارئ بالعراق لمساعدة اللاجئين السوريين

ago 2012: 1 3 انشقاق رئيس مجلس الوزراء عن نظام الأسد والمجلس الوطني يرحب , 2 3 اندلاع الاشتباكات الأعنف بين الجيشين السوري والأردني , 3 2 بورما تعلن إلغاء الرقابة على الإعلام , 4 2 سقوط طائرة مقاتلة للقوات الجوية السورية في المنطقة الشرقية , 5 2 إسرائيل توافق على طلب مصر بإدخال مروحيات قتالية إلى سيناء , 6 2 مجهولون يدمرون مسجداً بأمريكا , 7 1 الانتخابات العامة في أنغولا، والحزب الحاكم الأوفر حظاً

set 2012: 1 3 مقتل السفير الأمريكي في ليبيا بعد هجوم محتجين مسلحين على القنصلية في بنغازي , 2 3 سلسلة من التفجيرات في العراق تودي بحياة اكثر من 100 شخص , 3 3 «الحزب الكيبيكي» يفوز في الانتخابات البرلمانية العامة في ولاية كيبيك الكندية , 4 2 سيارة ذاتية القيادة في شوارع كاليفورنيا , 5 2 تايوان تدخل على الخط و تعمق الأزمة في الجزر المتنازع عليها بين الصين واليابان , 6 2 صدور مذكرات سلمان رشدي , 7 2 السجن 3 سنوات لأحمد نظيف بتهمة الكسب غير المشروع , 8 2 وفاة رائد الفضاء الأمريكي نيل آرمسترونغ عن 82 سنة , 9 2 الصفحة الرئيسية , 10 1 تركيا تهدد سوريا في حال تكرار النظام السوري تعديه على الحدود معها

out 2012: 1 3 انفجار في حي الأشرفية في قلب بيروت يوقع ثمانية قتلى على الأقل , 2 2 المعارضة الليتوانية تبدأ تشكيل الحكومة بعد فوزها في الانتخابات , 3 2 مقتل 41 شخصا على الأقل في تفجير انتحاري في مسجد في أفغانستان , 4 2 هيومن رايتس ووتش: قوات الأسد تستخدم الأسلحة العنقودية المحرمة دولياً , 5 2 جائزة نوبل للسلام يأخذها الاتحاد الأوروبي , 6 2 أمير الكويت يحل مجلس الأمة المعاد ويفتح الطريق لانتخابات برلمانية للمرة الثانية هذا العام , 7 2 البرلمان التركي يجيز التدخل العسكري في سوريا , 8 2 تفجيرات تهز حلب عاصمة سوريا الاقتصادية ووقوع أربعين قتيلاً , 9 2 مقتل قائد عمليات حزب الله في سوريا مع مجموعة من عناصره , 10 2 اختفاء الحزام الجنوبي لكوكب المشتري , 11 1 حكومة علي زيدان تنال ثقة المؤتمر الوطني العام الليبي

nov 2012: 1 2 تحطم طائرة عسكرية في صنعاء , 2 2 إسرائيل تقصف غزة , 3 2 خبراء يتوقعون ارتفاع معدلات الإصابة بسرطان الرئة بين النساء في بريطانيا , 4 2 الاتحاد الأوروبي يمنح مصر مساعدات بقيمة 6 مليار دولار , 5 2 فئران مدربة لضبط الممنوعات , 6 2 15 قتيلاً و80 جريحاً في تفجيرات في العراق , 7 1 الجمهوريون يعارضون تعيين سوزان رايس وزيرة للخارجية

dez 2012: 1 2 بارك كون هيه تفوز برئاسة كوريا الجنوبية , 2 2 إعلان الحداد في الولايات المتحدة بعد مجزرة نيوتاون , 3 2 مرسي يعطل سريان التعديلات الجديدة لقانون الضرائب على المبيعات لإتاحة فرصة أمام الحوار المجتمعي حولها , 4 2 الإعلان عن نتائج انتخابات الكويت , 5 1 هيلاري كلينتون في المستشفى إثر اشتباه إصابتها بخثرة دماغية

