Estatísticas da Wikinotícias catalão

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist

Metrics have been collected from a full archive dump, which contains all revisions of every article, meta data and raw content.
See also metrics definitions


 
Monthly counts & Quarterly rankings: outubro 2014
 
DataWikinoticiaristasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
out 2014+2%   +4%   +187%+3%+3%+24%+1%+5%+4%+14%
set 20140%   +2%   -55%+2%+2%0%-2%0%+2%0%
ago 20140%   +2%   +333%-0%+2%0%-67%+4%+1%0%
jul 2014+2%   +2%   +70%+1%+1%+1%+1%+1%+1%+2%
jun 20140%   +1%   +1%+1%+1%0%+1%+1%+1%0%
mai 20140%   +2%   -64%+2%+2%+1%+3%0%+2%0%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
out 2014611222,4 k38,123261,4 k8,3 Mb946 k5351,8 k1,1 k5,1 k183
set 201460 112,3 k27,823435018,0 Mb916 k4321,8 k1,1 k4,9 k161
ago 201460 112,3 k17,723371,1 k7,8 Mb896 k4321,8 k1,1 k4,8 k161
jul 2014601512,3 k17,323352567,9 Mb882 k4325,5 k1,0 k4,8 k161
jun 201459 112,2 k17,323461517,8 Mb870 k4265,4 k1,0 k4,7 k158
mai 201459 212,2 k27,423591507,7 Mb863 k4265,4 k1,0 k4,7 k158
abr 201459 312,1 k27,523574207,5 Mb844 k4205,2 k1,0 k4,6 k158
mar 2014592512,1 k37,423473147,3 Mb821 k4205,0 k9904,5 k157
fev 2014571212,0 k27,623471707,0 Mb789 k4204,9 k9554,4 k156
jan 201456 112,0 k17,723401746,8 Mb770 k4204,8 k9544,3 k156
dez 201356 211,9 k17,723401526,7 Mb756 k4204,7 k9494,2 k155
nov 2013561511,9 k27,823312406,5 Mb738 k4204,6 k9234,2 k155
out 201355 211,8 k27,923326916,3 Mb720 k4164,4 k8594,1 k154
set 201355 111,8 k17,723281506,2 Mb699 k4154,3 k8464,0 k154
ago 2013551321,8 k27,823192345,9 Mb679 k4154,2 k8424,0 k154
jul 201354 211,7 k17,923162665,8 Mb659 k4404,1 k8393,9 k154
jun 201354 111,7 k17,923261815,7 Mb647 k4584,1 k8303,8 k154
mai 201354 111,6 k2823272955,6 Mb635 k4584,0 k8173,7 k154
abr 2013542511,6 k28,123192905,4 Mb612 k4543,9 k8073,6 k154
mar 201352 211,5 k28,123083445,2 Mb592 k4463,7 k7963,6 k153
fev 201352 111,5 k28,223001735,0 Mb570 k4193,6 k7813,5 k150
jan 201352 111,4 k18,322931704,8 Mb552 k4193,4 k7763,4 k150
dez 201252 311,4 k18,422941814,7 Mb539 k4203,3 k7693,3 k150
nov 201252 211,4 k28,522653694,5 Mb517 k4063,2 k7543,2 k150
out 2012521511,3 k18,522582524,3 Mb498 k3993,1 k7483,2 k146
set 20125131211,3 k28,622586264,1 Mb481 k3933,0 k7403,1 k146
ago 2012481511,2 k28,422512993,9 Mb460 k4492,8 k7303,0 k146
jul 2012471411,2 k18,522532663,8 Mb442 k4082,8 k7142,9 k145
jun 201246 511,1 k18,622622633,7 Mb427 k4132,7 k6982,8 k144
mai 2012462411,1 k28,722784163,6 Mb415 k4072,7 k6672,7 k144
abr 201244 211,0 k28,922912413,4 Mb390 k4032,5 k6362,6 k143
mar 201244 3197129,122642773,1 Mb367 k3962,4 k6002,5 k140
fev 201244 5191329,422185802,9 Mb339 k3732,2 k5652,4 k139
jan 201244414286529,221921,5 k2,7 Mb318 k3612,1 k5272,3 k135
dez 20114029181217,921914702,5 Mb299 k4892,0 k5592,2 k119
nov 20113811177417,721931432,4 Mb286 k5061,8 k5342,1 k118
out 201137 2175717,721841462,3 Mb279 k5081,8 k5282,0 k116
set 201137 2173917,721662482,2 Mb270 k5081,7 k5172,0 k116
ago 201137 2 700 7,82171522,1 Mb257 k5081,5 k4981,9 k116
jul 201137 2 693 7,82172382,1 Mb255 k5061,5 k4921,8 k116
jun 201137 1 689 7,821761012,1 Mb254 k5181,5 k4881,8 k116
mai 201137 1167917,721741892,0 Mb250 k5051,5 k4781,8 k116
abr 201137 2165717,721694151,9 Mb242 k5051,4 k4691,7 k115
mar 20113715163327,321564811,8 Mb232 k5051,3 k4621,7 k115
fev 20113614158517,121562931,7 Mb215 k4881,1 k4381,6 k109
jan 20113534156316,921432431,6 Mb206 k4911,1 k4281,5 k106
dez 201032 31543 6,721311541,5 Mb198 k4691,0 k4161,5 k106
nov 20103212152816,621272571,5 Mb192 k4909414101,5 k106
out 201031 3151016,321163021,4 Mb186 k4868754011,4 k106
set 20103122149115,921072081,3 Mb178 k5338113941,4 k106
ago 20102922 473 5,72092871,2 Mb171 k5037453911,3 k101
jul 201027   468 5,6208281,2 Mb169 k5047243911,3 k101
jun 20102722 467 5,62082611,2 Mb168 k5037243901,3 k101
mai 201025 1 465 5,52086231,2 Mb168 k4997213881,3 k100
abr 20102512 462 5,52085251,2 Mb167 k4867153871,3 k100
mar 201024 1 460 5,52091101,2 Mb167 k4676993861,3 k99
fev 201024 2 460 5,42091231,2 Mb167 k4666993861,3 k99
jan 201024 1 459 5,42093401,2 Mb166 k4586983851,3 k99
dez 200924   455 5,42098101,2 Mb165 k4526963841,3 k96
nov 200924   455 5,3209871,2 Mb165 k4526853841,3 k96
out 20092422 455 5,32096381,2 Mb165 k4506853841,3 k96
set 200922 1 450 5,32100131,2 Mb164 k4476723791,2 k91
ago 200922121450 5,320991251,2 Mb164 k4356703801,2 k90
jul 20092112 446 52103501,2 Mb162 k4306673771,2 k89
jun 200920 2 442 52104461,1 Mb161 k4226653651,2 k89
mai 200920   438 4,92107271,1 Mb160 k4036563611,2 k85
abr 2009201  434 4,92102621,1 Mb158 k4026113371,2 k84
mar 200919   433 4,8210571,1 Mb158 k3905613401,2 k84
fev 2009191  433 4,72105101,1 Mb158 k3905613401,2 k84
jan 20091811 432 4,72110511,1 Mb158 k3905603401,2 k84
dez 20081711 427 4,72107241,1 Mb156 k3695493361,2 k79
nov 200816 2 425 4,62091261,1 Mb154 k3085493351,2 k79
out 200816 2 42314,62047991,1 Mb150 k2605473351,1 k76
set 20081612 404 4,62051481,0 Mb144 k2315343261,1 k59
ago 20081514 395 4,52062451,0 Mb142 k2245293251,1 k58
jul 200814 2 385 4,52062221000 kb138 k1845173201,1 k58
jun 200814 1 383 4,5206714997 kb138 k1615163201,1 k57
mai 200814 1 382 4,5207113997 kb137 k1605163241,1 k57
abr 200814   382 4,420711997 kb137 k1605163251,1 k56
mar 200814 1 382 4,4207148997 kb137 k1605163261,1 k56
fev 200814 1 374 4,4206854974 kb134 k1495093061,0 k55
jan 200814 1 366 4,4207740955 kb132 k1464732981,0 k53
dez 200714 1 357 4,4209229938 kb130 k14146729298352
nov 20071432 350 4,4210145924 kb128 k14146629096851
out 200711 1 345 4,3210413905 kb126 k13046729396350
set 200711 1 342 4,3211017901 kb125 k13046329695650
ago 200711   339 4,321195897 kb125 k12946329695650
jul 20071111 339 4,3211926897 kb125 k12946329795650
jun 200710 2 335 4,2211042881 kb123 k12945825192250
