Estatísticas da Wikinotícias tcheco

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist

Metrics have been collected from a full archive dump, which contains all revisions of every article, meta data and raw content.
See also metrics definitions


 
Monthly counts & Quarterly rankings: junho 2014
 
DataWikinoticiaristasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
jun 20140%   +1%   +625%+2%+2%+1%+5%+1%+1% 
mai 20140%   +1%   -79%+2%+2%0%0%+2%+2% 
abr 2014+2%   +3%   +282%+4%+4%0%+1%+4%+4% 
mar 2014+2%   +1%   -29%+1%+1%0%0%+1%+1% 
fev 2014+3%   +1%    +1%+1%+1%+1%+1%+1% 
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
jun 201442 512,3 k17,415265875,1 Mb527 k7181,7 k1,8 k4,2 k2
mai 201442 5 2,3 k17,21512815,0 Mb519 k7141,6 k1,8 k4,2 k2
abr 20144218 2,3 k27,315043824,9 Mb510 k7121,6 k1,8 k4,1 k2
mar 20144117 2,2 k17,414951004,7 Mb491 k7121,6 k1,7 k4,0 k2
fev 20144014 2,2 k17,414881414,7 Mb485 k7111,6 k1,7 k3,9 k2
jan 201439 1 2,2 k 7,41481144,6 Mb478 k7041,6 k1,7 k3,9 k2
dez 201339   2,2 k 7,414809694,6 Mb477 k7041,6 k1,7 k3,9 k2
nov 201339 2 2,2 k26,914821304,6 Mb478 k7041,6 k1,7 k3,9 k2
out 201339 1 2,1 k171499604,5 Mb473 k6761,5 k1,7 k3,8 k2
set 201339   2,1 k 7,1151494,5 Mb470 k6651,5 k1,7 k3,8 k2
ago 201339 1 2,1 k 7,11504144,5 Mb467 k6631,5 k1,7 k3,8 k2
jul 201339 2 2,1 k 7,11507694,5 Mb466 k6631,5 k1,7 k3,8 k2
jun 201339 6 2,1 k17,215131074,4 Mb465 k6611,2 k1,7 k3,7 k2
mai 201339 512,0 k27,215184634,4 Mb459 k6521,2 k1,7 k3,7 k2
abr 201339 7 2,0 k27,215291,7 k4,3 Mb450 k6081,2 k1,6 k3,4 k2
mar 20133925 1,9 k16,515472984,2 Mb443 k5881,1 k1,6 k3,3 k2
fev 20133726 1,9 k16,515622434,2 Mb438 k5701,1 k1,6 k3,3 k2
jan 201335 411,8 k16,515692684,1 Mb432 k5561,1 k1,6 k3,1 k2
dez 201235 4 1,8 k16,515721444,0 Mb423 k5331,1 k1,6 k2,9 k2
nov 20123529 1,8 k16,515854844,0 Mb418 k5091,1 k1,6 k2,8 k2
out 201233 2 1,7 k16,41586943,9 Mb410 k4991,1 k1,6 k2,7 k2
set 201233 1 1,7 k 6,41581453,8 Mb404 k4961,1 k1,6 k2,7 k2
ago 201233 1 1,7 k 6,41583173,8 Mb401 k4941,0 k1,5 k2,7 k2
jul 201233 111,7 k16,415821693,8 Mb400 k4941,0 k1,5 k2,7 k2
jun 201233 3 1,7 k16,415804053,7 Mb393 k4821,0 k1,5 k2,6 k2
mai 201233 1 1,6 k16,31573873,7 Mb386 k4661,0 k1,5 k2,6 k2
abr 201233 3 1,6 k16,31570843,6 Mb377 k4501,0 k1,5 k2,5 k2
mar 201233 2 1,6 k 6,41565363,5 Mb367 k4361,0 k1,4 k2,5 k2
fev 201233 4 1,6 k26,415661383,5 Mb366 k4341,0 k1,4 k2,5 k2
jan 20123328 1,5 k26,515582493,4 Mb354 k4099841,4 k2,4 k2
dez 20113113 1,5 k 6,615611073,3 Mb344 k3799471,4 k2,4 k2
nov 201130 211,5 k26,615551683,2 Mb339 k3699001,4 k2,3 k2
out 201130 311,4 k26,715692783,1 Mb330 k3418761,3 k2,3 k2
set 201130 411,3 k26,916032,4 k3,0 Mb320 k3247941,3 k2,3 k2
ago 2011302511,3 k15,216089163,0 Mb309 k3098021,3 k2,2 k2
jul 201128 1 1,3 k14,71577672,8 Mb292 k2837871,2 k2,2 k2
jun 2011281411,2 k24,715801862,7 Mb287 k2767711,2 k2,2 k2
mai 201127 2 1,2 k14,81595942,6 Mb275 k2477551,1 k2,1 k2
abr 201127 3 1,1 k 4,915844972,5 Mb263 k2357371,1 k2,0 k2
mar 201127 3 1,1 k14,515844862,5 Mb259 k6307381,1 k2,0 k2
fev 201127 3 1,1 k14,21605682,4 Mb258 k1,2 k6941,1 k2,0 k2
jan 201127 3 1,1 k 4,21610372,4 Mb252 k1,1 k6721,0 k1,9 k2
dez 201027 2 1,0 k14,21609772,3 Mb250 k1,1 k6601,0 k1,9 k2
nov 201027 2 1,0 k14,31603632,3 Mb242 k1,1 k6441,0 k1,9 k2
out 201027 2 99014,31594602,2 Mb234 k1,0 k6249831,9 k2
set 20102713 974 4,31594622,2 Mb230 k1,0 k6069681,9 k2
ago 201026 3 96714,31593802,1 Mb229 k1,0 k5999611,8 k2
jul 201026 2 95014,31596852,1 Mb225 k1,0 k5949431,8 k2
jun 201026 3 916 4,41596602,0 Mb217 k9595729091,8 k2
mai 201026 4 90114,415971032,0 Mb213 k9575518961,8 k2
abr 201026 2 87914,415781391,9 Mb206 k9485308641,7 k2
mar 20102614 840 4,41570701,8 Mb196 k8964768241,6 k2
fev 201025 1 831 4,41568251,8 Mb193 k8914698111,6 k2
jan 201025 3 823 4,41562871,8 Mb191 k8914688001,6 k2
dez 200925 2 811 4,31555421,7 Mb187 k8764567891,6 k2
nov 200925 2 801 4,31554611,7 Mb185 k8764447821,5 k2
out 200925 6 79114,31559781,7 Mb183 k8684257751,5 k2
set 20092514 76214,41581611,7 Mb179 k8474067531,5 k2
ago 20092422 74114,41594741,6 Mb176 k8333867401,5 k2
jul 20092212 718 4,51619511,6 Mb173 k8243697331,4 k2
jun 200921 2 710 4,41616441,6 Mb171 k8163487251,4 k2
mai 200921 2 695 4,51619561,6 Mb167 k7993357141,4 k2
abr 200921 2 681 4,51623591,5 Mb164 k7993356951,4 k2
mar 20092115 66614,516321141,5 Mb162 k7883276801,4 k2
fev 200920 2 643 4,51639261,5 Mb157 k7823156631,3 k2
jan 200920 6 63614,516362311,4 Mb155 k7713016581,3 k2
dez 20082017 59924,416462191,4 Mb147 k7252966291,3 k2
