Estatísticas da Wikinotícias catalão

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist

Metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.
See also metrics definitions


 
Monthly counts & Quarterly rankings: dezembro 2015
 
DataWikinoticiaristasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
dez 2015+3%   +1%   -5%      0%
nov 20150%   +1%   -8%      0%
out 20150%   +2%   +19%      0%
set 20150%   +1%   -66%      0%
ago 20150%   +1%   +113%      0%
jul 2015+3%   +1%   -2%      0%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
dez 2015732413,1 k18,3 209      249
nov 201571 213,1 k18,3 219      248
out 201571 213,0 k28,4 237      248
set 201571 213,0 k18,4 199      247
ago 201571 212,9 k18,5 583      247
jul 2015712512,9 k18,4 274      247
jun 201569 222,9 k18,4 279      247
mai 201569 222,8 k28,4 443      245
abr 201569 212,8 k28,4 413      205
mar 2015691322,7 k28,423423899,3 Mb1,1 M6291,8 k2795,7 k205
fev 201568 422,7 k28,423333289,1 Mb1,0 M6271,8 k2795,5 k205
jan 201568 222,6 k28,423315628,9 Mb1,0 M6231,8 k2785,4 k205
dez 201468 212,6 k28,423307878,7 Mb990 k6111,8 k2785,3 k204
nov 201468 322,5 k28,323248398,5 Mb966 k5781,8 k2775,2 k196
out 2014681322,5 k38,123261,4 k8,3 Mb946 k5351,8 k2775,1 k184
set 201467 112,4 k27,823435048,0 Mb916 k4321,8 k2774,9 k162
ago 201467 112,3 k17,823371,1 k7,8 Mb896 k4321,8 k2774,8 k162
jul 2014672712,3 k17,423352827,9 Mb882 k4325,5 k2774,8 k162
jun 201465 112,3 k17,423461527,8 Mb870 k4265,4 k2754,7 k159
mai 201465 212,2 k27,423591517,7 Mb863 k4265,4 k2754,7 k159
abr 201465 312,2 k27,523574257,5 Mb844 k4205,2 k2754,6 k159
mar 2014652512,1 k37,523473167,3 Mb821 k4205,0 k2664,5 k158
fev 2014631312,0 k27,623471837,0 Mb789 k4204,9 k2344,4 k157
jan 201462 212,0 k17,723401906,8 Mb770 k4204,8 k2344,3 k157
dez 2013622312,0 k17,823401656,7 Mb756 k4204,7 k2344,2 k156
nov 2013601511,9 k27,923312416,5 Mb738 k4204,6 k2344,2 k156
out 201359 311,9 k27,923326986,3 Mb720 k4164,4 k2334,1 k155
set 201359 111,8 k17,823281516,2 Mb699 k4154,3 k2334,0 k155
ago 2013591321,8 k27,923192345,9 Mb679 k4154,2 k2334,0 k155
jul 201358 211,7 k1823162665,8 Mb659 k4404,1 k2333,9 k155
jun 201358 111,7 k1823261825,7 Mb647 k4584,1 k2333,8 k155
mai 201358 111,7 k2823272975,6 Mb635 k4584,0 k2323,7 k155
abr 2013582511,6 k28,123192955,4 Mb612 k4543,9 k2323,6 k155
mar 201356 311,6 k28,123083505,2 Mb592 k4463,7 k2293,6 k154
fev 201356 211,5 k18,223001795,0 Mb570 k4193,6 k2283,5 k151
jan 201356 111,5 k18,322931754,8 Mb552 k4193,4 k2283,4 k151
dez 201256 311,4 k18,422941854,7 Mb539 k4203,3 k2283,3 k151
nov 201256 211,4 k28,522653804,5 Mb517 k4063,2 k2283,2 k151
out 2012561611,3 k18,522582534,3 Mb498 k3993,1 k2273,2 k147
set 20125531211,3 k28,622586274,1 Mb481 k3933,0 k2273,1 k147
ago 2012521511,2 k28,522512993,9 Mb460 k4492,8 k2283,0 k147
jul 2012511411,2 k18,522532683,8 Mb442 k4082,8 k2282,9 k146
jun 201250 511,2 k18,622622633,7 Mb427 k4132,7 k2282,8 k145
mai 2012502411,1 k28,722784173,6 Mb415 k4072,7 k2282,7 k145
abr 201248 211,0 k28,922912423,4 Mb390 k4032,5 k2282,6 k144
mar 201248 3199829,122642803,1 Mb367 k3962,4 k2282,5 k141
fev 201248 5194029,322185802,9 Mb339 k3732,2 k2282,4 k140
jan 201248314289229,221921,5 k2,7 Mb318 k3612,1 k2282,3 k136
dez 20114529184017,921914722,5 Mb299 k4892,0 k2322,2 k120
nov 20114311180217,721931462,4 Mb286 k5061,8 k2322,1 k119
out 201142 2178517,721841462,3 Mb279 k5081,8 k2322,0 k117
set 201142 2176717,721662482,2 Mb270 k5081,7 k2312,0 k117
ago 201142 2 727 7,82171552,1 Mb257 k5081,5 k2311,9 k117
jul 201142 2 720 7,82172462,1 Mb255 k5061,5 k2311,8 k117
jun 201142 1 716 7,821761062,1 Mb254 k5181,5 k2311,8 k117
mai 201142 1170617,721741912,0 Mb250 k5051,5 k2301,8 k117
abr 201142 2168417,721694181,9 Mb242 k5051,4 k2301,7 k116
mar 20114216166127,321564901,8 Mb232 k5051,3 k2301,7 k116
fev 20114114161117,121562931,7 Mb215 k4881,1 k2251,6 k110
jan 20114024159016,921432461,6 Mb206 k4911,1 k2251,5 k107
dez 201038 31569 6,721311551,5 Mb198 k4691,0 k2261,5 k107
nov 20103823155416,621272791,5 Mb192 k4909412251,5 k107
out 201036 4153516,321163151,4 Mb186 k4868752251,4 k107
set 20103612151515,921072131,3 Mb178 k5338112231,4 k107
ago 20103522 496 5,72092911,2 Mb171 k5037452211,3 k102
jul 201033   491 5,6208281,2 Mb169 k5047242211,3 k102
jun 20103312 490 5,62082621,2 Mb168 k5037242211,3 k102
mai 20103211 488 5,52086241,2 Mb168 k4997212231,3 k101
abr 20103112 485 5,52085251,2 Mb167 k4867152231,3 k101
mar 201030 1 483 5,52091121,2 Mb167 k4676992231,3 k100
fev 20103012 483 5,42091241,2 Mb167 k4666992231,3 k100
jan 20102911 482 5,42093401,2 Mb166 k4586982221,3 k100
dez 200928   478 5,42098131,2 Mb165 k4526962221,3 k97
nov 200928 1 478 5,32098221,2 Mb165 k4526852221,3 k97
out 20092822 478 5,32096411,2 Mb165 k4506852221,3 k97
set 200926 1 470 5,32100161,2 Mb164 k4476722211,2 k93
ago 200926131470 5,220991341,2 Mb164 k4356702221,2 k92
jul 20092512 466 52103501,2 Mb162 k4306672191,2 k90
jun 200924 2 462 4,92104491,1 Mb161 k4226652111,2 k90
mai 200924   458 4,92107281,1 Mb160 k4036562081,2 k86
abr 2009241  454 4,92102611,1 Mb158 k4026111831,2 k84
mar 200923   453 4,7210591,1 Mb158 k3905611861,2 k84
fev 2009231  453 4,72105131,1 Mb158 k3905611861,2 k84
jan 20092211 452 4,72110611,1 Mb158 k3905601861,2 k84
dez 20082111 445 4,62107271,1 Mb156 k3695491861,2 k79
nov 200820 2 443 4,62091281,1 Mb154 k3085491871,2 k79
out 200820 2 44114,620471041,1 Mb150 k2605471881,1 k76
set 20082022 423 4,52051491,0 Mb144 k2315341871,1 k59
ago 20081825 413 4,52062551,0 Mb142 k2245291861,1 k59
jul 200816 2 402 4,52062251000 kb138 k1845171831,1 k59
jun 200816 1 400 4,4206715997 kb138 k1615161831,1 k58
mai 200816 1 399 4,4207116997 kb137 k1605161851,1 k58
abr 200816   399 4,420717997 kb137 k1605161861,1 k57
mar 200816 1 398 4,4207148997 kb137 k1605161871,1 k57
fev 200816 1 390 4,3206859974 kb134 k1495091691,0 k56
jan 200816 1 382 4,3207739955 kb132 k1464731631,0 k54
dez 200716 1 373 4,3209229938 kb130 k14146715998352
nov 20071622 365 4,3210146924 kb128 k14146615996851
out 200714 1 358 4,2210413905 kb126 k13046716196350
set 20071411 355 4,2211022901 kb125 k13046316095650
ago 20071311 352 4,2211937897 kb125 k12946316095650
jul 20071211 351 4,1211926897 kb125 k12946316095650
jun 200711 2 346 4,1211041881 kb123 k12945815892250
mai 200711 4 33214,1209678840 kb117 k11445115588250
abr 200711 2 308 4,2212353788 kb109 k10742614680844
mar 20071114 29624,22113166756 kb104 k9941514679541
fev 20071013124444,42068273611 kb84 k7838311966733
jan 20079 1 137 5,9226830361 kb50 k431946737225
dez 20069 2 126 6,2224958331 kb46 k431916434125
nov 2006925 114 6,3231054307 kb42 k381714932023
out 20067 6 101 6,6202866246 kb34 k371644529418
set 2006714 87 6,9206858215 kb29 k361524226918
ago 20066 3 73 7,4210546186 kb26 k341393423815
jul 20066 5 59 8,41988110145 kb20 k321192519712
jun 20066 7 4718,21947235112 kb15 k2991191479
mai 2006655 1917,818689641 kb5,6 k5432473
abr 20061   3 17,7664447,1 kb1,1 k4  7 
mar 20061   3 16,36644 7,1 kb1,1 k4  7 
fev 20061   3 16,3664457,1 kb1,1 k4  7 
jan 20061   3 14,76644 7,1 kb1,1 k4  7 
dez 20051   3 14,7664477,1 kb1,1 k4  7 
nov 20051 1 3 12,36586227,0 kb1,1 k4  7 
out 20051 1 3 53215103,2 kb5424    
set 20051   3 1,7244822,4 kb4072    
ago 200511  2 1,5 3       
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
The following table ranks this project in relation to projects in other languages with 1000+ articles
out 201511 13514410 5      18
jul 20151126514910 6      18
abr 201511 14514510 5      18
jan 2015117143145104513121612151318
out 2014118125155104113121612151318
jul 201411556151011481312179151318
abr 2014111212415610441312179151318
jan 20141110136151110491412179151318
out 20131111117154104314121710151418
jul 2013111115101512104814121710161518
abr 201311712101581041114121710161518
jan 2013119159161293101513179151418
out 201211897161293101513179151418
jul 2012128911161393111614179151418
abr 201213912916983816141710151418
jan 20121256717101616517151711151618
out 201113151611171316161318161312161618
jul 20111310138171216161518161313151618
abr 2011131015917121616818151313151618
jan 20111361110181216161017161313151518
out 201013711917131515918161313141518
jul 201013131712181414141818151214151518
abr 2010138169181314141618151114141518
jan 20101312169171313131517141113141418
out 20091381411161413131517141113141418
jul 200912101510161313131516141113131418
abr 20091211169161113131315141113131418
jan 200912121410151313131415131113131418
out 200812131311151313131315131213131318
jul 200814111411141312121414131313131318
abr 2008129159141212121614131213131218
jan 200812121512141511111514131212121218
out 200712121210121211111213121211121117
jul 2007127128121011111212121211121117
abr 20071312127131210101412121211121117
jan 20071411149141110101215131415121217
out 20061410961511991115141415121216
jul 20061410881510991015151415121416
abr 200616101391611881316161616151616
jan 2006151214111512881515151515141515
out 20051310119139441113131313121313
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100ediçõesbytes
 WikinoticiaristasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikinoticiaristas (usuários registrados)
A = Wikinoticiaristas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikinoticiaristas que editaram pelo menos dez vezes desde que chegaram
C = Wikinoticiaristas que contribuíram cinco vezes ou mais este mês
D = Wikinoticiaristas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  5  10  100  1  3  5  10  25  5  10  1  3  5  10  25  100  250  5  10  100  1000 
dez 2015544421  1  31     54321  2221
nov 2015722221  1  5      73222  1111
out 2015522221  11 421    622221 3221
set 2015932221  1  521    22222  3311
ago 2015832221  1117      95422  2221
jul 2015965421     5222   54322      
jun 2015622222     3221   522221 321 
mai 20155222221 11 7211   42222111111
abr 20156422211 11 5431122754211111  
mar 20151243222  11 321  1133333112211
fev 2015544322  11 6411   83222111111
jan 20159222221 11 5321   7332211111 
dez 20145222211 1  22221  222221111  
nov 20144332221 1117321   63222      
out 201410632221111 322211 6222211    
set 2014611111  1116221   82111  111 
ago 2014521111  211       94222  431 
jul 20141197421  11 421    1133221 11  
jun 2014721111  11 1      71111  221 
mai 2014532111  11 21   1 52111  21  
abr 201411331111 11 321    1022111111  
mar 2014855431  11 422    1154221 111 
fev 2014843211  11 3      61111  332 
jan 2014832211  11 31     114431  331 
out 2015522221  11 421    622221 3221
jul 2015965421     5222   54322      
abr 20156422211 11 5431122754211111  
jan 20159222221 11 5321   7332211111 
out 201410632221111 322211 6222211    
jul 20141197421  11 421    1133221 11  
abr 201411331111 11 321    1022111111  
jan 2014832211  11 31     114431  331 
out 2013743111  111211    1053211 22  
jul 2013652221  11 422  111254321 44  
abr 20131465331  11 311  1 12633311431 
jan 2013731111  11        21111  331 
out 20121166211  11 422    95211  221 
jul 20121154321  1  62222  1242222111  
abr 2012732211  11 32     63321  11  
jan 20125624149621 1116331   16764332321 
out 2011632111  11 2      112211  33  
jul 20115222      1      124211  41  
abr 20111222111  111311    134211  211 
jan 20111064111  11 2      1353111142  
out 20101154211  1116221   1243211153  
jul 201041              41         
abr 2010822              1353        
jan 20101431       1042    22852       
out 2009932       72     127651      
jul 200963211     11     105421  1   
abr 200942    11 1      841    221 
jan 200914411      111    93321      
out 200853211     2111 1 1044111     
jul 20081032              10321   1   
abr 20084               53         
jan 200831111     3      133111      
out 2007321       1      11311       
jul 20076111      1      8541   11  
abr 20078322      3111   178631      
jan 20078111      3      2010532      
out 20069662      32     216432      
jul 200610754      7551   1063321 11  
abr 200621              115521      
jan 2006                113         
out 2005411              811        