mai 200710 4 32114,3209680840 kb117 k11445124388250
abr 200710 2 297 4,4212351788 kb109 k10742622880844
mar 20071014 28524,42113167756 kb104 k9941522679541
fev 2007913123444,62068278611 kb84 k7838319466733
jan 20078 1 128 6,3226852361 kb50 k4319413937225
dez 20068 2 118 6,4224955331 kb46 k431919034125
nov 2006814 107 6,5231050307 kb42 k381717332023
out 20067 5 96 6,7202859246 kb34 k371646529418
set 2006714 82 7,1206862215 kb29 k361525926918
ago 20066 3 71 7,4210543186 kb26 k341395023815
jul 20066 5 58 8,31988110145 kb20 k321193819712
jun 20066 7 4618,11947236112 kb15 k2991291479
mai 2006655 1817,5186810041 kb5,6 k5439473
abr 20061   1 356644 7,1 kb1,1 k4  7 
mar 20061   1 356644 7,1 kb1,1 k4  7 
fev 20061   1 356644 7,1 kb1,1 k4  7 
jan 20061   1 356644 7,1 kb1,1 k4  7 
dez 20051   1 35664417,1 kb1,1 k4  7 
nov 20051 1 1 346586227,0 kb1,1 k4  7 
out 20051 1 1 123215103,2 kb5424    
set 200511  1 2244822,4 kb4072    
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
The following table ranks this project in relation to projects in other languages with 1000+ articles
jul 20141177514913481312149131319
abr 2014111010414312441312149131319
jan 2014119166149124101312149131319
out 20131111147144124313121410141319
jul 201311101391411124813121410141319
abr 20131171191461241013121410141319
jan 20131110168141010491312149141319
out 201211810715109491312149141319
jul 201212788151194101413149141419
abr 201213912815783815131410141419
jan 2012123571791515516141411141519
out 20111413168171215151417141111141619
jul 201114111410171414141617151112141519
abr 201113915815121414916151112141519
jan 2011133139171214141316151212151519
out 2010139129161313131016151212151519
jul 201013131712161412121716141112151519
abr 2010148158161312121716141012151519
jan 20101412159161312121516141012141419
out 20091471512151412121516141012141419
jul 20091491411151212121515141012141419
abr 20091311158151112121315141012131419
jan 200914121510151312121315131012131419
out 200814131311151311111315131212131318
jul 200814111412141311111414131312121318
abr 2008138149141211111514131212121218
jan 200812121512141510101514131211121218
out 200713111310121310101313111210111116
jul 2007138129111110101211111210111016
abr 200713111271111991311111210111015
jan 200713111391312991213111313121115
out 200613101061311881113121313121114
jul 20061310881410881014131313131314
abr 200614101281410771314141414131414
jan 2006131213101311771313131213121313
out 2005118109119441011111111101111
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100ediçõesbytes
 WikinoticiaristasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikinoticiaristas (usuários registrados)
A = Wikinoticiaristas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikinoticiaristas que editaram pelo menos dez vezes desde que chegaram
C = Wikinoticiaristas que contribuíram cinco vezes ou mais este mês
D = Wikinoticiaristas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  5  10  100  1  3  5  10  25  5  10  1  3  5  10  25  100  250  5  10  100 
Monthly counts for recent history of wiki
out 20148522221111 322211 6222211   
set 2014411111  1116221   103211  111
ago 2014221111  211       94222  431
jul 2014765321  11 421    1033221 11 
jun 2014621111  11 1      61111  221
mai 2014532111  11 21   1 52111  21 
abr 20148331111 11 321    1011111111 
mar 2014755431  11 422    1254221 111
fev 2014622211  11 3      81111  332
jan 2014511111  11 31     125441  331
dez 2013942111  11 31     122111  221
nov 2013965311  11 32     123221  33 
out 2013632111  111211    1054211 22 
set 2013621111  11 31     54321  331
ago 2013633222  1  521  11622221132 
jul 2013652221  11 422  111164321 44 
jun 2013951111  1  31     944222 331
mai 20136211111 11 11   1 732111 331
abr 20131265331  11 311  1 10533311431
mar 20131552111  11131     1144211 333
fev 2013211111  11 1      843111 32 
jan 2013521111  11        31111  331
dez 2012543221  11 32     85322  211
nov 2012632111  1112      922111 11 
out 20121165211  11 422    95211  221
set 2012361912631  11 2      642111 332
ago 20121065221  11 61     721111 11 
jul 20121044321  1  62222  1242222111 
jun 20121285311     41     1144222 333
mai 201213543211 11 311    1032211111 
abr 2012732211  11 32     63321  11 
mar 2012533211  11 31     105221  111
fev 201213752211 111511    1664332 32 
jan 20125624149621 1116331   15764332321
Quarterly counts for entire history of wiki
out 20148522221111 322211 6222211   
jul 2014765321  11 421    1033221 11 
abr 20148331111 11 321    1011111111 
jan 2014511111  11 31     125441  331
out 2013632111  111211    1054211 22 
jul 2013652221  11 422  111164321 44 
abr 20131265331  11 311  1 10533311431
jan 2013521111  11        31111  331
out 20121165211  11 422    95211  221
jul 20121044321  1  62222  1242222111 
abr 2012732211  11 32     63321  11 
jan 20125624149621 1116331   15764332321
out 2011632111  11 2      81111  33 
jul 20115221      1      113311  41 
abr 2011922111  111311    134221  211
jan 2011964111  11 2      1153111142 
out 2010843111  1116221   1343211153 
jul 201041              41        
abr 2010822              1353       
jan 20101431       1042    21852      
out 2009732       72     127651     
jul 200963211     11     105421  1  
abr 200942    11 1      831    221
jan 200911211      111    103321     
out 200842211     2111 1 1043111    
jul 2008732              8321   1  
abr 20081               53        
jan 200821111     3      133111     
out 2007321       1      11311      
jul 20075111      1      8541   11 
abr 20077422      3111   177631     
jan 200771111     3      2010532     
out 20066552      32     196432     
jul 200610754      7551   1063321 11 
abr 2006                85521     
jan 2006                102        
out 2005411              811       