nov 20081926 54014,516931461,3 Mb136 k7052865841,2 k2
out 20081716150534,516852651,2 Mb127 k6972585511,1 k2
set 200816 5 42434,71562254955 kb99 k5872294689572
ago 200816 5134325,11577295783 kb81 k4661763928342
jul 20081625 27415,31645115654 kb68 k3671323167192
jun 20081429123625,61648712568 kb59 k3031242896222
mai 20081236117613,51297228357 kb35 k36412234662
abr 20089 3 156 2,5129135315 kb31 k3128205402 
mar 20089 4 14112,51295111286 kb28 k268192363 
fev 2008968 9822,51217165183 kb18 k15890225 
jan 2008323 4311,810677569 kb7,0 k3 3781 
dez 200711  2 198022,7 kb287  25 
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
The following table ranks this project in relation to projects in other languages with 1000+ articles
abr 201416955134111551615141491519
jan 2014161018813131115181615141491519
out 20131511188131012151416151414101519
jul 201315111612131412151615151414101519
abr 20131412712137121441515141591519
jan 2013151081013121313815151415101619
out 201215101310131212131315141415101619
jul 201215131710131312131314141415101619
abr 201215101010131311121214141415111519
jan 2012157712131010111114131515111419
out 201115131391379111014131615111419
jul 2011159168131113111416141715111619
abr 2011159111014131311616121716111619
jan 20111513151214141310171513916111519
out 2010157151014141414161514916111519
jul 20101513151214131313131514915111519
abr 2010141015814111313101614815121419
jan 2010141111814121313131614815111419
out 20091411111114121313131514815111419
jul 20091311161114141212151514815111419
abr 2009131214914121212151514816101419
jan 2009131591014121212111514816111419
out 2008141111101491111111415916111518
jul 2008149101216111111121616916131518
abr 2008168119161311111316161518131618
jan 200817101312171410101517171818151718
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100ediçõesbytes
 WikinoticiaristasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikinoticiaristas (usuários registrados)
A = Wikinoticiaristas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikinoticiaristas que editaram pelo menos dez vezes desde que chegaram
C = Wikinoticiaristas que contribuíram cinco vezes ou mais este mês
D = Wikinoticiaristas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  5  10  100  1000  1  3  5  10  25  1  3  5  10  25  100  250  5  10  100  1000 
Monthly counts for recent history of wiki
jun 201412652111    3221  42211  21  
mai 201495531     542   10441   21  
abr 2014168874 11  9643  164331  11  
mar 2014127741     533   12741   11  
fev 2014134442 11  62    146531  32  
jan 2014521       411   16741   21  
dez 20133    111 2     11211   22  
nov 201373221     5111  142111  33  
out 201363111     3     124311  22  
set 20135        21    64211  21  
ago 2013621       3     71111  11  
jul 201394211 11  1     93211  32  
jun 2013127641     4     6311   111 
mai 2013865331 111 7111  104311      
abr 20131510732 22214     116411113322
mar 2013139533 32  61    125411  43  
fev 2013157643     31    1131        
jan 20131054421 1   1     9211   22  
dez 201285442     41    1142        
nov 20121311954 221 116421 106321      
out 201273211     322   75211  1   
set 201211311      4     6321   32  
ago 2012631       6     1121        
jul 2012941111 11  3     83221  1   
jun 201264321 222 221   854331 22  
mai 201282111     521   133311      
abr 2012125311     41    12632       
mar 201212221      5     134111  331 
fev 2012104431 1   8221  157421  22  
jan 20122110863     731   1510521  21  
Quarterly counts for entire history of wiki
abr 2014168874 11  9643  164331  11  
jan 2014521       411   16741   21  
out 201363111     3     124311  22  
jul 201394211 11  1     93211  32  
abr 20131510732 22214     116411113322
jan 20131054421 1   1     9211   22  
out 201273211     322   75211  1   
jul 2012941111 11  3     83221  1   
abr 2012125311     41    12632       
jan 20122110863     731   1510521  21  
out 20111263211 32  721   146533  22  
jul 201194111     5     8221   1   
abr 201174321 211 322   144431  21  
jan 2011953       31    10211   33  
out 20109421  1   31    9211   42  
jul 201063221     1     5211       
abr 2010154222 1   421   116311      
jan 2010104321     8     72221  11  
out 200913763      611   1641        
jul 200911621      541   1022        
abr 200914522      5211  16662   221 
jan 2009179641     732   13551       
out 20081986531     942   199643      
jul 200896532     5222  10533   11  
abr 20086331      1     532        
jan 2008115321           108641      