jan 2013: 1 3 صندوق النقد العربي يمنح السودان قرضاً لإجراء إصلاحات على القطاع المالي للحكومة , 2 2 حريق في ناد ليلي في البرازيل يقضي على أكثر من 200 شخص , 3 2 محمود عباس يوقع مراسيم باعتماد تسمية «دولة فلسطين» رسمياً , 4 2 مرسي يعطل سريان التعديلات الجديدة لقانون الضرائب على المبيعات لإتاحة فرصة أمام الحوار المجتمعي حولها , 5 2 النتائج الأولية للانتخابات الرئاسية في المكسيك , 6 1 الخارجية الإسرائيلية تسحب شريطاً دعائياً يظهر اختفاء قبة الصخرة

fev 2013: 1 5 تنحي بابا الكنيسة الكاثوليكية بندكت السادس عشر , 2 3 انفجار نيزك فوق مدينة تشيليابينسك بوسط روسيا , 3 3 تعيين خالد بن بندر أميرًا للرياض , 4 3 اغتيال المعارض التونسي شكري بلعيد : ترجيحات متعددة , 5 2 مقتل 19 شخصاً في سقوط منطاد في الأقصر من ارتفاع 300 متر , 6 2 فوز فيلم آرغو بجائزة أفضل فيلم في حفل الأوسكار لعام 2013 , 7 1 البرلمان السلوفيني يسحب الثقة من الحكومة ويكلف ألينكا براتوشيك بتشكيل حكومة جديدة

mar 2013: 1 3 مقتل الشيخ سعيد رمضان البوطي و49 آخرين بينهم حفيده في تفجير انتحاري في دمشق , 2 3 الكردينال الأرجنتيني خورخه ماريو بيرغوليو يصبح أول بابا من خارج أوروبا باسم فرنسيس الأول , 3 2 سامسونج تعلن عن هاتفها الذكي الجديد جالكسي إس 4 , 4 2 تشافيز يعلن عن نكسة السرطان ويسمي خليفة محتملاً , 5 1 ميشيل دجوتوديا يقطع عهداً بتسليم السلطة في 2016

abr 2013: 1 4 وفاة رئيسة وزراء المملكة المتحدة السابقة مارغريت تاتشر , 2 3 مقتل شخصين وإصابة 22 آخرين في انفجارين قرب نهاية خط ماراثون بوسطن , 3 3 مادورو يفوز برئاسة فنزويلا بفارق طفيف، وكابريليس يطالب بإعادة فرز الأصوات , 4 3 ظهور فيديو يُظهر لحظة اغتيال محمد رمضان البوطي , 5 3 إيران تدشن مجمعات لمعالجة أكسيد اليورانيوم , 6 3 إسرائيل تواجه أكبر عمليَّة قرصنة إلكترونيَّة يشنها نشطاء فلسطينيّون , 7 2 الروائي الكويتي سعود السنعوسي يفوز بالجائزة العالمية للرواية العربية عن روايته «ساق البامبو» , 8 2 الجيش السوري الإلكتروني يتبنى مسؤولية نشر خبر كاذب عن إصابة أوباما بجروح , 9 2 القضاء الفرنسي يفتح تحقيقاً في تهمة تلقي ساركوزي تمويلاً غير قانوني من القذافي , 10 1 الملكة بياتريكس تتخلى عن العرش لصالح ابنها ويليام ألكسندر

mai 2013: 1 2 مقتل 46 في انفجار سيارتين في تركيا والقبض على 9 مشتبه بهم , 2 2 الملكة بياتريكس تتخلى عن العرش لصالح ابنها ويليم ألكساندر , 3 2 وفاة الأسير الفلسطيني ميسرة أبو حمدية في مستشفى سوروكا الإسرائيلي , 4 1 مجلس الأمن يضم «جبهة النصرة لأهل الشام» إلى قائمة المنظمات الإرهابية

jun 2013: 1 3 أمير قطر يسلم السلطة لنجله , 2 2 اكتشاف ستة كواكب منها ثلاثة على الأقل صالحة للسكنى , 3 2 رفض محكمة فرنسية ادعاء التلاعب في شريط استشهاد الطفل محمد الدرة , 4 2 الجيش اللبناني يعلن سيطرته على مسجد بلال بن رباح والمربع الأمني للشيخ أحمد الأسير , 5 2 إشتباكات مسلحة بين الجيش اللبناني وأنصار الشيخ أحمد الأسير وعناصر من حزب الله , 6 2 بشار الأسد يصدر مرسومين بزيادة رواتب العاملين المدنيين والعسكريين ومعاشات المتقاعدين , 7 2 ديلما روسيف تعد بالإصلاحات ومكافحة الفساد استجابةً للاحتجاجات