 

Distribuição de edições de artigos por wikinoticiaristas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikinoticiaristasEdições total
1292100.0%14,822100.0%
312843.8%14,56598.3%
106020.5%14,17295.6%
32268.9%13,57391.6%
100144.8%12,88887.0%
31651.7%11,29276.2%
100020.7%9,83866.4%
316210.3%8,58157.9%

 

8 wikinoticiaristas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions
agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
GrondinUC1 08,5811556,97895abr 21, 201016531,25320--
Syum90UC2...1,2571,257338322out 01, 2014295959--
CommonsDelinkerUC22-148110-mai 14, 20072726----
UnapersonaUC51+13134132mar 04, 201424051--
Sami06UC128...44--out 19, 201411----
Olivier LPBUC152...33--out 19, 20141111--
JackPotteUC291...111-out 19, 201411----
LtrlgUC292...11--out 19, 201411----

 

20 wikinoticiaristas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
AljulluUC3584mai 26, 20063079set 10, 2012780
Joan301009UC4547dez 18, 20111047set 05, 201455
DavidparUC5323nov 16, 20072540jul 19, 2014103
ManlleusUC6306out 19, 20062933jun 07, 20072702
JaumeBGUC7207fev 19, 20111349ago 19, 201472
PepetpsUC8202out 23, 20053294set 05, 20082246
Érico Júnior WoutersUC9170mai 14, 2012899nov 02, 2012727
PaucabotUC10167out 12, 20062940abr 19, 2013559
BestiasonicaUC11163set 16, 20082235dez 02, 2013332
SMPUC12150mai 26, 20063079jan 02, 2014301
Mattho69UC13120abr 16, 2013562abr 22, 2014191
ArnaugirUC14111mar 23, 20111317mai 27, 2013521
MartorellUC1596out 23, 20053294dez 18, 20101412
KippelboyUC1689set 28, 20111128jun 02, 2013515
1l2UC1780dez 12, 20101418abr 20, 20111289
AlbertsabUC1857ago 24, 20062989mai 08, 20072732
IndependènciaUC1957ago 10, 20082272dez 18, 2013316
TownieUC2057ago 08, 20111179jul 23, 2012829
GyrostatUC2150dez 26, 20111039mai 27, 2014156
JoancreusUC2344jun 15, 20082328jan 15, 20121019

 

usuários anônimos, ordenados por número de contribuições
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
81.44.95.24430
77.229.84.5923
83.61.142.23810

No total 402 edições foram feitas por usuários anônimos, de um total de 19631 edições ( 2e %)
  


21 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
GrondinBotUC13,213out 11, 20091845out 31, 2014-34811
DexbotUC2994ago 26, 201465ago 30, 201461--
BOT-SuperzerocoolUC390abr 10, 20092029jul 28, 201494--
KamikazeBotUC430dez 17, 20111048dez 18, 20111047--
MjbmrbotUC517out 19, 20101472mar 27, 20111313--
タチコマ robotUC612fev 28, 20082436fev 28, 20082436--
VolkovBotUC712jun 29, 20091949fev 17, 2013620--
JAnDbotUC86fev 03, 20092095out 03, 2013392--
Iradigalesc BotUC94jun 08, 20082335jan 30, 20092099--
Diego Grez BotUC104mai 28, 20101616out 08, 20101483--
ZéroBotUC114jan 14, 20121020set 11, 2012779--
AKBotUC123fev 07, 2012996fev 14, 2012989--
AlexbotUC132fev 08, 20082456jan 27, 20092102--
AvocatoBotUC142set 15, 2012775mai 06, 2013542--
LaaknorBotUC151jun 16, 20101597jun 16, 20101597--
MerlLinkBotUC161fev 04, 20111364fev 04, 20111364--
AmirobotUC171mar 13, 20111327mar 13, 20111327--
ArthurBotUC181abr 24, 20111285abr 24, 20111285--
MerlIwBotUC191out 13, 20111113out 13, 20111113--
CarsracBotUC201jan 21, 20121013jan 21, 20121013--
BotReversorUC211out 13, 201417out 13, 201417--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110
out 20142,6 k61656 33472933,2 k1129    1426
set 20142,5 k61455 33467933,2 k1129    158
ago 20142,5 k60955 33467933,1 k1129    106
jul 20142,4 k60455 33467833,1 k1129    236
jun 20142,4 k60255 33467533,1 k1129    138
mai 20142,4 k60055 33467133,0 k1124    135
abr 20142,3 k59955 33467133,0 k1124    373
mar 20142,3 k59355 33466932,9 k 124    288
fev 20142,2 k58655 33465232,8 k 120    149
jan 20142,1 k58255 33465132,8 k 120    160
dez 20132,1 k56855 33464832,8 k 112    139
nov 20132,1 k56654 33464832,7 k 112    211
out 20132,0 k56154 33364132,7 k 112    248
set 20132,0 k55654 33363632,7 k 112    130
ago 20131,9 k53754 33363632,6 k 112    226
jul 20131,9 k53454 33363132,5 k 112    252
jun 20131,8 k52754 33361532,5 k 110    171
mai 20131,8 k52254 33361132,3 k 110    272
abr 20131,7 k52054 33060832,3 k 110    262
mar 20131,7 k51454 33060432,2 k 106    232
fev 20131,6 k50554 33059732,1 k 97    132
jan 20131,6 k49754 33059432,1 k 89    145
dez 20121,6 k49453 33059332,1 k 85    166
nov 20121,5 k48953 33058932,0 k 85    198
out 20121,5 k48753 32858732,0 k 84    231
set 20121,4 k48353 32758532,0 k 79    518
ago 20121,4 k47853 32658331,9 k 78    255
jul 20121,3 k47153 32658131,8 k 63    258
jun 20121,3 k46353 32556231,8 k 48    249
mai 20121,2 k45053 32555331,6 k 39    359
abr 20121,2 k44153 30954831,6 k 23    199
mar 20121,1 k43353 30954531,6 k 23    232
fev 20121,1 k42953 30954331,4 k 23    326
jan 20121,0 k41352 30953131,4 k 22    776
dez 201194239949 30949831,2 k 16    392
nov 201190339249 30947931,1 k 16    138
out 201188437649 30947731,1 k 16    134
set 201186637049 30947731,1 k 16    216
ago 201182636449 30947731,1 k 15    51
jul 201181935549 30947731,0 k 15    31
jun 201181534149 30947731,0 k 14    92
mai 201180533849 30647231,0 k 14    170
abr 201178233149 3064713998 14    194
mar 201175931849 3064693964 14    460
fev 201170431648 3064593897 14    277
jan 201168030545 3034413871 14    221
dez 201065929845 3014413838 11    140
nov 201064429644 3014412815 10    198
out 201062629044 3014362787 9    181
set 201060728244 3014132768 8    183
ago 201058427244 3013992747 6    79
jul 201057925444 3013902729 5    7
jun 201057825444 3013902729 5    56
mai 201057523444 3013882702 5    19
abr 201057222942 3013852700 5    21
mar 201056922242 3013782698 5    9
fev 201056921942 3013752698 5    18
jan 201056821542 3013752698 5    34
dez 200956120042 3013722689 5    7
nov 200956119542 3013692689 5    5
out 200956119542 3013682689 4    28
set 200955019242 3013662677 4    9
ago 200954918242 3013662677 4    118
jul 200954418142 3013652668 4    41
jun 200954015742 2963552659 4    26
mai 200953215742 2963532659 4    14
abr 200952715342 2963512641 4    9
mar 200952613842 2963502641 4    6
fev 200952613142 2963452641 4    1
jan 200952512642 2963432641 3    44
dez 200851612642 2963392626 3    18
nov 200851412542 2963362624 3    22
out 200850911042 2943322621 3    91
set 20084749742 2943162580 3    46
ago 20084639442 2943152574 1    45
jul 20084539142 2943112564 1    22
jun 20084509142 2943102562      12
mai 20084498442 2943092562      11
abr 20084488242 2943092559      1
mar 20084488142 2943092559      46
fev 20084397442 2923092546      39
jan 20084297042 2923052537      33
dez 20074196642 2913022521      23
nov 20074106142 2913012509      42
out 20074026042 2913012503      13
set 20073995341 2913012497      15
ago 20073965141 2912992488      3
jul 20073965141 2912972488      20
jun 20073924641 2912952482      41
mai 20073784341 2912902473      75
abr 20073484141 2892902434      46
mar 20073334141 2892892398      157
fev 20072744141 2892832359      273
jan 20071593340 2892312316      45
dez 20061493138 2822232309      48
nov 20061352838 2802182287      47
out 20061172636 2802131257      53
set 20061032434 2792081224      51
ago 2006862334 2671971205      40
jul 2006702132 2591911172      92
jun 2006551931 1821831152      201
mai 2006211316  127185      95
abr 20061 1  6811       
mar 20061 1  6811       
fev 20061 1  5811       
jan 20061 1  561        
dez 20051 1  541        
nov 20051 1  501        
out 20051    431        
set 20051    381        