 

Distribuição de edições de artigos por wikinoticiaristas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikinoticiaristasEdições total
1201100.0%9,317100.0%
37939.3%9,14798.2%
104120.4%8,90095.5%
322311.4%8,57092.0%
100136.5%7,96085.4%
31673.5%6,81573.1%
100021.0%4,08843.9%

 

12 wikinoticiaristas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions
agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
OkinoUC1 03,0205331,29638jan 29, 200823438649--
Danny B.UC2 01,06821,68815jan 17, 20082355146---
TchořUC7 03274228-dez 01, 20082036103---
Venca24UC9 023121592jan 17, 2008235548---
CommonsDelinkerUC13 012162-jan 24, 20082348----
CepiceUC17+5592321mar 24, 201346231--
Serdtse v RossiiUC23 04051-abr 07, 201483405--
UtarUC32+118118-out 13, 20101355----
Jenda H.UC72...5511jun 25, 2014411--
Trek00UC199...11--jun 16, 201413----
JurgenNLUC200...113-jun 19, 201410----
Kenjiro995UC201...11--jun 23, 2014611--

 

20 wikinoticiaristas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
Lenka64UC3754ago 08, 20082151abr 01, 201489
RagimiriUC4600mai 27, 20082224dez 30, 20091642
Sevela.pUC5577fev 02, 20082339fev 12, 2012868
AktronUC6469dez 31, 20072372nov 14, 2012592
MildaUC8284fev 02, 20082339mai 01, 201459
MercyUC10199fev 12, 20082329set 17, 2012650
JedudedekUC11179jul 15, 20082175mar 26, 201495
I.Sáček, seniorUC12131jul 16, 20091809mai 22, 201438
JuandevUC1497mai 03, 20082248abr 06, 201484
KychotUC1596out 08, 20082090abr 17, 2012803
PaluUC1678abr 12, 20101539mai 20, 201440
JagroUC1854fev 22, 20091953abr 12, 2013443
DarkermonkUC1951jan 18, 20082354mar 23, 20082289
RiaUC2048mar 06, 20091941nov 17, 20091685
Orange.manUC2147jan 01, 20082371out 23, 20082075
SengaUC2240jun 21, 20111104out 29, 2011974
As007UC2429out 29, 20082069jan 06, 20092000
MiloshavlicekUC2529ago 03, 20111061ago 14, 20111050
EldronUC2627nov 10, 20082057out 02, 20091731
Faigl.ladislavUC2725fev 11, 20091964ago 18, 20111046

 

usuários anônimos, ordenados por número de contribuições
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
158.169.131.14103
78.45.42.18610
80.201.218.23710

No total 444 edições foram feitas por usuários anônimos, de um total de 17272 edições ( 2e %)
  


20 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
JAnDbotUC14,225mai 29, 20082222abr 20, 201470--
ReaperbotUC21,265set 18, 20111015set 18, 20111015--
OkinBOTUC3843ago 12, 20111052nov 02, 2012604--
TchoŘoBotUC4576mar 23, 20111194jul 23, 2012706--
Milda.botUC5401mar 17, 2013469mai 02, 2013423--
MjbmrbotUC639nov 17, 20101320mar 22, 20111195--
GrondinBotUC738out 14, 20091719nov 11, 2013230--
KamikazeBotUC830out 18, 2011985dez 18, 2011924--
VolkovBotUC922abr 10, 20091906fev 17, 2013497--
ArthurBotUC1020nov 06, 20091696abr 24, 20111162--
Diego Grez BotUC1114jul 12, 20101448out 08, 20101360--
BOT-SuperzerocoolUC1214dez 02, 2011940jun 07, 2012752--
GhalyBotUC136jan 01, 2013544jan 01, 2013544--
AmirobotUC144dez 03, 20101304jul 16, 20111079--
AvocatoBotUC154set 12, 2012655mai 06, 2013419--
MerlLinkBotUC163ago 06, 20101423fev 04, 20111241--
CarsracBotUC172set 14, 20101384jan 21, 2012890--
AKBotUC182fev 14, 2012866fev 14, 2012866--
AlexbotUC191jun 12, 20082208jun 12, 20082208--
GumruchobotUC201mai 17, 2012773mai 17, 2012773--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110Png
jun 20142,3 k640511486522,3 k      5841
mai 20142,3 k640511486522,3 k      781
abr 20142,3 k638511476522,3 k      3111
mar 20142,2 k629491416422,2 k      971
fev 20142,2 k626491416422,2 k      1221
jan 20142,2 k618491396422,2 k      121
dez 20132,2 k605491396422,2 k      41
nov 20132,2 k600491396422,2 k      1201
out 20132,1 k591491396422,1 k      571
set 20132,1 k584491396422,1 k      61
ago 20132,1 k558491396422,1 k      141
jul 20132,1 k555491386422,1 k      461
jun 20132,1 k549491386422,0 k      981
mai 20132,0 k547491386422,0 k      2731
abr 20132,0 k542491366422,0 k      1731
mar 20131,9 k53749136612601      1941
fev 20131,9 k52149135552596      2161
jan 20131,9 k50949135542595      2611
dez 20121,8 k50548135542593      1391
nov 20121,8 k49848135542592      2071
out 20121,8 k48746135492584      931
set 20121,7 k48346135492573      391
ago 20121,7 k47846135492562      171
jul 20121,7 k46646135492561      1211
jun 20121,7 k46246135482557      1231
mai 20121,7 k45145131472550      851
abr 20121,6 k44445130472541      831
mar 20121,6 k43245129472534      351
fev 20121,6 k42545129472473      1151
jan 20121,5 k40944129462458      2191
dez 20111,5 k40344126462455      731
nov 20111,5 k39843126462455      1461
out 20111,4 k38241126452452      1761
set 20111,3 k37041124452421      1781
ago 20111,3 k36239123442410      1811
jul 20111,3 k34139123432397      641
jun 20111,2 k32738123432395      1701
mai 20111,2 k32038119432380      921
abr 20111,1 k30838119432376      691
mar 20111,1 k29538119422371      851
fev 20111,1 k29438117422360      641
jan 20111,1 k28338117422351      311
dez 20101,0 k27438117422340      631
nov 20101,0 k27037117412336      531
out 201099226437116412334      451
set 201097626037116412324      571
ago 201096925137116412324      781
jul 201095223737116412318      751
jun 201091823637116402311      491
mai 201090321137116402310      901
abr 201088120737116392306      1091
mar 201084219636116392299      601
fev 201083319136116392298      221
jan 201082518736116392297      751
dez 200981317436116392286      321
nov 200980317336115392283      391
out 200979317336115382283      751
set 200976416936115381283      511
ago 200974316036115381270      711
jul 200972015636115371270      511
jun 200971215136115371270      411
mai 200969715136115361270      531
abr 200968314836115351269      571
mar 200966813136115341267      1131
fev 200964511933115311260      221
jan 200963811133115301260      1681
dez 200860110633115301252      1911
nov 200854210333115301240      1341
out 20085078533115301237      2601
set 20084266729114271228      2351
ago 2008345632811426 186      2611
jul 2008276542211324 176      1151
jun 2008238512111324 159      6951
mai 20081782915 713 118      227 
abr 200815618 17 88      34 
mar 200814118 17 81      109 
fev 20089818 16 70      162 
jan 200843 7 16 49      73 
dez 20072 5 16 4      2 