 

Distribuição de edições de artigos por wikinoticiaristas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikinoticiaristasEdições total
1348100.0%20,272100.0%
314541.7%19,94998.4%
107220.7%19,52796.3%
32298.3%18,75292.5%
100154.3%17,94188.5%
31651.4%16,19479.9%
100020.6%14,73572.7%
316220.6%14,73572.7%
1000010.3%10,07149.7%

 

5 wikinoticiaristas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions
agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
GrondinUC1 010,0711117,57819abr 21, 201020791,55417--
Syum90UC2 04,664444,05379out 01, 20144552464--
VriullopUC15 01131384-jul 04, 200634665---
PitxiquinUC32+42281994jul 18, 201453032--
AmadalvarezUC46...20207-dez 29, 20151----

 

20 wikinoticiaristas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
AljulluUC3580mai 26, 20063505set 10, 20121206
Joan301009UC4547dez 18, 20111473set 05, 2014481
DavidparUC5332nov 16, 20072966jul 19, 2014529
Manlleus~cawikinewsUC6306out 19, 20063359jun 07, 20073128
PaucabotUC7220out 12, 20063366out 30, 201561
JaumeBGUC8207fev 19, 20111775ago 19, 2014498
BestiasonicaUC9174set 16, 20082661dez 02, 2013758
PepetpsUC10170out 23, 20053720set 05, 20082672
ÉricoUC11170mai 14, 20121325nov 02, 20121153
SMPUC12149abr 21, 20063540jan 02, 2014727
Mattho69UC13122abr 16, 2013988jun 30, 2015183
ArnaugirUC14116mar 23, 20111743jul 31, 2015152
MartorellUC1697out 23, 20053720dez 18, 20101838
KippelboyUC1792set 28, 20111554set 24, 201597
1l2UC1880dez 12, 20101844abr 20, 20111715
CommonsDelinkerUC1969mai 14, 20073152nov 29, 201531
GyrostatUC2061dez 26, 20111465nov 30, 201530
IndependènciaUC2160ago 10, 20082698jul 12, 2015171
Albertsab~cawikinewsUC2257ago 24, 20063415mai 08, 20073158
TownieUC2357ago 08, 20111605jul 23, 20121255