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

set 2005: 1 1 Vint mil articles en català

out 2005: 1 4 Vint mil articles en català

nov 2005: 1 8 Vint mil articles en català

dez 2005: 1 1 Vint mil articles en català

mai 2006: 1 5 Portada , 2 3 Podria disputar-se un partit de futbol Catalunya-Euskadi , 3 3 Gran terratrèmol a l'illa de Java , 4 3 Google Video i el Barça firmen un acord , 5 2 Uribe és reelegit president de Colòmbia , 6 2 L'Oratge , 7 1 Estudiants xilens protesten per a demanar reformes a l'educació

jun 2006: 1 4 S'aprova en el referèndum la proposta d'estatut d'autonomia per a Catalunya , 2 4 Més de 30 mil persones es manifesten a València en defensa del territori , 3 4 Portada , 4 3 Es debat a Barcelona la tercera versió de la llicència GNU , 5 3 Maragall anuncia que no es presentarà a la reelecció , 6 3 Alemanya venç a Costa Rica a l'inici de la Copa Mundial d'Alemanya 2006 , 7 3 Mor el cap d'Al-Qaida a l'Iraq , 8 3 Comença la campanya electoral del referèndum sobre el nou Estatut català , 9 3 Rocío Jurado mor als 61 anys , 10 2 Ocupació del nou Centre d'Internament a la Zona Franca , 11 1 Montenegro es converteix en el 192é estat membre de les Nacions Unides

jul 2006: 1 5 Un comboi descarrila causant 41 morts al metro de València , 2 5 Ocupació del nou Centre d'Internament a la Zona Franca , 3 3 Grip aviària: ha estat trobat un cabussot mort a Espanya , 4 2 El Papa Benet XVI visita València per la Trobada Mundial de les Famílies , 5 2 El Papa Benet XVI visita València per la Trobada Mundial de la Família catòlica , 6 1 Vint mil articles en català

ago 2006: 1 3 Els embassaments valencians esgotaran l'aigua potable en dotze dies , 2 3 Projectes d'atemptats han sigut descoberts per la policia britànica , 3 2 Lopez Obrador no reconeix la victòria de Calderón i anuncia formar un govern paral·lel a Mèxic , 4 2 Plutó ja no es un planeta

set 2006: 1 3 Michael Schumacher anuncia que es retira , 2 2 Revolució a la borsa impulsada per la compra d'accions de les companyies elèctriques , 3 1 Un avió amb 155 passatgers s'estavella a l'Amazones

out 2006: 1 3 Orhan Pamuk, premi Nobel de Literatura 2006 , 2 3 Portada , 3 2 Lula, nou president del Brasil , 4 2 Barcelona celebrarà l'arribada del Firefox 2.0 dissabte , 5 1 Investigadors nord-americans desenvolupen un traductor capaç de llegir els llavis

nov 2006: 1 4 Jornada electoral a Catalunya , 2 2 Debat d'investidura de José Montilla , 3 2 Portada , 4 1 José Montilla és investit president de la Generalitat de Catalunya

dez 2006: 1 4 Saddam Hussein, penjat a la forca , 2 4 Explosió a l'aeroport de Madrid , 3 1 Salvades 200 persones del vaixell naufragat a Indonèsia

jan 2007: 1 3 L'Atlàntida presenta un concert de gralla i piano, amb Josep Sentmartí i Jordi Vila , 2 2 La Viquipèdia en català arriba als 50.000 articles

fev 2007: 1 3 Portada , 2 2 Es desploma el sostre d'un supermercat a la República Txeca , 3 2 La caiguda del sostre d'una pista de patinatge mata a 14 persones a Alemanya , 4 2 El pilot britànic de Fórmula 1 Jenson Button surt il·lès d'un accident en el circuit de Monza , 5 2 El president de la FIFA no descarta la candidatura de Colòmbia per a la seu del Mundial de 2014 , 6 2 La FIFA aixeca restriccions de publicació d'imatges del Mundial d'Alemanya a la web , 7 2 Brasil pot perdre seu del Mundial de futbol de 2014 , 8 1 Trekorientació, la cursa d'orientació popular de la Conca de Barberà

mar 2007: 1 5 Agustí Cerdà, candidat d'ERPV a la Generalitat Valenciana , 2 2 Surt a la venda la PlayStation 3 , 3 2 'Crisi d'estat', segons Benach si el Constitucional retalla l'estatut , 4 2 Raimon es queixa del maltracte que rep del govern valencià , 5 2 Acusen a Chávez d'antisemitisme en el seu discurs nadalenc , 6 2 Teheran realitza una conferència sobre l'Holocaust , 7 2 Montilla presenta les prioritats del govern amb el Pla de Govern 2007-2010 , 8 1 Les baralles partidistes impedeixen un acord sobre l'autodeterminació

abr 2007: 1 2 BMW Sauber presenta el seu primer Fórmula 1 , 2 2 Llançament de Debian GNU/Linux 4.0 , 3 2 \"La condició per veure TV3 al País Valencià no és raonable\" , 4 2 Avaria de l'ADSL de Telefónica deixa sense servei a milers d'usuaris a Espanya , 5 2 L'Oratge , 6 1 S'allibera la versió 7.04 de l'Ubuntu

mai 2007: 1 3 Les dues cares del conflicte israelo-palestí en dos videojocs , 2 3 Massiva manifestació a València amb el lema \"1707 - 2007 Ja n'hi ha prou!\" , 3 2 Fianna Fáil guanya les eleccions legislatives a Irlanda , 4 2 Benet XVI canonitza al primer sant brasiler , 5 1 El Nàstic, equip de segona

jun 2007: 1 2 ETA dóna per finalitzat l'alto al foc , 2 1 L'Atlàntida presenta un concert de gralla i piano, amb Josep Sentmartí i Jordi Vila

jul 2007: 1 2 La Generalitat i el govern espanyol desencallen el traspàs de la rodalia de Renfe de Barcelona , 2 1 L'Oratge/28 de juliol del 2007

ago 2007: 1 1 La Generalitat i el govern espanyol desencallen el traspàs de la rodalia de Renfe de Barcelona

set 2007: 1 2 L'Atlàntida presenta un concert de gralla i piano, amb Josep Sentmartí i Jordi Vila

out 2007: 1 1 Vint mil articles en català

nov 2007: 1 3 Trekorientació, la cursa d'orientació popular de la Conca de Barberà , 2 2 Trànsit proposa endurir l'examen del carnet de conduir per a motos de gran cilindrada arran de l'elevada sinistralitat , 3 2 El restabliment de la línia C-2 supera amb normalitat l'hora punta del primer dia laborable , 4 1 L'Atlàntida presenta un concert de gralla i piano, amb Josep Sentmartí i Jordi Vila

dez 2007: 1 2 Air Tiurana començarà a operar el 29 de febrer , 2 1 Empat al partit Euskal Herria-Catalunya

jan 2008: 1 2 La NASA hauria descobert el desè planeta del sistema solar , 2 1 Més de dos milions de signatures contra el canon digital

fev 2008: 1 1 L'AVE arriba a Barcelona

mar 2008: 1 2 Assassinat l'ex-regidor Isaías Carrasco al País Basc , 2 1 El darrer Harry Potter ven 45.000 exemplars en tan sols un mes en català

abr 2008: 1 1 La NASA hauria descobert el desè planeta del sistema solar

mai 2008: 1 2 Les FARC demanen participació més activa en el Foro de São Paulo , 2 2 La nau Voyager I abandona el sistema solar , 3 1 Trekorientació, la cursa d'orientació popular de la Conca de Barberà