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

dez 2007: 1 1 Slovinsko se připravuje na předsednictví Evropské unie

jan 2008: 1 3 V Turkmenistánu je povolena opera a cirkus , 2 3 Bulharsko a Rumunsko trpí sněhovou kalamitou , 3 2 Plzeňský magistrát zakázal pochod neonacistů , 4 2 Koss slaví 50 let , 5 2 Toyota se stala největším výrobcem aut na světě , 6 1 Zemřel režisér Jiří Sequens

fev 2008: 1 5 Fidel Castro končí ve vrcholných kubánských funkcích , 2 5 Policisté odhalili podvod za 82 miliard , 3 4 Konec papírových dvacetikorun a padesátníků , 4 4 V Iráku zemřely dvě děti po snědení otrávených koláčů, devět se stále léčí , 5 4 USA a některé státy EU Kosovo uznaly, Srbsko ne , 6 3 Kosovo vyhlásilo oficiálně nezávislost , 7 3 Identifikována oběť nepokojů v Bělehradu , 8 3 I v Praze se protestovalo proti kosovské nezávislosti , 9 3 Do Česka se dováží stále víc masného odpadu , 10 3 Americké letectvo sestřelilo porouchaný satelit , 11 3 Ve věku 104 let zemřela americká spisovatelka Whitneyová , 12 3 Omluva a odškodnění britským veteránům za chemické pokusy , 13 3 Rekordní posílení české i slovenské koruny , 14 3 Nejméně 30 lidí zabilo zemětřesení ve Rwandě a Kongu , 15 3 Lotyšsko se připravuje na energetickou krizi , 16 3 Češi budou moci do USA bez víz možná již letos , 17 2 V Čadu pokračuje boj povstalců s vládními jednotkami , 18 2 Turecko si přeje vstup Albánie do NATO , 19 2 Mezi Madridem a Barcelonou začaly jezdit rychlovlaky , 20 1 Zveřejněny první záběry z nového filmu s Indianou Jonesem

mar 2008: 1 4 Kosovo vyhlásilo oficiálně nezávislost , 2 3 Předčasné volby v Srbsku se uskuteční v květnu , 3 2 Zemřel herec Radovan Lukavský , 4 2 Papež přednesl velikonoční poselství , 5 2 NATO si přeje zlepšit si své vztahy se Sbrskem , 6 2 Identifikována oběť nepokojů v Bělehradu , 7 2 Zdravotníci nakazili 49 pacientů virem HIV , 8 2 Českého diplomata v Ghaně přepadli lupiči s mačetou , 9 2 V Zimbabwe začínají napjaté volby , 10 2 Rusko a USA se na radaru nedohodly , 11 2 Obama vítězí v demokratických primárkách ve Wyomingu , 12 2 Na jednání o novém jménu Republiky Makedonie nebyl přijat žádný název

abr 2008: 1 2 V Surinamu spadlo letadlo, asi 19 mrtvých , 2 2 Bush vyzval státy NATO, aby podpořily členství Ukrajiny a Gruzie , 3 2 Belgie plánuje si dočasně najmout věznice v zahraničí , 4 2 Škoda 15T byla představena , 5 1 Sonda Messenger pořídila fotografie Merkuru

mai 2008: 1 4 USA hlásí rekordní ceny kukuřice , 2 4 Slova o maďarském šaškovi rozdmýchala slovensko-maďarské vztahy , 3 3 Omluva a odškodnění britským veteránům za chemické pokusy , 4 3 Nejméně 30 lidí zabilo zemětřesení ve Rwandě a Kongu , 5 3 Zemřel slavný guru šedesátých let Mahariši Maheš Jógi , 6 3 Česká vláda uznala kosovský stát , 7 3 Ve stanici Černý Most zastavil pád člověka do kolejiště provoz metra , 8 3 V Praze se propadl rozestavěný tunel, místní překvapila díra ve Stromovce , 9 3 V Kičevu došlo k několika vraždám, místní se bojí sériového vraha , 10 3 Několikaleté tramvajové provizorium nahradí trať na pražské Letné , 11 3 Ceny ropy dle Goldman Sachs: Bude hůř , 12 3 Barma vyhlásila třídenní státní smutek , 13 2 Vzniká nová mezinárodní organizace zemí vyvážejících plyn , 14 2 Ve věku 104 let zemřela americká spisovatelka Whitneyová , 15 2 Konec papírových dvacetikorun a padesátníků , 16 2 Zdravotníci nakazili 49 pacientů virem HIV , 17 2 V Iráku zemřely dvě děti po snědení otrávených koláčů, devět se stále léčí , 18 2 Lotyšsko se připravuje na energetickou krizi , 19 2 Nepál bude republikou, král dnes končí , 20 2 Anglické Wikizprávy nařknuty z cenzury , 21 2 Rusko a USA se na radaru nedohodly , 22 2 Pákistánská opozice vyhrála volby , 23 2 Policisté odhalili podvod za 82 miliard , 24 2 Nákladní loď u chorvatských břehů v plamenech , 25 2 Nominace na Juno Award 2008 oznámeny

jun 2008: 1 6 Z Varšavy do Poznaně rychlostí 250 km/h , 2 5 Osm mrtvých a dva nezvěstní po požáru na nákladní lodi v Kaliningradu , 3 5 Silné zemětřesení zasáhlo Řecko , 4 4 Nový zákon v Litvě: Srp a kladivo už ne , 5 4 Konzervativní organizace podporují nenásilný odpor proti Queer Parade Brno , 6 4 Norské národní shromáždění posvětilo sňatky homosexuálů , 7 4 Kosovo má už i vlastní hymnu , 8 4 Výsledky ankety CZECH OPEN SOURCE 2008 , 9 4 Ruské tajné služby zabránily teroristickým útokům na moskevské metro , 10 4 Autotec 2008 končí , 11 4 Slovenské euro se blíží. Je vláda připravena? , 12 4 Řidič autobusu v Polsku jel s 1,6 promile alkoholu v krvi , 13 4 NHL: Detroit vyhrál Stanley Cup , 14 4 Ahmadínežád opět prorokoval zkázu Izraele. A také návrat Ježíše , 15 4 Koštunica: Volby jsou o Srbsku, ne o EU , 16 3 Woods vyhrál golfové US Open, ale potřeboval víc než play-off , 17 3 Irové v referendu odmítli Lisabonskou smlouvu , 18 3 EURO 2008: Favorizovaní Němci prohráli s Chorvaty , 19 3 Americký Nejvyšší soud: Vězni z Guantánama mají právo na civilní soud , 20 3 Spoluzakladatel Google si předplatil cestu do vesmíru , 21 3 EURO: Češi prohráli s Portugalci. Neuhlídali Ronalda. , 22 3 Vnučka královny Alžběty nepojede kvůli zranění koně na olympiádu , 23 3 Dopaden válečný zločinec Stojan Župljanin , 24 3 Na súdánském letišti shořelo letadlo , 25 3 Cena ropy se může do osmnácti měsíců zdvojnásobit

jul 2008: 1 5 Srbové zatkli Radovana Karadžiče , 2 4 Češi protestovali proti podpisu smlouvy o radaru , 3 3 Zatýkání na palestinských územích pokračuje , 4 3 Boeing s proděravělým trupem přistál bezpečně v Manile , 5 3 Zbigniew Brzezinski varoval před vedením války v Afghánistánu , 6 3 Referendum ve Švýcarsku: Zakázat minarety? , 7 3 Pražská Letná: První přeložka v provozu , 8 3 Násilné protesty v Mongolsku si vyžádaly už 5 mrtvých , 9 2 Slavnostní olympijský ceremoniál prozrazen , 10 2 Slovenská televize startuje třetí kanál , 11 2 Minimální mzda v USA vzrostla na 6,55 $ na hodinu , 12 2 Berlín přivítal Baracka Obamu , 13 1 Americký radar bude i v Izraeli