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 438 edições foram feitas por usuários anônimos, de um total de 25760 edições ( 1e %)
  


22 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
GrondinBotUC13,446out 11, 20092271dez 26, 201544759
DexbotUC2994ago 26, 2014491ago 30, 2014487--
YiFeiBotUC3403ago 08, 2015144nov 26, 201534--
BOT-SuperzerocoolUC487abr 10, 20092455jul 28, 2014520--
KamikazeBotUC530dez 17, 20111474dez 18, 20111473--
MjbmrbotUC616nov 17, 20101869mar 27, 20111739--
VolkovBotUC713jun 29, 20092375fev 17, 20131046--
タチコマ robotUC812fev 28, 20082862fev 28, 20082862--
JAnDbotUC97fev 03, 20092521out 03, 2013818--
Iradigalesc BotUC104jun 08, 20082761jan 30, 20092525--
ZéroBotUC114jan 14, 20121446set 11, 20121205--
ArthurBotUC123ago 06, 20092337abr 24, 20111711--
Diego Grez BotUC133mai 28, 20102042jun 05, 20102034--
AKBotUC143fev 07, 20121422fev 14, 20121415--
AlexbotUC152fev 08, 20082882jan 27, 20092528--
MerlIwBotUC162jul 12, 20111632out 13, 20111539--
AvocatoBotUC172set 15, 20121201mai 06, 2013968--
LaaknorBotUC181jun 16, 20102023jun 16, 20102023--
MerlLinkBotUC191fev 04, 20111790fev 04, 20111790--
AmirobotUC201mar 13, 20111753mar 13, 20111753--
CarsracBotUC211jan 21, 20121439jan 21, 20121439--
BotReversorUC221out 13, 2014443out 13, 2014443--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110
dez 20153,3 k551114 3751,2 k54,1 k11136     
nov 20153,3 k546114 3751,2 k53,7 k11136     
out 20153,3 k544113 3751,2 k53,7 k11135     
set 20153,2 k542112 3721,2 k53,7 k11135     
ago 20153,2 k542110 3691,2 k53,6 k11135     
jul 20153,2 k538110 3661,2 k53,6 k11135     
jun 20153,1 k537110 3651,2 k53,6 k11135     
mai 20153,1 k536107 3621,2 k53,5 k11135     
abr 20153,0 k536103 3621,1 k53,5 k11135     
mar 20152,9 k532102 3601,1 k53,5 k11135    372
fev 20152,9 k52999 3571,0 k53,4 k11135    313
jan 20152,8 k52494 35589643,3 k11135    551
dez 20142,8 k52281 33882243,3 k11129    779
nov 20142,7 k52256 33472233,2 k11129    722
out 20142,6 k51856 33471533,2 k11129    1435
set 20142,5 k51755 33466633,2 k11129    160
ago 20142,5 k51355 33466633,1 k11129    111
jul 20142,5 k50855 33466533,1 k11129    259
jun 20142,4 k50655 33466233,1 k11129    139
mai 20142,4 k50455 33465933,0 k11124    135
abr 20142,3 k50355 33465933,0 k11124    377
mar 20142,3 k49955 33465732,9 k9124    290
fev 20142,2 k49355 33464032,8 k9120    162
jan 20142,2 k48955 33463932,8 k9120    175
dez 20132,1 k48155 33463632,8 k9112    151
nov 20132,1 k48154 33463632,7 k9112    211
out 20132,0 k47754 33362832,7 k9112    255
set 20132,0 k47354 33362332,7 k9112    131
ago 20131,9 k46054 33362332,6 k9112    226
jul 20131,9 k45754 33361832,5 k9112    252
jun 20131,8 k45154 33360232,5 k9111    171
mai 20131,8 k44854 33359832,3 k9111    274
abr 20131,8 k44654 33059532,3 k9111    266
mar 20131,7 k44054 33059132,2 k9107    238
fev 20131,7 k43254 33058432,1 k998    138
jan 20131,6 k42454 33058132,1 k990    149
dez 20121,6 k42353 33058032,1 k986    169
nov 20121,5 k41853 33057732,0 k986    204
out 20121,5 k41753 32857532,0 k985    232
set 20121,4 k41353 32757332,0 k980    519
ago 20121,4 k40853 32657131,9 k979    255
jul 20121,3 k40353 32656931,8 k964    260
jun 20121,3 k39853 32555031,8 k949    249
mai 20121,3 k38853 32554131,6 k940    360
abr 20121,2 k38153 30953631,6 k924    199
mar 20121,1 k37653 30953431,6 k924    235
fev 20121,1 k37553 30953231,4 k924    326
jan 20121,0 k36552 30952031,4 k923    778
dez 201195935248 30948831,2 k917    394
nov 201192034548 30946931,1 k917    141
out 201190133048 30946731,1 k917    134
set 201188332548 30946731,1 k917    216
ago 201184332048 30946731,1 k916    53
jul 201183631448 30946731,0 k916    38
jun 201183230448 30946731,0 k915    96
mai 201182230148 30646231,0 k915    172
abr 201179929648 3064613999915    197
mar 201177628748 3064593965915    469
fev 201172028547 3064493898915    277
jan 201169627744 3034333872915    222
dez 201067527144 3014333839912    141
nov 201066026943 3014332816911    207
out 201064126643 3014282788810    196
set 201062125943 301407276987    188
ago 201059724943 301393274885    83
jul 201059223243 301384273074    7
jun 201059123243 301384273074    57
mai 201058821843 301382270374    20
abr 201058521441 301379270174    21
mar 201058220841 301372269974    11
fev 201058220541 301369269974    19
jan 201058120341 301369269954    34
dez 200957419041 301366269054    9
nov 200957418541 301363269054    19
out 200957418541 301362269053    30
set 200956218241 301360267853    12
ago 200956117541 301360267853    126
jul 200955517441 301359266953    41
jun 200955115041 296350266053    29
mai 200954315041 296349266053    15
abr 200953714641 296347264253    9
mar 200953613241 296346264253    7
fev 200953612941 296341264253    4
jan 200953512441 296339264252    53
dez 200852412441 296335262742    20
nov 200852212341 296332262542    23
out 200851711041 294327262242    95
set 20084829741 294311258142    47
ago 20084729441 294310257541    55
jul 20084619141 294306256531    25
jun 20084589141 29430525633     13
mai 20084578441 29430425632     14
abr 20084568241 29430425602     5
mar 20084558141 29430425602     46
fev 20084467441 29230425472     44
jan 20084367041 29230025382     34
dez 20074256641 29129725222     23
nov 20074166141 29129625102     43
out 20074086041 29129625042     13
set 20074055340 29129524982     19
ago 20074025140 29129324892     35
jul 20074015140 29129124892     20
jun 20073964640 29128924832     40
mai 20073824340 29128424742     73
abr 20073524140 28928424342     48
mar 20073374140 28928323982     156
fev 20072774140 28927723591     268
jan 20071623339 28922623161     27
dez 20061513137 28221923091     51
nov 20061372837 28021422871     51
out 20061192635 28020912571     60
set 20061052433 27920412241     47
ago 2006882333 26719412051     43
jul 2006712131 25918811721     92
jun 2006561930 18218011521     201
mai 2006221315  1261851     91
abr 20063 1  68111     4
mar 20063 1  68111      
fev 20063 1  58111     5
jan 20063 1  561 1      
dez 20053 1  541 1      
nov 20053 1  501        
out 20053    431        
set 20053    381        
ago 20052    341        