jun 2008: 1 2 Trekorientació, la cursa d'orientació popular de la Conca de Barberà , 2 2 Michael Schumacher anuncia que es retira

jul 2008: 1 3 Els Mossos d'Esquadra desallotgen el Kasal Okupat del Prat

ago 2008: 1 4 Trobada Alternativa de Nou Barris , 2 3 Neix La Nostra TV, un programa amb la voluntat d'aplegar tots els canals televisius en català

set 2008: 1 3 Cessen les emissions de Televisió Pla de l'Estany , 2 3 Google llança el seu navegador web , 3 2 Trobada Alternativa de Nou Barris , 4 2 Neix La Nostra TV, un programa amb la voluntat d'aplegar tots els canals televisius en català

out 2008: 1 2 S'estrena el musical Retaule de la llum, que commemora el centenari de la creació de l'Orfeó Manresà

nov 2008: 1 4 Un trasplantament de medul·la òssia, potencialment relacionat amb el restabliment d'un pacient amb SIDA , 2 2 La FIFA aixeca restriccions de publicació d'imatges del Mundial d'Alemanya a la web , 3 1 Els Mossos d'Esquadra desallotgen el Kasal Okupat del Prat

dez 2008: 1 3 Futbol:FC Barcelona - TS Wisła Kraków (13-08-2008) , 2 1 Catalunya: s'ha obert la variant sud de Lleida

jan 2009: 1 4 Itàlia: Naufragi del vaixell Costa Concordia , 2 3 Catalunya: s'ha obert la variant sud de Lleida , 3 2 Un bombardeig israelià va matar un líder de Hamàs

fev 2009: 1 1 L'Atlàntida presenta un concert de gralla i piano, amb Josep Sentmartí i Jordi Vila

mar 2009: 1 2 Vint mil articles en català , 2 1 Catalunya: s'ha obert la variant sud de Lleida

abr 2009: 1 1 Cessen les emissions de Televisió Pla de l'Estany

mai 2009: 1 3 Noruega guanya el Festival d'Eurovisió de 2009 , 2 2 Itàlia: Naufragi del vaixell Costa Concordia , 3 2 El Barça guanya la Lliga de Campions davant el Manchester United

jun 2009: 1 3 Neix Huubs, un cercador de notícies en català , 2 2 Desenes de milers de persones es manifesten a Bilbao en defensa de la llibertat i en repulsa del darrer atemptat mortal d'ETA d'ahir divendres

jul 2009: 1 1 Neix Huubs, un cercador de notícies en català

ago 2009: 1 1 L'alcaldessa propsa que es demanin informes a reconeguts juristes

set 2009: 1 1 Neix Huubs, un cercador de notícies en català

out 2009: 1 3 Descobreixen 32 planetes extrasolars amb l'HARPS , 2 3 Mor el cantant argentí Luis Aguilé , 3 2 El TSJIB assumeix el cas Ca'n Domenge , 4 1 El Pol Nord s'està desgelant

nov 2009: 1 1 L'Atlàntida presenta un concert de gralla i piano, amb Josep Sentmartí i Jordi Vila

dez 2009: 1 1 Neix Huubs, un cercador de notícies en català

jan 2010: 1 4 L'ajuntament de Vic ha decidit no empadronar als immigrants il·legals, llevant-los l'accés a l'educació i la salut , 2 3 Manifestació del 30 de desembre de 2009 , 3 2 Vic , 4 1 L'Atlàntida presenta un concert de gralla i piano, amb Josep Sentmartí i Jordi Vila

fev 2010: 1 6 Arrestat l'alcalde de Pichilemu Jorge Vargas

mar 2010: 1 1 Vallès Visió comença a emetre de forma regular

abr 2010: 1 3 Arrestat l'alcalde de Pichilemu Jorge Vargas , 2 3 L'erupció d'un volcà a Islàndia causa l'aturada dels avions a mitja Europa

mai 2010: 1 2 El món sobre rodes , 2 1 L'Atlàntida presenta un concert de gralla i piano, amb Josep Sentmartí i Jordi Vila

jun 2010: 1 6 La Viquipèdia en català arriba als 250.000 articles , 2 4 El món sobre rodes , 3 2 El vaixell irlandès Rachel Corrie intenta arribar a Gaza

jul 2010: 1 1 Arrestat l'alcalde de Pichilemu Jorge Vargas

ago 2010: 1 2 Cessen les emissions de Televisió Pla de l'Estany

set 2010: 1 3 LIP3DUB, el primer lip dub en 3D de l'Estat Espanyol , 2 3 Els sindicats espanyols convoquen una vaga general pel 29-S , 3 2 Campionat de França de rugbi Pro D2 2010-2011: els resultats del segon dia , 4 1 Catalunya: s'ha obert la variant sud de Lleida

out 2010: 1 2 Volta a Tarragona de 2007 , 2 2 França: mor el president Georges Frêche

nov 2010: 1 2 Allau humana del Festival de l'Aigua a Cambodja , 2 2 Tests matxs de la tardor del 2010: els resultats del quart dia , 3 2 Nicolas Sarkozy : semblaria que vostè fos pedòfil , 4 2 Campionat de França de rugbi Pro D2 2010-2011: els resultats del onzè dia , 5 1 Volta a Tarragona de 2007

dez 2010: 1 3 Mort de Leslie Nielsen , 2 2 La Fundació PuntCat aporta 20.000€ per al desenvolupament del pla estratègic de la Viquipèdia , 3 2 Copa d'Europa de rugbi a 15 2010-2011: els resultats del quart dia , 4 2 Atemptat suïcida a Suècia , 5 1 Cessen les emissions de Televisió Pla de l'Estany

jan 2011: 1 3 Dret francès: els enregistraments sonors en dret civil i mercantil , 2 2 Al-Baradei encapçala l'Egipte contra el president Mubàrak , 3 2 Handbol: França és campiona del món per quarta vegada , 4 2 Campionat de França de rugbi 2010-2011: els resultats del dissetè dia , 5 2 Espanya: per primera vegada s'ha parlat en català al Senat , 6 2 França: Marine Le Pen succeix al seu pare al cap del Front nacional , 7 1 Poseu-me les ulleres, un espectacle biogràfic sobre l'obra i vida de Vicent Andrés Estellés

fev 2011: 1 3 Mor el cantant nord català Jordi Barre , 2 3 Campionat del Super 15 de rugbi a 15 2011: els resultats de la primera jornada , 3 3 Campionat de França de rugbi 2010-2011: els resultats del divuitè dia , 4 2 Poseu-me les ulleres, un espectacle biogràfic sobre l'obra i vida de Vicent Andrés Estellés , 5 2 Campionat del Super 15 de rugbi a 15 2011: els resultats de la segona jornada , 6 2 Mor el prestigiós cuiner Santi Santamaria , 7 1 L'Atlàntida presenta un concert de gralla i piano, amb Josep Sentmartí i Jordi Vila

mar 2011: 1 4 L'OTAN pren el control de la zona d'exclusió aèria de Líbia , 2 3 L'Atlàntida presenta un concert de gralla i piano, amb Josep Sentmartí i Jordi Vila , 3 3 Torneig de les Sis Nacions 2011: els resultats de la cinquena jornada , 4 3 L'ICANN aprova el domini .xxx per pornografia , 5 3 45 morts després de dispars contra manifestants iemenites , 6 3 El consell de seguretat de l'ONU aprovà la zona d'exclusió aèria a Líbia , 7 2 LIP3DUB, el primer lip dub en 3D de l'Estat Espanyol , 8 2 Qatar es converteix en primer país àrab en fer volar avions de combat per sobre de Líbia , 9 2 Nova Zelanda entra en semifinals mentre que Sud-àfrica torna a fallar a la Copa del Món de criquet masculí , 10 2 Japó eleva el nivell de gravetat de la crisi, els esforços per refredar la malmesa central d'energia nuclear continuen , 11 2 Home acusat d'assassinat d'una dona britànica a Hong Kong , 12 2 Campionat del Super 15 de rugbi a 15 2011: els resultats de la sisena jornada , 13 2 Mor el linguïsta francès Jacques Capelovici