ago 2008: 1 6 Před vlak EuroCity se zřítil most , 2 4 Nicolas Sarkozy žádá o milost pro členku Rudých brigád , 3 3 Útok na Írán by odstartoval světovou válku , 4 3 Letecká havárie v Madridu , 5 3 Příměří zatím nenechalo gruzínské síly chladné , 6 3 Jižní Osetii opouštějí tisíce lidí, bojuje se dále , 7 3 Gruzie a Rusko jsou na pokraji války , 8 3 Týrání zvířat bude trestáno přísněji , 9 2 Fanoušci Sparty urazili Chorvaty , 10 2 Rusko uznalo Abcházii a Jižní Osetii , 11 2 Výbuch vlaku u Gori , 12 2 Rusko i nadále kontroluje přístav Poti , 13 2 Rakousko uznává kosovské pasy , 14 2 Pákistánský prezident Mušaraf oznámil rezignaci , 15 1 Praha má již 43 nízkopodlažních tramvají 14T

set 2008: 1 8 Střelba ve finské škole , 2 4 První debata McCaina a Obamy: Mluvilo se o ekonomice, Iráku a Íránu , 3 4 Příměří zatím nenechalo gruzínské síly chladné , 4 3 Sněmovna reprezentantů odmítla opatření proti krizi , 5 3 Zemřel Paul Newman , 6 2 Obama vede v předběžných průzkumech o 8 procentních bodů , 7 2 Evropské burzy se vzpamatovávají z kolapsu po hlasování americké Sněmovny reprezentantů , 8 2 Boris Tadić připustil možné rozdělení Kosova , 9 2 Nejméně 125 lidí ušlapáno v indickém hinduistickém chrámu , 10 2 700 milionů eur pro Zastavu, investují Fiat a Iveco , 11 2 Lavrov: To Gruzie si zničila svoje hranice , 12 2 Otrávené mléko v Číně: Při razii nalezeno 200 kg melaminu , 13 2 Britové znárodňují zadluženou banku B&B, libra se propadla , 14 2 Taliban zabil afghánskou policistku, ochránkyni práv žen , 15 2 Tři bojové lodě obklíčily somálské piráty , 16 2 Egyptské národní divadlo likviduje požár , 17 2 Černohorci mohou do Ruska bez víz , 18 2 Pro potřeby alternativní medicíny bude na Srí Lance zřízena plantáž s konopím , 19 2 Malé evropské národy ukazuje brněnská výstava fotografií , 20 2 Slovensko v boji za neuznání Kosova podpořilo Srbsko , 21 2 Šachistka Němcová se stala mistryní Evropy do 18 let , 22 2 Požár na Makarské živí vítr , 23 2 Stanice metra Národní třída bude uzavřena 16 měsíců , 24 1 Prima si našla místo v digitální televizi, analogová Dvojka se pomalu vypíná

out 2008: 1 10 Požár zničil pýchu pražského Výstaviště , 2 5 Protestní shromáždění 8. října 2008 na náměstí Míru v Praze 2 , 3 4 V Itálii probíhají protesty proti kontroverzní školní reformě , 4 4 Rusko vyděsil únos letadla, situaci se ale podařilo uklidnit , 5 4 Skončil 12. ročník konference Fórum 2000 , 6 4 Kosovští Srbové: Ahtisaari je ten poslední, kdo by měl dostat Nobelovu cenu , 7 3 Vichřice zastavila železniční dopravu na Severní Moravě , 8 3 Severní Moravu zasáhl orkán , 9 3 V Londýně měla světovou premiéru bondovka Quantum of Solace , 10 3 Akce proti Obamovi: Fiktivní dopis z roku 2012 , 11 3 Island si půjčil dvě miliardy dolarů na záchranu ekonomiky , 12 3 Jemenské město Shibam ohrožují povodně , 13 3 Jedná se o vyslovení nedůvěry vládě , 14 3 Skončily krajské volby a 1. kolo voleb do Senátu 2008 , 15 3 Muslim na římskokatolické mši , 16 3 SAE dnes uznaly Kosovo , 17 3 Požáry vyvolaly paniku u Los Angeles , 18 3 Martti Ahtisaari získal Nobelovu cenu míru , 19 3 Zemřel olympijský vítěz v běhu na lyžích Prokurorov , 20 3 Praha si připomíná 40 let od okupace vojsk Varšavské smlouvy , 21 2 Obamovu půlhodinovou reklamu vidělo více než 20 milionů lidí , 22 2 Premiér Fico nazval novináře idioty , 23 1 Polovina studentů Cambridge podvádí s díly staženými z internetu

nov 2008: 1 6 Obama vítězí v amerických volbách nad McCainem , 2 4 Ústavní soud rozhodl - Lisabonská smlouva je v pořádku , 3 4 Burger King poprvé v Česku , 4 4 StarDance III: Mistr republiky končí, Norisová opět na špici , 5 4 StarDance III: První pár vypadl , 6 4 Dánský premiér chce vyhlásit referendum k přijetí eura , 7 4 Mistři čínské tušové malby se loučí s návštěvníky , 8 3 StarDance III: Norisová opět nejlepší, Suchařípa opouští soutěž , 9 3 Dalíkova firma chce po státu pět milionů , 10 3 Schwippel kritizuje Topolánkova jednání s ČSSD , 11 3 Špidla: Otevřte pracovní trh , 12 3 Německý levicový politik přestal blokovat portál Wikipedia.de , 13 3 Putin pohrozil zrušením plynovodu Nord Stream , 14 2 V Budapešti protestovali proti vládě zaměstnanci veřejného sektoru , 15 1 V Nitře se střílelo

dez 2008: 1 4 V Guineji se junta snaží o převrat , 2 4 I letos jsou Pražané zváni na vánoční trhy , 3 4 Klaus už nechce být patronem ODS , 4 3 Kyvadlo na Letné odstartuje české předsednictví , 5 3 Černá Hora: YouTube a Facebook nebude , 6 3 Český řidič odsouzen v Británii za nebezpečnou jízdu , 7 3 Při pokusu o start havaroval v americkém Denveru Boeing 737 , 8 3 Povstalecká Armáda božího odporu přišla o svoji hlavní základnu , 9 3 Čeští hokejisté rozstříleli Švédsko , 10 3 Theoneste Bagosora dostal za genocidu ve Rwandě doživotí , 11 3 Den \"D\" českého homebrewingu , 12 3 V ostravské zoo se narodila mláďata levhartů , 13 3 Britští poskytovatelé internetového připojení cenzurují Wikipedii , 14 2 Rok 2009 začne o sekundu později , 15 2 Izrael odmítl francouzský návrh na příměří , 16 2 Švýcarsko je součástí Schengenu, končí kontroly na hraničních přechodech , 17 2 V Guineji oznámili rebelové vytvoření prozatímní vlády