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

ago 2005: 1 1 Indicació d'idioma

set 2005: 1 1 Vint mil articles en català

out 2005: 1 4 Vint mil articles en català

nov 2005: 1 8 Vint mil articles en català

dez 2005: 1 2 Indicació d'idioma

fev 2006: 1 2 Indicació d'idioma

abr 2006: 1 2 Indicació d'idioma

mai 2006: 1 5 Portada , 2 3 Podria disputar-se un partit de futbol Catalunya-Euskadi , 3 3 Gran terratrèmol a l'illa de Java , 4 3 Google Video i el Barça firmen un acord , 5 2 Uribe és reelegit president de Colòmbia

jun 2006: 1 4 Portada , 2 4 S'aprova en el referèndum la proposta d'estatut d'autonomia per a Catalunya , 3 4 Més de 30 mil persones es manifesten a València en defensa del territori , 4 3 Es debat a Barcelona la tercera versió de la llicència GNU , 5 3 Maragall anuncia que no es presentarà a la reelecció , 6 3 Alemanya venç a Costa Rica a l'inici de la Copa Mundial d'Alemanya 2006 , 7 3 Mor el cap d'Al-Qaida a l'Iraq , 8 3 Comença la campanya electoral del referèndum sobre el nou Estatut català , 9 3 Rocío Jurado mor als 61 anys , 10 2 Ocupació del nou Centre d'Internament a la Zona Franca

jul 2006: 1 5 Un comboi descarrila causant 41 morts al metro de València , 2 5 Ocupació del nou Centre d'Internament a la Zona Franca , 3 3 Portada , 4 3 Grip aviària: ha estat trobat un cabussot mort a Espanya , 5 2 El Papa Benet XVI visita València per la Trobada Mundial de les Famílies , 6 2 El Papa Benet XVI visita València per la Trobada Mundial de la Família catòlica

ago 2006: 1 3 Els embassaments valencians esgotaran l'aigua potable en dotze dies , 2 3 Projectes d'atemptats han sigut descoberts per la policia britànica , 3 2 Se signa la Declaració de la Riera d'Argentona , 4 2 Lopez Obrador no reconeix la victòria de Calderón i anuncia formar un govern paral·lel a Mèxic , 5 2 Plutó ja no es un planeta

set 2006: 1 3 Michael Schumacher anuncia que es retira , 2 2 Revolució a la borsa impulsada per la compra d'accions de les companyies elèctriques , 3 1 Portada

out 2006: 1 3 Portada , 2 3 Orhan Pamuk, premi Nobel de Literatura 2006 , 3 2 En , 4 2 Lula, nou president del Brasil , 5 1 Se signa la Declaració de la Riera d'Argentona

nov 2006: 1 4 Jornada electoral a Catalunya , 2 2 Portada , 3 2 Debat d'investidura de José Montilla , 4 1 En

dez 2006: 1 4 Saddam Hussein, penjat a la forca , 2 4 Explosió a l'aeroport de Madrid , 3 1 En

jan 2007: 1 3 L'Atlàntida presenta un concert de gralla i piano, amb Josep Sentmartí i Jordi Vila , 2 2 La Viquipèdia en català arriba als 50.000 articles , 3 1 Mida

fev 2007: 1 3 Portada , 2 2 Es desploma el sostre d'un supermercat a la República Txeca , 3 2 La caiguda del sostre d'una pista de patinatge mata a 14 persones a Alemanya , 4 2 El pilot britànic de Fórmula 1 Jenson Button surt il·lès d'un accident en el circuit de Monza , 5 2 El president de la FIFA no descarta la candidatura de Colòmbia per a la seu del Mundial de 2014 , 6 2 La FIFA aixeca restriccions de publicació d'imatges del Mundial d'Alemanya a la web , 7 2 Brasil pot perdre seu del Mundial de futbol de 2014 , 8 1 En

mar 2007: 1 5 Agustí Cerdà, candidat d'ERPV a la Generalitat Valenciana , 2 2 Surt a la venda la PlayStation 3 , 3 2 'Crisi d'estat', segons Benach si el Constitucional retalla l'estatut , 4 2 Raimon es queixa del maltracte que rep del govern valencià , 5 2 Acusen a Chávez d'antisemitisme en el seu discurs nadalenc , 6 2 Teheran realitza una conferència sobre l'Holocaust , 7 2 Montilla presenta les prioritats del govern amb el Pla de Govern 2007-2010 , 8 1 Referències

abr 2007: 1 2 BMW Sauber presenta el seu primer Fórmula 1 , 2 2 Llançament de Debian GNU/Linux 4.0 , 3 2 \"La condició per veure TV3 al País Valencià no és raonable\" , 4 2 Avaria de l'ADSL de Telefónica deixa sense servei a milers d'usuaris a Espanya , 5 1 Referències

mai 2007: 1 3 Les dues cares del conflicte israelo-palestí en dos videojocs , 2 3 Massiva manifestació a València amb el lema \"1707 - 2007 Ja n'hi ha prou!\" , 3 2 Fianna Fáil guanya les eleccions legislatives a Irlanda , 4 2 Benet XVI canonitza al primer sant brasiler , 5 1 El Nàstic, equip de segona

jun 2007: 1 2 ETA dóna per finalitzat l'alto al foc , 2 1 L'Atlàntida presenta un concert de gralla i piano, amb Josep Sentmartí i Jordi Vila

jul 2007: 1 2 La Generalitat i el govern espanyol desencallen el traspàs de la rodalia de Renfe de Barcelona , 2 1 Coord

ago 2007: 1 4 Coord , 2 2 Saïda Saddouki denuncia la Guàrdia Civil per per discriminació lingüística

set 2007: 1 3 Saïda Saddouki denuncia la Guàrdia Civil per per discriminació lingüística

out 2007: 1 1 Vint mil articles en català

nov 2007: 1 3 Trekorientació, la cursa d'orientació popular de la Conca de Barberà , 2 2 Trànsit proposa endurir l'examen del carnet de conduir per a motos de gran cilindrada arran de l'elevada sinistralitat , 3 2 El restabliment de la línia C-2 supera amb normalitat l'hora punta del primer dia laborable , 4 1 Coord

dez 2007: 1 2 Air Tiurana començarà a operar el 29 de febrer , 2 1 Empat al partit Euskal Herria-Catalunya

jan 2008: 1 2 La NASA hauria descobert el desè planeta del sistema solar , 2 1 Infotaula accident aeri

fev 2008: 1 1 Infotaula accident aeri

mar 2008: 1 2 Assassinat l'ex-regidor Isaías Carrasco al País Basc , 2 1 Portada

abr 2008: 1 1 Saïda Saddouki denuncia la Guàrdia Civil per per discriminació lingüística

mai 2008: 1 2 Les FARC demanen participació més activa en el Foro de São Paulo , 2 2 La nau Voyager I abandona el sistema solar , 3 1 Infotaula accident aeri

jun 2008: 1 2 Trekorientació, la cursa d'orientació popular de la Conca de Barberà , 2 2 Michael Schumacher anuncia que es retira , 3 1 Indicació d'idioma

jul 2008: 1 3 Els Mossos d'Esquadra desallotgen el Kasal Okupat del Prat , 2 2 Referències

ago 2008: 1 4 Trobada Alternativa de Nou Barris , 2 3 Neix La Nostra TV, un programa amb la voluntat d'aplegar tots els canals televisius en català , 3 2 Mida

set 2008: 1 3 Cessen les emissions de Televisió Pla de l'Estany , 2 3 Google llança el seu navegador web , 3 2 Trobada Alternativa de Nou Barris , 4 2 Neix La Nostra TV, un programa amb la voluntat d'aplegar tots els canals televisius en català , 5 1 Referències

out 2008: 1 2 S'estrena el musical Retaule de la llum, que commemora el centenari de la creació de l'Orfeó Manresà , 2 1 Referències

nov 2008: 1 4 Un trasplantament de medul·la òssia, potencialment relacionat amb el restabliment d'un pacient amb SIDA , 2 2 La FIFA aixeca restriccions de publicació d'imatges del Mundial d'Alemanya a la web , 3 1 Saïda Saddouki denuncia la Guàrdia Civil per per discriminació lingüística

dez 2008: 1 3 Futbol:FC Barcelona - TS Wisła Kraków (13-08-2008) , 2 1 Referències

jan 2009: 1 4 Itàlia: Naufragi del vaixell Costa Concordia , 2 3 Catalunya: s'ha obert la variant sud de Lleida , 3 2 Un bombardeig israelià va matar un líder de Hamàs , 4 1 Es crea el Manifest Basset-Bausset

fev 2009: 1 2 Mida , 2 1 Moure a Viquinotícies

mar 2009: 1 2 Vint mil articles en català , 2 1 Saïda Saddouki denuncia la Guàrdia Civil per per discriminació lingüística

abr 2009: 1 1 Cessen les emissions de Televisió Pla de l'Estany

mai 2009: 1 3 Noruega guanya el Festival d'Eurovisió de 2009 , 2 2 Itàlia: Naufragi del vaixell Costa Concordia , 3 2 El Barça guanya la Lliga de Campions davant el Manchester United , 4 1 Ifempty

jun 2009: 1 3 Neix Huubs, un cercador de notícies en català , 2 2 Desenes de milers de persones es manifesten a Bilbao en defensa de la llibertat i en repulsa del darrer atemptat mortal d'ETA d'ahir divendres , 3 1 Referències