jul 2013: 1 3 قطاع غزة يترنح بعد إغلاق مصر 80% من الأنفاق , 2 2 استئناف المفاوضات الفلسطينية الإسرائيلية , 3 2 العثور على تمساح نيل يافع في نهر بيروت , 4 2 توقيف المرافق الشخصي للشيخ أحمد الأسير , 5 2 العثور على مقابر جماعية لمقاتلي حزب الله في سوريا , 6 2 الأمير ويليام وزوجته الأميرة كيت يُرزقان بمولود ذكر , 7 2 علماء آثار إسرائيليّون يعتقدون باكتشافهم قصر النبي داود , 8 2 انفجار في موكب تابع لحزب الله على طريق بيروت-دمشق الدولية , 9 2 بنما توقف سفينة كورية شمالية للاشتباه بنقلها مكونات صواريخ , 10 2 تعيين محمد البرادعي رئيسًا للوزراء في مصر

ago 2013: 1 3 مجزرة كيميائية مُسنَدَة إلى القوات النظامية السورية في غوطة دمشق , 2 3 وفاة الداعية الإسلامي الكويتي عبد الرحمن السميط , 3 2 وزير الدفاع البريطاني يعلن عدم مشاركة بريطانيا في أي عمل عسكري في سوريا , 4 2 تداعيات وردود أفعال على مقتل 3 شبان فلسطينيين في مخيم قلنديا , 5 2 وكالة الاستخبارات المركزية الأمريكية تعترف بدورها في انقلاب إيران 1953 , 6 2 نائب الحاكم العسكري بمصر يأمر بوضع مبارك قيد الإقامة الجبرية , 7 2 اكتشاف نوع جديد من الثدييات في الأنديز , 8 2 انفجار يهز الضاحية الجنوبية لبيروت , 9 2 اختتام مؤتمر ويكيمانيا 2013 في هونغ كونغ , 10 1 سكايب يعمل على توفير خدمة المحادثة ثلاثية الأبعاد

set 2013: 1 2 خروج قطار بضائع عن القضبان واصصدامه بالرصيف بعد تجاوزه السرعة المقررة , 2 2 فوياجر 1 تجتاز حافة النظام الشمسي , 3 2 مصرع 3 موظفين بإحدى شركات الاتصالات وإصابة 8 في حادث تصادم بـالصحراوي , 4 1 عقيدة المصريين عن اخر الايام

out 2013: 1 1 محافظ ينبع.. اثناء زيارته للمخيمات الشاطئية ينبع لاتقدر من يضيع وقته بالكلام

nov 2013: 1 2 الاتحاد الأوروبي يقرر تخفيض العقوبات على إيران , 2 2 الفيفا يقترب لحسم قراره بخصوص مونديال قطر , 3 1 الإتحاد الأوروبي يقرر تخفيض العقوبات على إيران

dez 2013: 1 2 ظهور جزيرة في بحر العرب بفعل زلزال الباكستان , 2 1 انفجار مديرية الأمن بالمنصورة

jan 2014: 1 2 فليتشر: لا نخاف من تشيلسي , 2 1 اليجري يرفض عرضا للتدريب في انجلترا

fev 2014: 1 2 بوتفليقة يترشح لعهدة انتخابية رابعة , 2 2 الجيش الإسرائيلي يكشف نفقا يمتد من داخل القطاع الى الأراضي الإسرائيلية , 3 1 بوتفليقة يترشح لعهدة إنتخابية رابعة

Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Domingo, 30 de março 2014 20:17

Dump file arwikinews-20140310-pages-meta-history.xml.7z (full dump), size 4.8 Mb as 7z -> 160 Mb
Dump processed till Feb 28, 2014, on server stat1002, ready at Sat-15/03/2014-10:44 after 38 sec.

Versão do script:2.6
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.