jan 2009: 1 6 Polsko usiluje o pořádání Wikimanie 2010 , 2 4 Lichtenštejnsko se vzdává bankovního tajemství ve prospěch USA , 3 4 Rumunsko pocítilo výpadky dodávek plynu, Evropa je zásobována přes Bělorusko , 4 3 Putin a Tymošenková se dohodli na plynu , 5 3 Architekt Jan Kaplický zemřel , 6 3 V Praze byl zahájen Mezinárodní rok astronomie 2009 , 7 3 Žilina se připojí k městům, kde je zakázáno popíjení alkoholu na veřejnosti , 8 3 Z berlínské galerie ukradena díla Picassa, Matisse, Braqua a dalších , 9 2 Požár v Bangkoku si vyžádal nejméně 59 mrtvých , 10 1 Britská Dolní sněmovna odmítla lidové hlasování o lisabonské smlouvě

fev 2009: 1 4 Vlakové neštěstí u Polomky na Slovensku si vyžádalo 12 obětí , 2 3 Remíza v izraelských volbách , 3 1 Čína vydala zprávu hodnotící stav lidských práv v USA

mar 2009: 1 3 Izraelský prezident v Česku , 2 3 Liberec: Obchodní dům Ještěd ustoupí nové výstavbě , 3 3 Nové lampy nad přechody nahradily reflektory , 4 2 V Třebíči jezdí první autobus na CNG

abr 2009: 1 4 Ostuda. Maďarští fanoušci pískali během hymny , 2 4 Komunita open source představuje své výsledky na devátém LinuxExpu , 3 3 Iveta Radičová se vzdala poslaneckého mandátu , 4 3 O Jílovské zlato 2009 , 5 2 Třebíčí se běžel jubilejní Běh na Hrádku , 6 1 V Haagu začal soud s chorvatským generálem Gotovinou

mai 2009: 1 6 Vajíčkové útoky na Jiřího Paroubka vyvrcholily v Praze , 2 3 Kinského zahrada v Praze hostí o víkendu Národopisné slavnosti , 3 3 Teplý konec května přerušila bouřka , 4 3 Knihy všemi pěti smysly , 5 2 Odborná literatura na Světě knihy , 6 2 Mezinárodní konference Bolidy a pády meteoritů , 7 2 Vichřice a kroupy přerušily pálení čarodějnic

jun 2009: 1 5 Král popu Michael Jackson zemřel , 2 3 Microsoft spustil nový vyhledávač , 3 2 Zpráva o smrti Michaela Jacksona přetížila servery po celém světě , 4 2 První oběť prasečí chřipky v Evropě

jul 2009: 1 4 Byla podepsána smlouva o plynovodu Nabucco, Evropa chce snížit závislost na Rusku , 2 3 Objevte dno brněnské přehrady , 3 3 Zpráva o smrti Michaela Jacksona přetížila servery po celém světě , 4 2 Nastane vražda české vědy? , 5 1 Pavel Zelený opět šéfuje CERMAT

ago 2009: 1 3 Otevření Keplerova muzea a Keplerova konference , 2 3 9,58 - nový světový rekord v běhu mužů na 100 m , 3 3 Zemřela Eunice Kennedyová , 4 3 Zemřela inovátorská houslařka Carleen Hutchinsová , 5 3 V New Yorku se homosexuálové berou i přes zákaz , 6 2 Zemřel spisovatel James Lord , 7 2 Před 40 lety potlačila armáda vzpomínku na okupaci

set 2009: 1 3 Česká republika bude po 29 letech hrát finále Davisova poháru , 2 3 Předčasné volby odloženy , 3 2 I ve Střešovicích se staví tunel Blanka , 4 2 Black Sun Empire vystoupili na akci Take Control v Praze , 5 2 Železniční nadšenci mají tento týden žně , 6 2 Kosovo neuznáme, vzkázal Fico Cvetkovićovi , 7 1 Třebíčští fotografové vystavovali pod širým nebem

out 2009: 1 5 Staré zámecké schody opět v provozu , 2 4 Prezident Klaus udělil státní vyznamenání. Válečným hrdinům, Gottovi či Váňovi , 3 3 Japonsko se nechce vyrovnat se sexuálními otrokyněmi , 4 3 Brzký sníh zaskočil Českou republiku , 5 2 Lisabonská smlouva vstoupí v platnost 1. prosince , 6 2 Na Maltě začal filmový festival , 7 2 Biljana Plavšićová bude dnes propuštěna , 8 2 Amnesty International: Izrael omezil dodávky vody Palestincům , 9 2 Nová metoda odhalení padělků léků se zkouší ve Švédsku , 10 1 Zmrzlinou proti vedlejším účinkům chemoterapie

nov 2009: 1 4 Studenti si připomněli 20. výročí Sametové revoluce , 2 3 V Nepálu byly obětovány statisíce zvířat , 3 3 Střelba na americké základně Fort Hood si vyžádala 12 mrtvých , 4 2 Evropský šampionát v gymnastickém aerobiku poprvé hostilo Česko

dez 2009: 1 4 Izraelský Ústav soudního lékařství odebíral v 90. letech nezákonně orgány , 2 4 Odpůrce inzultoval Berlusconiho na mítinku v Miláně , 3 3 Wikikonference 2009 , 4 2 Jančíkův mluvčí odstraňoval informace z Wikipedie

jan 2010: 1 3 Mozek nezvládne všechny naše přátele na Facebooku , 2 2 Za týden skončí pravidelná svatohorská výstava betlémů , 3 1 Apple představil nový iPad

fev 2010: 1 3 Česká Wikipedie už má více než 150 tisíc článků , 2 2 Ministři Kohout a Pecina budou kandidovat za ČSSD

mar 2010: 1 2 Webové portály Atlas a Centrum se spojují , 2 2 Webová stránka s holandským protiislámským filmem uzavřena , 3 2 Pákistánská snaha o blokování YouTube možná zavinila její výpadek , 4 2 Evropská komise pokutovala Microsoft za nedodání klíčových údajů konkurentům , 5 2 Boeing 747 poprvé letěl zčásti na biopalivo , 6 2 Rodiče zemřelého mladíka, kteří dali přednost modlitbám před lékaři, odsouzeni na 16 měsíců , 7 1 První tramvajová trať s bezžlábkovými kolejemi v Praze povede na Lehovec