jul 2009: 1 1 Neix Huubs, un cercador de notícies en català

ago 2009: 1 2 Coord

set 2009: 1 1 Infotaula

out 2009: 1 3 Descobreixen 32 planetes extrasolars amb l'HARPS , 2 3 Mor el cantant argentí Luis Aguilé , 3 2 Es presenta el projecte Parelles Lingüístiques Transfrontereres , 4 2 El TSJIB assumeix el cas Ca'n Domenge

nov 2009: 1 2 Es presenta el projecte Parelles Lingüístiques Transfrontereres

dez 2009: 1 1 Es crea el Manifest Basset-Bausset

jan 2010: 1 4 L'ajuntament de Vic ha decidit no empadronar als immigrants il·legals, llevant-los l'accés a l'educació i la salut , 2 3 Manifestació del 30 de desembre de 2009 , 3 2 Vic , 4 1 L'Atlàntida presenta un concert de gralla i piano, amb Josep Sentmartí i Jordi Vila

fev 2010: 1 6 Arrestat l'alcalde de Pichilemu Jorge Vargas , 2 1 Infotaula

mar 2010: 1 1 En

abr 2010: 1 3 Arrestat l'alcalde de Pichilemu Jorge Vargas , 2 3 L'erupció d'un volcà a Islàndia causa l'aturada dels avions a mitja Europa

mai 2010: 1 2 El món sobre rodes , 2 1 Referències

jun 2010: 1 6 La Viquipèdia en català arriba als 250.000 articles , 2 4 El món sobre rodes , 3 2 El vaixell irlandès Rachel Corrie intenta arribar a Gaza , 4 1 Es crea el Manifest Basset-Bausset

jul 2010: 1 1 Arrestat l'alcalde de Pichilemu Jorge Vargas

ago 2010: 1 2 Cessen les emissions de Televisió Pla de l'Estany , 2 1 Referències

set 2010: 1 3 LIP3DUB, el primer lip dub en 3D de l'Estat Espanyol , 2 3 Els sindicats espanyols convoquen una vaga general pel 29-S , 3 2 Es ratifica el Compromís Municipal Sobiranista de Sant Pere de Rodes , 4 2 Campionat de França de rugbi Pro D2 2010-2011: els resultats del segon dia

out 2010: 1 3 Infotaula , 2 2 Saïda Saddouki denuncia la Guàrdia Civil per per discriminació lingüística , 3 2 Volta a Tarragona de 2007 , 4 2 França: mor el president Georges Frêche

nov 2010: 1 2 Se signa la Declaració de la Riera d'Argentona , 2 2 S'estrena \"Illa de Xàtiva\", un documental sobre les Comarques Centrals del País Valencià , 3 2 Allau humana del Festival de l'Aigua a Cambodja , 4 2 Tests matxs de la tardor del 2010: els resultats del quart dia , 5 2 Nicolas Sarkozy : semblaria que vostè fos pedòfil

dez 2010: 1 3 Mort de Leslie Nielsen , 2 2 La Fundació PuntCat aporta 20.000€ per al desenvolupament del pla estratègic de la Viquipèdia , 3 2 Copa d'Europa de rugbi a 15 2010-2011: els resultats del quart dia , 4 2 Atemptat suïcida a Suècia , 5 1 Es ratifica el Compromís Municipal Sobiranista de Sant Pere de Rodes

jan 2011: 1 3 Dret francès: els enregistraments sonors en dret civil i mercantil , 2 2 Al-Baradei encapçala l'Egipte contra el president Mubàrak , 3 2 Handbol: França és campiona del món per quarta vegada , 4 2 Campionat de França de rugbi 2010-2011: els resultats del dissetè dia , 5 2 Espanya: per primera vegada s'ha parlat en català al Senat , 6 2 França: Marine Le Pen succeix al seu pare al cap del Front nacional , 7 1 Referències

fev 2011: 1 3 Mor el cantant nord català Jordi Barre , 2 3 Campionat del Super 15 de rugbi a 15 2011: els resultats de la primera jornada , 3 3 Campionat de França de rugbi 2010-2011: els resultats del divuitè dia , 4 2 Poseu-me les ulleres, un espectacle biogràfic sobre l'obra i vida de Vicent Andrés Estellés , 5 2 Campionat del Super 15 de rugbi a 15 2011: els resultats de la segona jornada , 6 2 Mor el prestigiós cuiner Santi Santamaria , 7 1 Portada

mar 2011: 1 4 L'OTAN pren el control de la zona d'exclusió aèria de Líbia , 2 3 Hedoi Etxarte i Alain M. Urrutia publiquen \"La bella fugida\" , 3 3 L'Atlàntida presenta un concert de gralla i piano, amb Josep Sentmartí i Jordi Vila , 4 3 Torneig de les Sis Nacions 2011: els resultats de la cinquena jornada , 5 3 L'ICANN aprova el domini .xxx per pornografia , 6 3 45 morts després de dispars contra manifestants iemenites , 7 3 El consell de seguretat de l'ONU aprovà la zona d'exclusió aèria a Líbia , 8 2 LIP3DUB, el primer lip dub en 3D de l'Estat Espanyol , 9 2 Qatar es converteix en primer país àrab en fer volar avions de combat per sobre de Líbia , 10 2 Nova Zelanda entra en semifinals mentre que Sud-àfrica torna a fallar a la Copa del Món de criquet masculí , 11 2 Japó eleva el nivell de gravetat de la crisi, els esforços per refredar la malmesa central d'energia nuclear continuen , 12 2 Home acusat d'assassinat d'una dona britànica a Hong Kong , 13 2 Campionat del Super 15 de rugbi a 15 2011: els resultats de la sisena jornada , 14 2 Mor el linguïsta francès Jacques Capelovici

abr 2011: 1 3 L'Atlàntida presenta un concert de gralla i piano, amb Josep Sentmartí i Jordi Vila , 2 2 Infotaula , 3 2 Mor l'actriu francesa Marie-France Pisier , 4 2 Campionat del Super 15 de rugbi a 15 2011: els resultats de la vuitena jornada , 5 2 Un empresari fuig i deixa desamparats als seus treballadors , 6 1 Hedoi Etxarte i Alain M. Urrutia publiquen \"La bella fugida\"

mai 2011: 1 4 El FC Barcelona guanya la Copa de la Lliga de Campions UEFA de la temporada 2010-2011 , 2 2 Campionat de la Lliga cèltica de rugbi 2010-2011: els resultats de la vint-i-dosena jornada , 3 2 Campionat del Super 15 de rugbi a 15 2011: els resultats de la dotzena jornada , 4 1 Hedoi Etxarte i Alain M. Urrutia publiquen \"La bella fugida\"

jun 2011: 1 3 Saïda Saddouki denuncia la Guàrdia Civil per per discriminació lingüística , 2 2 Mor l'actor Peter Falk , 3 2 Catalunya participarà a la Copa del Món de Touch Rugbi , 4 2 Campionat del Super 15 de rugbi a 15 2011: els resultats de la divuitena jornada

jul 2011: 1 2 El món sobre rodes , 2 1 S'estrena \"Illa de Xàtiva\", un documental sobre les Comarques Centrals del País Valencià

ago 2011: 1 5 Tanca la Televisió d'Ontinyent , 2 2 Poseu-me les ulleres, un espectacle biogràfic sobre l'obra i vida de Vicent Andrés Estellés , 3 2 Es pot consultar Atsotitzak per Internet , 4 1 Hedoi Etxarte i Alain M. Urrutia publiquen \"La bella fugida\"

set 2011: 1 3 Neix Tanatopedia, la primera enciclopèdia virtual col·laborativa sobre el món funerari , 2 3 Copa del Món de rugbi a 15 2011: els resultats de la segona jornada , 3 2 Copa del Món de rugbi a 15 2011: els resultats de la quarta jornada , 4 1 L'Atlàntida presenta un concert de gralla i piano, amb Josep Sentmartí i Jordi Vila

out 2011: 1 3 Copa del Món de rugbi a 15 2011: els All Blacks campions del món , 2 3 Copa del Món de rugbi a 15 2011: França classificada per la final , 3 2 Campionat de França de rugbi Pro D2 2011-2012: els resultats de la sisena jornada , 4 2 Copa del Món de rugbi a 15 2011: França i Gal·les jugaran la semifinal , 5 2 Copa del Món de rugbi a 15 2011: els resultats de la vintena jornada , 6 1 Neix Tanatopedia, la primera enciclopèdia virtual col·laborativa sobre el món funerari

nov 2011: 1 3 Es pot consultar Atsotitzak per Internet , 2 2 França: mor la vídua de l'antic president François Mitterrand , 3 2 Estats Units: el conflicte entre els jugadors i l'NBA es torna virulent , 4 2 Estats Units: l'NBA manté el locaut després el fracàs de les últimes negociacions , 5 1 Es crea el Manifest Basset-Bausset