abr 2011: 1 3 L'Atlàntida presenta un concert de gralla i piano, amb Josep Sentmartí i Jordi Vila , 2 2 Mor l'actriu francesa Marie-France Pisier , 3 2 Campionat del Super 15 de rugbi a 15 2011: els resultats de la vuitena jornada , 4 2 Un empresari fuig i deixa desamparats als seus treballadors

mai 2011: 1 4 El FC Barcelona guanya la Copa de la Lliga de Campions UEFA de la temporada 2010-2011 , 2 2 Campionat de la Lliga cèltica de rugbi 2010-2011: els resultats de la vint-i-dosena jornada , 3 2 Campionat del Super 15 de rugbi a 15 2011: els resultats de la dotzena jornada , 4 1 El FC Barcelona va guanyar la Copa de la Lliga de Campions UEFA de la temporada 2010-2011

jun 2011: 1 2 Mor l'actor Peter Falk , 2 2 Catalunya participarà a la Copa del Món de Touch Rugbi , 3 2 Campionat del Super 15 de rugbi a 15 2011: els resultats de la divuitena jornada , 4 1 Volta a Tarragona de 2007

jul 2011: 1 2 El món sobre rodes , 2 1 Poseu-me les ulleres, un espectacle biogràfic sobre l'obra i vida de Vicent Andrés Estellés

ago 2011: 1 5 Tanca la Televisió d'Ontinyent , 2 2 Poseu-me les ulleres, un espectacle biogràfic sobre l'obra i vida de Vicent Andrés Estellés , 3 2 Es pot consultar Atsotitzak per Internet

set 2011: 1 3 Neix Tanatopedia, la primera enciclopèdia virtual col·laborativa sobre el món funerari , 2 3 Copa del Món de rugbi a 15 2011: els resultats de la segona jornada , 3 2 Copa del Món de rugbi a 15 2011: els resultats de la quarta jornada , 4 1 L'Atlàntida presenta un concert de gralla i piano, amb Josep Sentmartí i Jordi Vila

out 2011: 1 3 Copa del Món de rugbi a 15 2011: els All Blacks campions del món , 2 3 Copa del Món de rugbi a 15 2011: França classificada per la final , 3 2 Campionat de França de rugbi Pro D2 2011-2012: els resultats de la sisena jornada , 4 2 Copa del Món de rugbi a 15 2011: França i Gal·les jugaran la semifinal , 5 2 Copa del Món de rugbi a 15 2011: els resultats de la vintena jornada , 6 1 Neix Tanatopedia, la primera enciclopèdia virtual col·laborativa sobre el món funerari

nov 2011: 1 3 Es pot consultar Atsotitzak per Internet , 2 2 França: mor la vídua de l'antic president François Mitterrand , 3 2 Estats Units: el conflicte entre els jugadors i l'NBA es torna virulent , 4 2 Estats Units: l'NBA manté el locaut després el fracàs de les últimes negociacions , 5 1 L'Atlàntida presenta un concert de gralla i piano, amb Josep Sentmartí i Jordi Vila

dez 2011: 1 5 Mor el dictador nord-coreà Kim Jong-il , 2 4 La vaga dels agents de seguretat dels aeroports acaba , 3 4 Mor la cantora capverdiana Cesária Évora , 4 4 El Canadà tanca al calaix el Protocol de Kyoto , 5 4 Mèxic: un terratrèmol de magnitud 6,7 mata almenys tres persones , 6 3 Neix Huubs, un cercador de notícies en català , 7 3 Una quarta part dels béns històrics de la Xina estan mal conservats , 8 3 Brasil esdevé la sisena economia en el món , 9 3 Campionat de França de rugbi 2011-2012: els resultats de la tretzena jornada , 10 2 L'Atlàntida presenta un concert de gralla i piano, amb Josep Sentmartí i Jordi Vila , 11 2 El món sobre rodes , 12 2 Estats Units: creixement de l'atur durant el mes de desembre de 2011

jan 2012: 1 41 Itàlia: Naufragi del vaixell Costa Concordia , 2 8 Comunicat de la Comunitat Viquipèdia , 3 5 Els Mossos d'Esquadra desallotgen el Kasal Okupat del Prat , 4 5 Dos policies brasilers han estat sancionats després d'agredir un estudiant de la Universitat de São Paulo , 5 4 Cessen les emissions de Televisió Pla de l'Estany , 6 3 França: Desaparicions misterioses dels gats a Costa d'Or , 7 3 Vallès Visió comença a emetre de forma regular , 8 3 Copa del Rei 2011-2012: el Barça derrota el Real Madrid al partit d'anada dels quarts de final , 9 3 Viquinotícies en català supera les 1000 pàgines , 10 3 Mor el president de Guinea Bissau, Malam Bacai Sanhá , 11 3 Neix La Nostra TV, un programa amb la voluntat d'aplegar tots els canals televisius en català , 12 3 El Barça guanya 4-0 a l'anada de la copa contra l'Osasuna , 13 3 Il·lustradors de Llotja faran pràctiques professionals amb Amical Viquipèdia , 14 3 Xavi Hernández ha estat elegit per quart cop consecutiu millor cradeor de joc del món , 15 3 Condemnats per no afrontar els riscos de pluja , 16 3 Al-Jazeera comença a emetre en anglès , 17 2 Poseu-me les ulleres, un espectacle biogràfic sobre l'obra i vida de Vicent Andrés Estellés , 18 2 El món sobre rodes , 19 2 Arrestat l'alcalde de Pichilemu Jorge Vargas , 20 2 Neix Huubs, un cercador de notícies en català , 21 2 Neix Tanatopedia, la primera enciclopèdia virtual col·laborativa sobre el món funerari , 22 2 Tanca la Televisió d'Ontinyent , 23 2 Trobada Alternativa de Nou Barris , 24 2 Djokovic supera a Murray i jugarà contra Nadal en la final de l'Open d'Austràlia , 25 2 França: els policies treballant a la frontera s'hauran de pagar l'autopista

fev 2012: 1 4 Mor el pintor català Antoni Tàpies , 2 4 Rugbi a 15: Sébastien Chabal es troba sense club , 3 3 Apareix Lajornada.cat, un nou diari digital esportiu en català , 4 3 Campionat d'Espanya de futbol 2011-2012: els resultats de la vint-i-dosena jornada , 5 2 Campionat del Super 15 de rugbi a 15 2012: els resultats de la primera jornada , 6 2 Campionat de França de futbol de lliga 2 2011-2012: empat entre Tours i Le Havre , 7 2 Lliga de Campions de la UEFA 2011-2012: el Barça derrota fora el Bayer Leverkusen , 8 2 Estats Units: guanya Mitt Romney en les primàries republicanes de Maine , 9 2 Torneig de les Sis Nacions 2012: el partit entre França i Irlanda tindrà lloc com era previst , 10 2 Copa del Rei 2011-2012: el Barça i l'Athletic Club jugaran la final , 11 2 Estats Units: en les primàries del Partit Republicà a Colorado i Minnesota surt victoriós Rick Santorum , 12 1 Catalunya: s'ha obert la variant sud de Lleida