abr 2010: 1 4 Letecká doprava je nadále ovlivňována popelem z islandské sopky , 2 3 Únik ropy v Mexickém zálivu se snaží zastavit ponorky , 3 3 Barcelona selhala, Inter vyhrál v semifinále Ligy mistrů 3:1 , 4 3 Byly vyčísleny náklady na české předsednictví EU v roce 2009 , 5 3 V Jižním Tyrolsku vykolejil vlak, minimálně devět mrtvých , 6 3 U Smolenska havarovalo letadlo polské delegace, zemřel polský prezident a řada dalších vrcholných představitelů , 7 3 Obama a Medvěděv podepsali v Praze smlouvu o snížení počtu jaderných hlavic , 8 3 Blízko Velkého bariérového útesu uniká nafta z čínské lodi , 9 2 Muslimové, židé a křesťané běželi společně do Jeruzalému za mír , 10 2 Odsouzený v Utahu bude popraven popravčí četou , 11 2 Ruští hokejisté v přípravě jen remizovali s Itálií , 12 2 Nejvyšší soud Spojených států amerických zrušil zákon proti filmům s týráním zvířat , 13 1 Ropa z potopené věže zasáhla pobřeží Spojených států

mai 2010: 1 5 Wikipedie je obviňována z šíření pornografie, zakladatel Jimmy Wales inicioval kontroverzní a rozsáhlé mazání obrázků , 2 4 Pravice vyhrála české parlamentní volby, Paroubek odchází , 3 4 Děti, které lžou, budou v dospělosti úspěšnější , 4 4 Wikimedia Česká republika odměnila na Světě knihy zdatné wikipedisty , 5 4 Novým premiérem Spojeného království je David Cameron, konzervativci se spojili do koalice s liberály , 6 1 Německý prezident Köhler znenadání odstoupil

jun 2010: 1 3 Spojené arabské emiráty zavřely 40 firem nelegálně obchodujících s Íránem , 2 3 Jukio Hatojama rezignoval na funkci japonského premiéra , 3 2 Při razii v Belgii policie vrtala i do hrobek , 4 2 Při vykolejení vlaku v Kongu zahynulo přes sedmdesát cestujících , 5 1 U Ústí nad Labem vykolejil vlak, strojvůdce zemřel

jul 2010: 1 3 Mistry světa jsou fotbalisté Španělska , 2 3 Letadlo na sluneční pohon létalo celý den a noc , 3 2 Podle analytiků Eritrea nepodporuje al-Šabáb , 4 2 Kanada oznámila plán nakoupit 65 stíhaček F-35 za 9 miliard dolarů , 5 2 Do Ulan-Ude se sjeli Mongolové z celého světa , 6 2 Raoul Mout hledaný v Anglii pro podezření z vraždy se zastřelil , 7 2 Spojené státy americké se dohodly s Ruskou federací na výměně vězňů , 8 1 Atol Bikini, dějiště jaderných testů, se stal světovým dědictvím

ago 2010: 1 4 Ašské letní slavnosti se dočkaly i přes nepřízeň počasí vysoké účasti , 2 2 Muž se samopalem střílel a zabíjel na bratislavském sídlišti , 3 2 Při sebevražedném útoku v Mogadišu zahynuly tři desítky lidí , 4 2 Silný déšť v Číně zhoršuje situaci po záplavách , 5 2 Lidé v Aši se bouří proti úpravám sadů Míru

set 2010: 1 4 Tramvaje se po rekonstrukci vrátily do Řep , 2 2 Zemřel herec Radovan Lukavský , 3 1 Slovinský cyklista Jure Robič zahynul při dopravní nehodě

out 2010: 1 4 V Praze dnes poprvé s cestujícími vyjela tramvaj Škoda 15T , 2 3 Ikebana na Hradě , 3 2 Navzdory stávkám francouzský parlament schválil důchodovou reformu , 4 2 Mike Godwin opouští nadaci Wikimedia , 5 2 English Heritage vyzvalo komerční fotografy, aby platili za obrázky Stonehenge , 6 2 Nedostatek bavlny vyhnal její cenu k historickému rekordu , 7 1 Četník zastřelený Nikolou Šuhajem má v Příbrami pomník

nov 2010: 1 4 Severní Korea zabíjela při útoku na jihokorejský ostrov , 2 3 Pražané protestovali proti magistrátní koalici , 3 2 Světoví politici jednali o záchraně tygrů , 4 2 Prince ulovila Kate i dostihoví fanoušci , 5 2 Organizátoři Dne hněvu v Moskvě musejí na několik dní do vězení , 6 2 Český ministr dopravy nesmí půl roku řídit auto , 7 2 Bývalý předseda československého ústavního soudu byl zastřelen , 8 1 Jižní Korea a Spojené státy odpoví na severokorejský útok dalšími manévry

dez 2010: 1 2 Čína si připomněla 117. výročí narození Mao Ce-tunga , 2 2 Portmanová září v Černé labuti plné stereotypů , 3 2 Zemřel Richard Holbrooke , 4 2 Požár v chilské věznici zabil 83 lidí , 5 2 V Ústí začal provoz nové lanovky na Větruši , 6 2 Po srážce s autem zemřelo v Itálii osm cyklistů , 7 1 Sparta na Spenglerově poháru neuspěla

jan 2011: 1 3 V Egyptě krvavé protesty, Mubarak rozpustil vládu , 2 3 Sebevražedný atentátník zabil na moskevském letišti 35 lidí , 3 3 Jihokorejské námořnictvo osvobodilo unesenou loď , 4 3 Čínu s Ruskem spojil první ropovod

fev 2011: 1 3 Kanadský Whistler zaplnili milovníci psů, vadí jim odhalený loňský masakr , 2 3 Egyptská armáda nepoužije proti demonstrantům sílu , 3 2 Z Libye uteklo na 100 tisíc běženců , 4 2 V Praze pomalu končí tramvaje Tatra T3 , 5 2 Ve věku 84 let zemřel protipotratový bojovník Bernard Nathanson , 6 2 Australské město se na měsíc přejmenuje, aby propagovalo silniční bezpečnost , 7 2 Bahrajnská pořádková policie vytlačila demonstranty z Perlového náměstí , 8 1 Rusky v čele s Kanajevovou ovládly první díl grand prix moderních gymnastek

mar 2011: 1 9 Japonsko zasáhlo silné zemětřesení, vlny cunami pustoší Pacifik , 2 3 Začaly letecké údery na Libyi , 3 2 Dva lidé silně ozářeni v elektrárně Fukušima , 4 2 Měsíc bude nejblíž k Zemi za posledních 19 let , 5 2 Rada bezpečnosti vyhlásila bezletovou zónu nad Libyí , 6 2 Japonská krize útočí na celosvětovou budoucnost jaderné energetiky , 7 2 Odborníci zatím marně usilují o nápravu situace v elektrárně Fukušima , 8 2 Spojené státy americké dále zkoušejí bezpilotní kosmickou loď , 9 2 V Praze pomalu končí tramvaje Tatra T3 , 10 1 Japonsko je v maximální pohotovosti, vyhlásil premiér kvůli Fukušimě