dez 2011: 1 5 Mor el dictador nord-coreà Kim Jong-il , 2 4 La vaga dels agents de seguretat dels aeroports acaba , 3 4 Mor la cantora capverdiana Cesária Évora , 4 4 El Canadà tanca al calaix el Protocol de Kyoto , 5 4 Mèxic: un terratrèmol de magnitud 6,7 mata almenys tres persones , 6 3 Neix Huubs, un cercador de notícies en català , 7 3 Una quarta part dels béns històrics de la Xina estan mal conservats , 8 3 Brasil esdevé la sisena economia en el món , 9 3 Campionat de França de rugbi 2011-2012: els resultats de la tretzena jornada , 10 2 L'Atlàntida presenta un concert de gralla i piano, amb Josep Sentmartí i Jordi Vila , 11 2 El món sobre rodes , 12 2 Estats Units: creixement de l'atur durant el mes de desembre de 2011 , 13 1 Vuit ferits en incendiar-se un avió a l'aeroport de París-Orly

jan 2012: 1 41 Itàlia: Naufragi del vaixell Costa Concordia , 2 8 Comunicat de la Comunitat Viquipèdia , 3 5 Els Mossos d'Esquadra desallotgen el Kasal Okupat del Prat , 4 5 Dos policies brasilers han estat sancionats després d'agredir un estudiant de la Universitat de São Paulo , 5 4 Cessen les emissions de Televisió Pla de l'Estany , 6 3 França: Desaparicions misterioses dels gats a Costa d'Or , 7 3 Vallès Visió comença a emetre de forma regular , 8 3 Copa del Rei 2011-2012: el Barça derrota el Real Madrid al partit d'anada dels quarts de final , 9 3 Viquinotícies en català supera les 1000 pàgines , 10 3 Mor el president de Guinea Bissau, Malam Bacai Sanhá , 11 3 Neix La Nostra TV, un programa amb la voluntat d'aplegar tots els canals televisius en català , 12 3 El Barça guanya 4-0 a l'anada de la copa contra l'Osasuna , 13 3 Il·lustradors de Llotja faran pràctiques professionals amb Amical Viquipèdia , 14 3 Xavi Hernández ha estat elegit per quart cop consecutiu millor cradeor de joc del món , 15 3 Condemnats per no afrontar els riscos de pluja , 16 3 Al-Jazeera comença a emetre en anglès , 17 2 Poseu-me les ulleres, un espectacle biogràfic sobre l'obra i vida de Vicent Andrés Estellés , 18 2 El món sobre rodes , 19 2 Arrestat l'alcalde de Pichilemu Jorge Vargas , 20 2 Neix Huubs, un cercador de notícies en català , 21 2 Neix Tanatopedia, la primera enciclopèdia virtual col·laborativa sobre el món funerari , 22 2 Tanca la Televisió d'Ontinyent , 23 2 Trobada Alternativa de Nou Barris , 24 2 Djokovic supera a Murray i jugarà contra Nadal en la final de l'Open d'Austràlia , 25 2 França: els policies treballant a la frontera s'hauran de pagar l'autopista

fev 2012: 1 4 Mor el pintor català Antoni Tàpies , 2 4 Rugbi a 15: Sébastien Chabal es troba sense club , 3 3 Apareix Lajornada.cat, un nou diari digital esportiu en català , 4 3 Campionat d'Espanya de futbol 2011-2012: els resultats de la vint-i-dosena jornada , 5 2 Campionat del Super 15 de rugbi a 15 2012: els resultats de la primera jornada , 6 2 Campionat de França de futbol de lliga 2 2011-2012: empat entre Tours i Le Havre , 7 2 Lliga de Campions de la UEFA 2011-2012: el Barça derrota fora el Bayer Leverkusen , 8 2 Estats Units: guanya Mitt Romney en les primàries republicanes de Maine , 9 2 Torneig de les Sis Nacions 2012: el partit entre França i Irlanda tindrà lloc com era previst , 10 2 Copa del Rei 2011-2012: el Barça i l'Athletic Club jugaran la final , 11 2 Estats Units: en les primàries del Partit Republicà a Colorado i Minnesota surt victoriós Rick Santorum , 12 1 Catalunya: s'ha obert la variant sud de Lleida

mar 2012: 1 2 Puntdecimal , 2 2 Campionat de França de rugbi 2011-2012: el Racing Metro venç el Castres Olympique , 3 2 Catalunya del Nord en situació de vigilància per la sequera , 4 2 França: el fundador del GIGN critica l'acció del RAID , 5 2 Feredat a la ciutat de Tolosa de Llenguadoc , 6 2 Torneig de les Sis Nacions 2012: el País de Gaŀles guanya el Gran Slam , 7 2 Illes Balears: una vaga de fam per a la defensa del català , 8 2 Rick Santorum guanya en les primàries de Kansas , 9 2 Lliga de Campions 2012: el Barça classificat per a les quarts de final

abr 2012: 1 3 La nacionalització d'YPF pel govern argentí crea polèmica , 2 3 Rick Santorum es retira de la carrera presidencial estatunidenca , 3 2 Es presenta l'assaig «Descoberta i conquesta catalana d'Amèrica» , 4 2 Lliga de Campions 2012: el Barça es classifica per a les semifinals , 5 1 Campionat de França de futbol de lliga 1 2011-2012: els resultats de la trenta-quatrena jornada

mai 2012: 1 4 Eleccions presidencials franceses del 2012: François Hollande és el setè president de la Cinquena República , 2 3 França : Jean-Marc Ayrault nomenat Primer ministre , 3 3 Es presenta l'assaig «Descoberta i conquesta catalana d'Amèrica» , 4 2 S'estrena 10 cites a Televisió de Catalunya , 5 2 El bo espanyol, lluny dels nivells d'intervenció de Grècia i Portugal , 6 2 El foc de Rasquera ja ha cremat 2.400 hectàrees , 7 2 El català Manuel Valls, ministre d'Interior francès , 8 2 Rajoy torna a demanar ajuda a Europa , 9 2 País Valencià: el PSPV proposa Carles Santos pel Consell de Cultura , 10 1 S'estrena \"Illa de Xàtiva\", un documental sobre les Comarques Centrals del País Valencià

jun 2012: 1 3 Android GingerBread , 2 3 Espanya: Ajuntament Impulsa, un web per a ajudar els ajuntaments del país , 3 3 França: mor el periodista esportiu Thierry Roland , 4 2 Copa d'Europa de futbol 2012: Laurent Blanc deixa la seva funció de seleccionador dels “Bleus” , 5 2 Finalitza el Campionat del món sots16 de corfbol 2008 , 6 2 Unió Europea: fi de la independència pressupostària dels estats , 7 2 Egipte: Hosni Mubàrak cau en coma , 8 2 El PASOK anuncia per demà un govern de coalició amb Nova Democràcia , 9 2 Quebec: un espectacle audiovisual per a la commemoració dels naufragis del Titanic i de l'Empress of Ireland , 10 2 Rajoy insisteix a defensar la solidesa de l'economia espanyola , 11 2 Bauzá, reelegit president del PP balear

jul 2012: 1 3 Catalunya: l'Alt Empordà és víctima de les flames , 2 3 El Parlament europeu rebutja el projecte ACTA , 3 3 Copa d'Europa de futbol 2012: Espanya humilia Itàlia a la final , 4 3 Espanya: Ajuntament Impulsa, un web per a ajudar els ajuntaments del país , 5 2 Murdoch dimiteix de la branca britànica del seu imperi , 6 2 Google amplia el seu museu virtual , 7 2 Microsoft presenta el competidor de l'iPad , 8 2 La UE prendrà competències al govern espanyol i tutelarà el Banc d'Espanya , 9 2 Twitter confirma de forma oficial que a partir de demà dijous serà també en català , 10 1 Es presenta el projecte Parelles Lingüístiques Transfrontereres

ago 2012: 1 6 Catalunya: més d'un milió de persones manifesten a favor de la independència , 2 4 El CE Vilanova i la Geltrú guanya la Copa Catalunya de corfbol 2012 , 3 2 Breivik, condemnat a vint-i-un anys de presó prorrogables , 4 2 Exemples de mala gestió i de maniobres irregulars a RTVV , 5 2 El CK Vallparadís guanya la seva primera Copa Catalana , 6 2 El Vacarisses guanya la copa Catalana 2008 , 7 2 El CK Vacarisses es fa amb la seva quarta Copa Catalana , 8 2 El CEVG guanya la seva primera Copa de corfbol , 9 2 El CE Vilanova i la Geltrú guanya la Copa Catalunya de corfbol 2011 , 10 1 Portada