mar 2012: 1 2 Campionat de França de rugbi 2011-2012: el Racing Metro venç el Castres Olympique , 2 2 Catalunya del Nord en situació de vigilància per la sequera , 3 2 França: el fundador del GIGN critica l'acció del RAID , 4 2 Feredat a la ciutat de Tolosa de Llenguadoc , 5 2 Torneig de les Sis Nacions 2012: el País de Gaŀles guanya el Gran Slam , 6 2 Illes Balears: una vaga de fam per a la defensa del català , 7 2 Rick Santorum guanya en les primàries de Kansas , 8 2 Lliga de Campions 2012: el Barça classificat per a les quarts de final , 9 1 Volta a Tarragona de 2007

abr 2012: 1 3 La nacionalització d'YPF pel govern argentí crea polèmica , 2 3 Rick Santorum es retira de la carrera presidencial estatunidenca , 3 2 Es presenta l'assaig «Descoberta i conquesta catalana d'Amèrica» , 4 2 Lliga de Campions 2012: el Barça es classifica per a les semifinals , 5 1 Campionat de França de futbol de lliga 1 2011-2012: els resultats de la trenta-quatrena jornada

mai 2012: 1 4 Eleccions presidencials franceses del 2012: François Hollande és el setè president de la Cinquena República , 2 3 França : Jean-Marc Ayrault nomenat Primer ministre , 3 3 Es presenta l'assaig «Descoberta i conquesta catalana d'Amèrica» , 4 2 S'estrena 10 cites a Televisió de Catalunya , 5 2 El bo espanyol, lluny dels nivells d'intervenció de Grècia i Portugal , 6 2 El foc de Rasquera ja ha cremat 2.400 hectàrees , 7 2 El català Manuel Valls, ministre d'Interior francès , 8 2 Rajoy torna a demanar ajuda a Europa , 9 2 País Valencià: el PSPV proposa Carles Santos pel Consell de Cultura , 10 1 L'Atlàntida presenta un concert de gralla i piano, amb Josep Sentmartí i Jordi Vila

jun 2012: 1 3 Android GingerBread , 2 3 Espanya: Ajuntament Impulsa, un web per a ajudar els ajuntaments del país , 3 3 França: mor el periodista esportiu Thierry Roland , 4 2 Copa d'Europa de futbol 2012: Laurent Blanc deixa la seva funció de seleccionador dels “Bleus” , 5 2 Finalitza el Campionat del món sots16 de corfbol 2008 , 6 2 Unió Europea: fi de la independència pressupostària dels estats , 7 2 Egipte: Hosni Mubàrak cau en coma , 8 2 El PASOK anuncia per demà un govern de coalició amb Nova Democràcia , 9 2 Quebec: un espectacle audiovisual per a la commemoració dels naufragis del Titanic i de l'Empress of Ireland , 10 2 Rajoy insisteix a defensar la solidesa de l'economia espanyola , 11 2 Bauzá, reelegit president del PP balear

jul 2012: 1 3 Catalunya: l'Alt Empordà és víctima de les flames , 2 3 El Parlament europeu rebutja el projecte ACTA , 3 3 Copa d'Europa de futbol 2012: Espanya humilia Itàlia a la final , 4 3 Espanya: Ajuntament Impulsa, un web per a ajudar els ajuntaments del país , 5 2 Murdoch dimiteix de la branca britànica del seu imperi , 6 2 Google amplia el seu museu virtual , 7 2 Microsoft presenta el competidor de l'iPad , 8 2 La UE prendrà competències al govern espanyol i tutelarà el Banc d'Espanya , 9 2 Twitter confirma de forma oficial que a partir de demà dijous serà també en català , 10 1 Alemanya: una majoria dels alemanys en favor d'una sortida de l'euro

ago 2012: 1 6 Catalunya: més d'un milió de persones manifesten a favor de la independència , 2 4 El CE Vilanova i la Geltrú guanya la Copa Catalunya de corfbol 2012 , 3 2 Breivik, condemnat a vint-i-un anys de presó prorrogables , 4 2 Exemples de mala gestió i de maniobres irregulars a RTVV , 5 2 El CK Vallparadís guanya la seva primera Copa Catalana , 6 2 El Vacarisses guanya la copa Catalana 2008 , 7 2 El CK Vacarisses es fa amb la seva quarta Copa Catalana , 8 2 El CEVG guanya la seva primera Copa de corfbol , 9 2 El CE Vilanova i la Geltrú guanya la Copa Catalunya de corfbol 2011

set 2012: 1 30 Catalunya: més d'un milió de persones manifesten a favor de la independència , 2 3 Unió europea: Barroso es declara en pro d'un federalisme europeu , 3 2 Salut: els OGM podrien augmentar el risc de càncer , 4 2 Quebec: l'SHMP continuarà assegurant la gestió del far de Pointe-au-Père l'any 2013 , 5 2 Comença l'extracció de combustible d'un petrolier enfonsat el 1937 als Columbrets , 6 2 Barcelona World, el projecte turístic alternatiu a Eurovegas , 7 2 Adelson anuncia que instal·larà Eurovegas a Madrid , 8 2 Algemesí celebra les festes de la Mare de Déu de la Salut , 9 1 La banca europea realitza tests d'estrès

out 2012: 1 3 França: l'estat s'oblida de pagar el sou d'uns quants soldats , 2 2 Ernest Maragall abandona el PSC i crea Nova Esquerra Catalana , 3 2 Catalunya: Mas, ignorat internacionalment? , 4 2 Canonització de Kateri Tekakwitha , 5 2 Descoberta d'un planeta extrasolar tenint 4 sols

nov 2012: 1 2 Tests matxs tardor 2012 : França derrota Austràlia per 33 à 6 , 2 2 Obama és reelegit com a President dels Estats Units , 3 2 Disney compra la productora de George Lucas i anuncia nous capítols de 'Star Wars' , 4 2 Abertis va guanyar mil milions fins al setembre, un 69% més , 5 1 Ernest Maragall abandona el PSC i crea Nova Esquerra Catalana

dez 2012: 1 3 28 morts en un tiroteig escolar a Connecticut , 2 2 Ghana: l'actual president John Mahama guanya les eleccions presidencials , 3 2 Filipines: el tifó Bopha causa la mort a més de 300 persones , 4 1 Ernest Maragall abandona el PSC i crea Nova Esquerra Catalana

jan 2013: 1 3 Llançament oficial de Viquiviatges , 2 2 Ernest Maragall abandona el PSC i crea Nova Esquerra Catalana

fev 2013: 1 1 Campionat d'Espanya de futbol 2012-2013: els resultats de la vint-i-cinquena jornada

mar 2013: 1 6 Veneçuela : mor el président Hugo Chávez , 2 4 Roma: Papa Francesc renta els peus de 12 reus durant la missa de Dijous Sant , 3 3 El col·legi cardenalici elegeix Jorge Mario Bergoglio com a nou papa , 4 2 Seu Vacant del 2013: el Col·legi Cardenalici entra en conclave avui , 5 2 Ciutat del Vaticà: és vacant la Santa Seu després de la renúncia de Benet XVI

abr 2013: 1 6 Atemptat de Boston: dos sospitosos identificats pel FBI , 2 4 Estats Units: 3 morts i més de 170 ferits a l'atemptat de Boston , 3 3 Teresa Forcades i Arcadi Oliveres promouen un manifest \"per un procés constituent a Catalunya\" , 4 2 El català té una gran capacitat d'atracció

mai 2013: 1 3 Arriba al seu quart mes la vaga de gana de presos de Guantánamo , 2 2 França: 68a. commemoració de l'armistici del 8 de maig del 1945 , 3 1 Teresa Forcades i Arcadi Oliveres promouen un manifest \"per un procés constituent a Catalunya\"

jun 2013: 1 5 Ciutat del Vaticà: el Papa Francesc apel·la a una reforma de la Cúria Vaticana , 2 2 Meka Whaitiri és proclamada guanyadora de l'elecció parcial d'Ikaroa-Rāwhiti a Nova Zelanda , 3 2 Sud-àfrica: Nelson Mandela es troba en estat crític , 4 1 Teresa Forcades i Arcadi Oliveres promouen un manifest \"per un procés constituent a Catalunya\"