set 2012: 1 30 Catalunya: més d'un milió de persones manifesten a favor de la independència , 2 3 Unió europea: Barroso es declara en pro d'un federalisme europeu , 3 2 Salut: els OGM podrien augmentar el risc de càncer , 4 2 Quebec: l'SHMP continuarà assegurant la gestió del far de Pointe-au-Père l'any 2013 , 5 2 Comença l'extracció de combustible d'un petrolier enfonsat el 1937 als Columbrets , 6 2 Barcelona World, el projecte turístic alternatiu a Eurovegas , 7 2 Adelson anuncia que instal·larà Eurovegas a Madrid , 8 2 Algemesí celebra les festes de la Mare de Déu de la Salut , 9 1 Es ratifica el Compromís Municipal Sobiranista de Sant Pere de Rodes

out 2012: 1 3 França: l'estat s'oblida de pagar el sou d'uns quants soldats , 2 2 Ernest Maragall abandona el PSC i crea Nova Esquerra Catalana , 3 2 Catalunya: Mas, ignorat internacionalment? , 4 2 Canonització de Kateri Tekakwitha , 5 2 Descoberta d'un planeta extrasolar tenint 4 sols , 6 1 Es ratifica el Compromís Municipal Sobiranista de Sant Pere de Rodes

nov 2012: 1 2 La GIOrquestra s'estrena amb un concert a l'Auditori de Girona , 2 2 Tests matxs tardor 2012 : França derrota Austràlia per 33 à 6 , 3 2 Obama és reelegit com a President dels Estats Units , 4 2 Disney compra la productora de George Lucas i anuncia nous capítols de 'Star Wars' , 5 2 Abertis va guanyar mil milions fins al setembre, un 69% més

dez 2012: 1 3 28 morts en un tiroteig escolar a Connecticut , 2 2 Infotaula , 3 2 Ghana: l'actual president John Mahama guanya les eleccions presidencials , 4 2 Filipines: el tifó Bopha causa la mort a més de 300 persones

jan 2013: 1 3 Llançament oficial de Viquiviatges , 2 2 Ernest Maragall abandona el PSC i crea Nova Esquerra Catalana , 3 1 La GIOrquestra s'estrena amb un concert a l'Auditori de Girona

fev 2013: 1 1 Coord

mar 2013: 1 6 Veneçuela : mor el président Hugo Chávez , 2 4 Roma: Papa Francesc renta els peus de 12 reus durant la missa de Dijous Sant , 3 3 El col·legi cardenalici elegeix Jorge Mario Bergoglio com a nou papa , 4 2 Seu Vacant del 2013: el Col·legi Cardenalici entra en conclave avui , 5 2 Ciutat del Vaticà: és vacant la Santa Seu després de la renúncia de Benet XVI , 6 1 S'estrena \"Illa de Xàtiva\", un documental sobre les Comarques Centrals del País Valencià

abr 2013: 1 6 Atemptat de Boston: dos sospitosos identificats pel FBI , 2 4 Estats Units: 3 morts i més de 170 ferits a l'atemptat de Boston , 3 3 Teresa Forcades i Arcadi Oliveres promouen un manifest \"per un procés constituent a Catalunya\" , 4 2 El català té una gran capacitat d'atracció , 5 1 Saïda Saddouki denuncia la Guàrdia Civil per per discriminació lingüística

mai 2013: 1 3 Arriba al seu quart mes la vaga de gana de presos de Guantánamo , 2 2 Hedoi Etxarte i Alain M. Urrutia publiquen \"La bella fugida\" , 3 2 França: 68a. commemoració de l'armistici del 8 de maig del 1945

jun 2013: 1 5 Ciutat del Vaticà: el Papa Francesc apel·la a una reforma de la Cúria Vaticana , 2 2 Meka Whaitiri és proclamada guanyadora de l'elecció parcial d'Ikaroa-Rāwhiti a Nova Zelanda , 3 2 Sud-àfrica: Nelson Mandela es troba en estat crític , 4 1 Teresa Forcades i Arcadi Oliveres promouen un manifest \"per un procés constituent a Catalunya\"

jul 2013: 1 3 Egipte: més de setanta morts al Caire en les topades entre la policia i partidaris del president Mursi , 2 3 Tragèdia ferroviària a Galícia: 80 morts i 35 ferits crítics , 3 2 Campionat del Super 15 de rugbi a 15 2013: Els Chiefs i Brumbies disputaran la final , 4 2 País Valencià: el meteoròleg Jordi Payà s'acomiada de Canal 9 , 5 2 França: diversos morts en un accident de tren a prop de París , 6 2 Nova Zelanda: Pita Sharples dimiteix com a colíder del Partit Maori , 7 2 Catalunya: s'ha obert la variant sud de Lleida , 8 1 Quim Arrufat: “La corrupció és el sistema”

ago 2013: 1 2 Més de 150 persones inicien la Marxa per l’Educació Pública , 2 2 Els Estats Units van pagar a Facebook, Google, Yahoo i Microsoft per a espiar , 3 2 Estats Units: trenta-cinc anys de presó per a Bradley Manning , 4 2 El Madrid guanya 2-1 al Real Betis a la primera jornada de la Lliga , 5 2 El Barça guanya 7-0 al Levante UD a la primera jornada de la Lliga , 6 2 Estats Units: Obama anuncia reformes en els programes d'espionatge , 7 2 Illes Balears: la coalició Més denuncia que les destitucions de directors són il·legals , 8 2 Obama suspèn la reunió amb Putin després de les tensions pel cas Snowden , 9 1 Espanya: el batlle de Callosa escandalitza la premsa britànica per la “invasió” de Gibaltar

set 2013: 1 3 Catalunya: èxit de la Via Catalana , 2 2 Islàndia suspèn el procés d'adhesió a la Unió Europea , 3 1 Se signa la Declaració de la Riera d'Argentona

out 2013: 1 3 La NSA nega haver espiat els europeus , 2 2 Catalunya: manifestació important contra la Lomce , 3 2 Eleccions europees franceses del 2014: el Front Nacional al capdavant en un sondeig , 4 2 Eleccions presidencials franceses del 2012: els electors del Front Nacional cortejats , 5 1 Es presenta el projecte Parelles Lingüístiques Transfrontereres

nov 2013: 1 4 França: tiroteig a la seu del diari « Libération » , 2 2 Explosió a la planta West Fertilizer , 3 2 Romain Lannuzel segueix desparegut sis anys després , 4 2 Campionat d'Anglaterra de futbol 2013-2014: els resultats de la dotzena jornada , 5 2 Estats Units: s'informava Obama sobre les operacions d'espionatge

dez 2013: 1 3 Catalunya: la consulta per a la independència tindrà lloc el 9 de novembre del 2014 , 2 2 Lon wd , 3 2 Lat wd , 4 2 Finalitza el Campionat del Món sub19 de korfbal 2010 , 5 2 Mor l'expresident sud-africà Nelson Mandela , 6 1 Hedoi Etxarte i Alain M. Urrutia publiquen \"La bella fugida\"

jan 2014: 1 2 Es crea el Manifest Basset-Bausset , 2 2 Israel: mor l'exprimer ministre Ariel Xaron , 3 2 Desenes de milers de persones es manifesten a Bilbao en defensa de la llibertat i en repulsa del darrer atemptat mortal d'ETA d'ahir divendres , 4 1 Saïda Saddouki denuncia la Guàrdia Civil per per discriminació lingüística

fev 2014: 1 4 Estats Units: mor Quentin Elias, excantor del grup francès Alliage , 2 2 Coord comprova/tipus

mar 2014: 1 3 Eleccions municipals franceses del 2014: la mapa dels resultats de la segona volta , 2 3 Eleccions municipals franceses del 2014 - segona volta: Estrasburg , 3 2 Eleccions municipals franceses del 2014 - segona volta: Reims , 4 2 Eleccions municipals franceses del 2014 - segona volta: Rennes , 5 2 Eleccions municipals franceses del 2014 - segona volta: Beauvais , 6 2 Eleccions municipals franceses del 2014 - segona volta: Montalban , 7 1 Es presenta el projecte Parelles Lingüístiques Transfrontereres

abr 2014: 1 6 Kepler-186f: descobreixen un planeta potencialment habitable , 2 2 Eleccions municipals franceses del 2014 - segona volta: Clarmont d'Alvèrnia , 3 2 Crimea: la població vota massivament a favor de la unió amb Rússia , 4 1 Es presenta el projecte Parelles Lingüístiques Transfrontereres

mai 2014: 1 3 França: Jean-François Copé dimiteix com a president de la UMP , 2 2 Obama amenaça a Síria amb una \"resposta greu\" pels atacs químics encara que no se'n sap l'autoria , 3 1 Campionat del Super 15 de rugbi a 15 2014: els resultats de la setzena jornada

jun 2014: 1 2 Mundial 2014: Itàlia eliminada , 2 2 Felip VI nou rei d'Espanya , 3 2 Mundial 2014: Espanya rosega les mastegueres contra els Països Baixos , 4 2 Mundial 2014: el Brasil guanya el seu matx d'obertura , 5 2 Mundial 2014: cerimònia d'obertura , 6 1 S'estrena \"Illa de Xàtiva\", un documental sobre les Comarques Centrals del País Valencià

jul 2014: 1 4 Continua la música al FIB 2014 , 2 4 El FIB inicia la seua 20a edició , 3 3 Es presenta la bandera del Tricentenari , 4 3 Vint anys del Festival Internacional de Benicàssim , 5 3 El FIB 2014 s'acomiada fins a l'any que ve , 6 3 The Libertines i Lily Allen, principals actuacions de la tercera jornada del FIB 2014 , 7 2 El Tribunal Suprem confirma la pena de quatre anys de presó per a l'expresident de la Diputació de Castelló i del PP provincial, Carlos Fabra , 8 2 Biquipedia, la Viquipèdia en aragonés, celebra el seu desé aniversari , 9 2 Catalunya: fi de Caixa Catalunya , 10 1 Saïda Saddouki denuncia la Guàrdia Civil per per discriminació lingüística

ago 2014: 1 1 Es ratifica el Compromís Municipal Sobiranista de Sant Pere de Rodes

set 2014: 1 2 Campionat d'Espanya de futbol 2014-2015: els resultats de la tercera jornada , 2 1 Coord comprova

out 2014: 1 5 Ciutat del Vaticà: beatificació del papa Pau VI , 2 3 Atorguen el Nobel d'Economia al francès Jean Tirole , 3 2 El govern espanyol vol impugnar també el nou 9-N , 4 2 Companyia japonesa disponibilitza manuscrits de la Biblioteca Vaticana , 5 2 Declaren \"sense Ebola\" a la infermera espanyola Teresa Romero , 6 2 Andrés Iniesta guanya el Golden Foot 2014 , 7 2 El cicló Hudhud deixa almenys sis morts a l'Índia , 8 2 Marina Silva anuncia el seu suport a Aécio Neves per a la segona ronda al Brasil , 9 2 Rousseff i Neves es disputaran la presidència del Brasil a la segona ronda , 10 2 La missió Grail de la NASA descobreix l'origen de la taca visible de la Lluna , 11 2 Mèxic confirma captura del cap del Càrtel dels Beltrán Leyva , 12 2 Doble atemptat a Síria deixa 48 morts , 13 1 Coord comprova/tipus

nov 2014: 1 3 Es convoquen manifestacions a Andalusia a favor del dret a decidir , 2 3 El govern català manté la votació del 9-N , 3 2 Atac suïcida deixa almenys 50 morts en un partit de voleibol a l'Afganistan , 4 2 Inundacions al sud de França deixen cinc morts , 5 2 Es coneix l'identitat del soldat que va disparar a Osama bin Laden , 6 2 El Tribunal Constitucional suspèn la consulta del 9N , 7 1 Es crea el Manifest Basset-Bausset

dez 2014: 1 2 Portada , 2 2 WhatsApp farà servir xifrat entre mòbils per millorar la seguretat dels seus usuaris , 3 2 WhatsApp incorpora una notificació de lectura dels missatges , 4 1 Catalunya del Nord: dispositiu dels gendarmes per aquest Cap d'Any

jan 2015: 1 4 Mor el poeta Marco Gal , 2 3 Jove decapita la seva mare als Estats Units amb una destral perquè es va enfadar amb ella , 3 2 Catalunya del Nord: circulació difícil a les carreteres de muntanya , 4 2 La presa d'ostatges a París porta de Vincennes cap a un supermercat , 5 2 Els germans Kouachi identificats a Dammartin-en-Goële, prop de París, prenent ostatges , 6 2 Explosió criminal a Villefranche-sur-Saône , 7 1 En

fev 2015: 1 2 If empty , 2 2 Brasil pendent de la crisi a Veneçuela , 3 2 Dinamarca: un mort a Copenhaguen en un tiroteig contra un acte de suport a Charlie Hebdo , 4 2 Campionat d'Espanya de futbol 2014-2015: els resultats de la vint-i-dosena jornada , 5 1 Infotaula esdeveniment

mar 2015: 1 6 Itàlia: Amanda Knox finalment absolta de l'assassinat de Meredith Kercher , 2 3 S'estavella un Airbus A320 de la companyia Germanwings al sud de França , 3 2 Lon wd , 4 2 Lat wd

abr 2015: 1 3 El 31 de març el BOE va publicar la coneguda com a \"llei mordassa\" , 2 2 Un estudiant menor d'edat mata un professor en un institut de Barcelona , 3 2 Campionat de França de futbol de lliga 1 2014-2015: els resultats de trenta-dosena la primera jornada , 4 2 Campionat d'Espanya de futbol 2014-2015: els resultats de la trentena-unena jornada , 5 2 Campionat de França de futbol de lliga 2 2014-2015: els resultats de la trenta-unena jornada , 6 1 Volcà entra en erupció al sud de Xile

mai 2015: 1 2 El 9 de març dues plataformes demanaran signatures pel dret a convocar referèndums , 2 1 Infotaula esdeveniment

jun 2015: 1 3 França: mor l'exministre francès Charles Pasqua , 2 2 Tunísia: atacs sagnants contra dos hotels a Sussa , 3 2 Líder d'Al Qaeda mort per un atac nord-americà , 4 2 França: la Federació de les Telecomunicacions marxa del MEDEF , 5 2 Catalunya del Nord: el Consell d'Estat anul·la les eleccions municipals a Ceret , 6 1 FormatExtCoordinate

jul 2015: 1 5 Es crea el partit polític Demòcrates de Catalunya , 2 3 Anglaterra aconsegueix el tercer lloc de la Copa Mundial de futbol femení , 3 2 Ceret: Alain Torrent reelegit al primer torn , 4 2 La Comissió Europea no descarta la sortida de Grècia de l'euro si no presenta mesures creïbles , 5 2 Grècia diu No al pla de rescat de la troica , 6 2 Francesc Solé guanya el Ultra Trail d'Andorra , 7 2 Grècia: el programa de la coalició de govern inclou una flexibilització de les mesures d'austeritat , 8 1 Moure a Viquinotícies

ago 2015: 1 3 França : troben un adolescent de 12 anys amb bicicleta per l'autopista , 2 2 Estats Units: dos periodistes matats per trets durant una retransmissió en directe a Virgínia , 3 2 Assassinen al fotoperiodista Rubén Espinosa , 4 2 Rússia: naufragi amb 54 morts al Pacífic , 5 1 If empty

set 2015: 1 3 França: Myriam El Khomri succedeix a Rebsamen al ministeri de Treball , 2 2 Volkswagen engolit per l'escàndol de les emissions de dièsel , 3 2 Un terratrèmol sacseja Xile i repercuteix a Argentina , 4 1 Infotaula

out 2015: 1 2 338 ostatges de Boko Haram alliberats per l'exèrcit nigerià , 2 2 Científics que van descobrir l'oscil·lació dels neutrins reben el Nobel de Física , 3 2 Atacs a la zona comercial de Bagdad deixen dotzenes de morts , 4 1 Es crea el Manifest Basset-Bausset

nov 2015: 1 4 França: almenys 132 morts en sis atacs terroristes a París , 2 3 França: homenatge a les víctimes dels atemptats del 13 de novembre del 2015 , 3 2 COP 21: s'assemblen 150 caps d'Estat pel primer dia

dez 2015: 1 3 Mèxic: s'aprova una vacuna antidengue , 2 2 Infotaula accident aeri , 3 2 Guatemala: La Fiscalia de Guatemala acusa a Otto Pérez Molina , 4 1 Infotaula esdeveniment

Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Quinta-feira, 21 de janeiro 2016 21:07

Dump file cawikinews-20160111-stub-meta-history.xml.gz (edits only), size 4.3 Mb as gz -> 36 Mb
Dump processed till Dec 31, 2015, on server stat1002, ready at Tue-12/01/2016-20:38 after 23 sec.

Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.