jul 2013: 1 3 Egipte: més de setanta morts al Caire en les topades entre la policia i partidaris del president Mursi , 2 3 Tragèdia ferroviària a Galícia: 80 morts i 35 ferits crítics , 3 2 Campionat del Super 15 de rugbi a 15 2013: Els Chiefs i Brumbies disputaran la final , 4 2 País Valencià: el meteoròleg Jordi Payà s'acomiada de Canal 9 , 5 2 França: diversos morts en un accident de tren a prop de París , 6 2 Nova Zelanda: Pita Sharples dimiteix com a colíder del Partit Maori , 7 2 Catalunya: s'ha obert la variant sud de Lleida , 8 1 Quim Arrufat: “La corrupció és el sistema”

ago 2013: 1 2 Més de 150 persones inicien la Marxa per l’Educació Pública , 2 2 Els Estats Units van pagar a Facebook, Google, Yahoo i Microsoft per a espiar , 3 2 Estats Units: trenta-cinc anys de presó per a Bradley Manning , 4 2 El Madrid guanya 2-1 al Real Betis a la primera jornada de la Lliga , 5 2 El Barça guanya 7-0 al Levante UD a la primera jornada de la Lliga , 6 2 Estats Units: Obama anuncia reformes en els programes d'espionatge , 7 2 Illes Balears: la coalició Més denuncia que les destitucions de directors són il·legals , 8 2 Obama suspèn la reunió amb Putin després de les tensions pel cas Snowden , 9 1 Espanya: el batlle de Callosa escandalitza la premsa britànica per la “invasió” de Gibaltar

set 2013: 1 3 Catalunya: èxit de la Via Catalana , 2 2 Islàndia suspèn el procés d'adhesió a la Unió Europea , 3 1 Campionat de França de futbol de lliga 1 2013-2014: els resultats de la vuitena jornada

out 2013: 1 3 La NSA nega haver espiat els europeus , 2 2 Catalunya: manifestació important contra la Lomce , 3 2 Eleccions europees franceses del 2014: el Front Nacional al capdavant en un sondeig , 4 2 Eleccions presidencials franceses del 2012: els electors del Front Nacional cortejats , 5 1 Noves filtracions mostren que BT Security va facturar 9.000 euros al Cesicat per quatre informes d'espionatge a activistes

nov 2013: 1 4 França: tiroteig a la seu del diari « Libération » , 2 2 Explosió a la planta West Fertilizer , 3 2 Romain Lannuzel segueix desparegut sis anys després , 4 2 Campionat d'Anglaterra de futbol 2013-2014: els resultats de la dotzena jornada , 5 2 Estats Units: s'informava Obama sobre les operacions d'espionatge

dez 2013: 1 3 Catalunya: la consulta per a la independència tindrà lloc el 9 de novembre del 2014 , 2 2 Finalitza el Campionat del Món sub19 de korfbal 2010 , 3 2 Mor l'expresident sud-africà Nelson Mandela , 4 2 Mor Ma. Dolors Baena Font , 5 1 Catalunya del Nord: robats els cables del tren groc

jan 2014: 1 2 Israel: mor l'exprimer ministre Ariel Xaron , 2 2 Desenes de milers de persones es manifesten a Bilbao en defensa de la llibertat i en repulsa del darrer atemptat mortal d'ETA d'ahir divendres , 3 1 País Valencià: concentració a València contra el tancament de les televisions i les ràdios en català

fev 2014: 1 4 Estats Units: mor Quentin Elias, excantor del grup francès Alliage

mar 2014: 1 3 Eleccions municipals franceses del 2014: la mapa dels resultats de la segona volta , 2 3 Eleccions municipals franceses del 2014 - segona volta: Estrasburg , 3 2 Eleccions municipals franceses del 2014 - segona volta: Reims , 4 2 Eleccions municipals franceses del 2014 - segona volta: Rennes , 5 2 Eleccions municipals franceses del 2014 - segona volta: Beauvais , 6 2 Eleccions municipals franceses del 2014 - segona volta: Montalban

abr 2014: 1 6 Kepler-186f: descobreixen un planeta potencialment habitable , 2 2 Eleccions municipals franceses del 2014 - segona volta: Clarmont d'Alvèrnia , 3 2 Crimea: la població vota massivament a favor de la unió amb Rússia , 4 1 Perpinyà: 113 llars sense gas natural des de dijous passat

mai 2014: 1 3 França: Jean-François Copé dimiteix com a president de la UMP , 2 2 Obama amenaça a Síria amb una \"resposta greu\" pels atacs químics encara que no se'n sap l'autoria , 3 1 Campionat del Super 15 de rugbi a 15 2014: els resultats de la setzena jornada

jun 2014: 1 2 Mundial 2014: Itàlia eliminada , 2 2 Felip VI nou rei d'Espanya , 3 2 Mundial 2014: Espanya rosega les mastegueres contra els Països Baixos , 4 2 Mundial 2014: el Brasil guanya el seu matx d'obertura , 5 2 Mundial 2014: cerimònia d'obertura , 6 1 Mundial 2014: França es classifica per als quarts de final

jul 2014: 1 4 Continua la música al FIB 2014 , 2 4 El FIB inicia la seua 20a edició , 3 3 Vint anys del Festival Internacional de Benicàssim , 4 3 El FIB 2014 s'acomiada fins a l'any que ve , 5 3 The Libertines i Lily Allen, principals actuacions de la tercera jornada del FIB 2014 , 6 2 El Tribunal Suprem confirma la pena de quatre anys de presó per a l'expresident de la Diputació de Castelló i del PP provincial, Carlos Fabra , 7 2 Biquipedia, la Viquipèdia en aragonés, celebra el seu desé aniversari , 8 2 Catalunya: fi de Caixa Catalunya , 9 1 Perpinyà: una guarderia reubicada a causa de múltiples incidents

ago 2014: 1 1 França: Manuel Valls al funeral de Christian Bourquin

set 2014: 1 2 Campionat d'Espanya de futbol 2014-2015: els resultats de la tercera jornada , 2 1 França: nou daltabaix dels socialistes a les eleccions senatorials

out 2014: 1 5 Ciutat del Vaticà: beatificació del papa Pau VI , 2 3 Atorguen el Nobel d'Economia al francès Jean Tirole , 3 2 El govern espanyol vol impugnar també el nou 9-N , 4 2 Companyia japonesa disponibilitza manuscrits de la Biblioteca Vaticana , 5 2 Declaren \"sense Ebola\" a la infermera espanyola Teresa Romero , 6 2 Andrés Iniesta guanya el Golden Foot 2014 , 7 2 El cicló Hudhud deixa almenys sis morts a l'Índia , 8 2 Marina Silva anuncia el seu suport a Aécio Neves per a la segona ronda al Brasil , 9 2 Rousseff i Neves es disputaran la presidència del Brasil a la segona ronda , 10 2 La missió Grail de la NASA descobreix l'origen de la taca visible de la Lluna , 11 2 Mèxic confirma captura del cap del Càrtel dels Beltrán Leyva , 12 2 Doble atemptat a Síria deixa 48 morts , 13 1 Campionat d'Espanya de futbol 2014-2015: els resultats de la desena jornada

No data on this page have been normalized to 30 day months (as WMF does on certain traffic reports).
Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Segunda-feira, 1 de dezembro 2014 04:30

Dump file cawikinews-20141104-pages-meta-history.xml.7z (full dump), size 5.2 Mb as 7z -> 164 Mb
Dump processed till Oct 31, 2014, on server stat1002, ready at Thu-06/11/2014-10:50 after 28 sec.

Versão do script:2.6
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.