abr 2011: 1 4 Školák v Gaze zemřel na následky raketového útoku , 2 3 Vládní koalice utrpěla porážku ve finských volbách , 3 3 V Ohiu popravili dvojnásobného vraha , 4 2 Bill Gates má největší podíl v kanadských železnicích , 5 1 Praha žila Dnem tance

mai 2011: 1 3 Srbové chytili Mladiće, půjde před tribunál v Haagu , 2 2 Barcelona vyhrála Ligu mistrů, zdolala Manchester 3:1 , 3 2 Věřitelé poslali Sazku do konkurzu , 4 2 Číňanka dostala cenu Benois za výkon v Bubeníčkově choreografii , 5 2 Islandská sopka znovu blokuje lety nad Evropou, Ryanairu se to nelíbí , 6 2 John obhájil v elektronické volbě post předsedy Věcí veřejných , 7 2 Mistrem fotbalové ligy je poprvé Viktoria Plzeň , 8 2 Arabští demonstranti se pokusili probít přes hranice do Izraele, ten jich nejméně devět zabil , 9 1 Asadův generální pardon má uklidnit situaci v Sýrii

jun 2011: 1 3 Liová je první čínskou vítězkou na grand slamu v historii , 2 2 Kosmické smetí těsně minulo Mezinárodní vesmírnou stanici , 3 2 Vatikán zprovoznil nový webový portál , 4 2 Jaterní parazit napadá čím dál víc lidí , 5 2 Rakouská policie zabavila vloni drogy za 50 milionů euro , 6 2 Stát New York povolil sňatky homosexuálů , 7 2 Starosta San Sebastiánu dal odstranit obraz španělského krále , 8 2 Diabetes II. typu je možná vyléčitelný , 9 2 Filipíny zasáhly povodně , 10 1 Věci veřejné zůstávají ve vládě, koaliční trojka podepsala dodatek

jul 2011: 1 3 Při neštěstí v ukrajinském dole zahynuly desítky horníků , 2 2 Při teroristickém útoku v Norsku byly zabity desítky lidí , 3 2 News Corp. ustoupila od převzetí společnosti BSkyB , 4 2 Historická budova Národního muzea se naposledy otevřela před rekonstrukcí , 5 1 Americký pat ohledně dluhového stropu trvá

ago 2011: 1 3 Olivová revoluce má zaklepat na dveře Jeruzaléma , 2 3 Plzeň porazila Kodaň i v odvetě a je v Lize mistrů , 3 3 Rusko prozatím zakázalo používání letadel An-12 , 4 3 Nepokoje se rozšířily do Manchesteru, musely být uzavřeny obchody , 5 3 Německý ministr chce po útocích v Oslu omezit internetovou anonymitu , 6 2 Ruská firma chce mít do pěti let hotel na oběžné dráze , 7 2 Spojené státy pohrozily Palestině trestem za jednání v OSN , 8 2 Libyjští povstalci obsadili Tripolis, boje pokračují , 9 1 Kanadský HDP se nečekaně propadl

set 2011: 1 4 Demonstrace proti Bátorovi a na jeho podporu , 2 3 Za pád letadla Lokomotivu Jaroslavl mohl pilot , 3 3 Francouzští muži jsou osamělejší než ženy , 4 3 Floridské školy začaly vynucovat zákaz pokleslých kalhot , 5 2 Amazon představil tablet Kindle. Jmenuje se Fire , 6 2 Tajfun Nesat zasáhl filipínskou Manilu , 7 2 Turecké ženy už pracují i jako taxikářky , 8 2 V Mexiku byly objeveny stopy prvních obyvatel , 9 2 Jerevan oslavil výročí nezávislosti vojenskou přehlídkou , 10 2 Ázerbájdžánští Ell & Nikki mají letošní nejlepší píseň Eurovize , 11 1 Německo podpořilo navýšení záchranného eurofondu

out 2011: 1 3 V Malajsii zahynul motocyklový exmistr světa Simoncelli , 2 3 Fuksa jako ministr zemědělství skončil , 3 2 Benedikt XVI. se obléká parádněji než Jan Pavel II., zjistil El País , 4 2 Tate Gallery chystá výstavu Picassa a jeho následovníků , 5 2 Perth hostí summit Commonwealthu , 6 2 Najef bin Abdulaziz se stal korunním princem , 7 1 Moskevské Velké divadlo se po šestileté obnově znovu otevřelo

nov 2011: 1 3 Československo na úvod fotbalového mistrovství světa podlehlo Severnímu Irsku , 2 3 I Václavské náměstí bylo 22 let po sametové revoluci místem protivládní demonstrace , 3 3 Kvitová vyhrála turnaj mistryň , 4 2 Kanaďané se na ledě poprali se Sověty , 5 2 Národní divadlo shořelo , 6 2 Libyjci zadrželi Sajfa Isláma Kaddáfího , 7 2 Italský premiér Berlusconi odstoupil , 8 2 Tři králové pro sochaře Trbuška představují náročnou pouť , 9 2 Český Krumlov si připomněl 400 let od smrti Petra Voka , 10 2 Plynovod Nord Stream byl uveden do provozu , 11 2 V italské restauraci v Pákistánu vybuchla bomba

dez 2011: 1 11 Zemřel Václav Havel , 2 4 Češi pohřbili svého prezidenta Havla , 3 4 Bývalý izraelský prezident Moše Kacav je ode dneška za mřížemi , 4 3 Zemřel severokorejský vůdce Kim Čŏng-il , 5 2 V Praze dojezdily tramvaje Tatra T3 , 6 1 Maďarský zákon dává socialistům vinu za komunistický režim

jan 2012: 1 7 Stop SOPA! , 2 6 1. leden 2012 , 3 5 Sue Gardnerová pro Wikizprávy: Wikipedie zhasnutím dosáhla zvýšení povědomí o SOPA , 4 5 2. leden 2012 , 5 5 Jafa Jarkoniová zemřela , 6 4 Britové mají novou kampaň na resuscitace , 7 4 4. leden 2012 , 8 4 3. leden 2012 , 9 4 Zemřel bývalý makedonský prezident , 10 3 29. leden 2012 , 11 3 Sto mrtvých následkem vadných léků v pákistánském Láhauru , 12 3 26. leden 2012 , 13 3 19. leden 2012 , 14 3 7. leden 2012 , 15 2 27. leden 2012 , 16 2 Tokio zasáhne podle vědců v nejbližší budoucnosti zemětřesení , 17 2 24. leden 2012 , 18 2 23. leden 2012

fev 2012: 1 3 Zemřel Antonín Vítek, propagátor kosmonautiky a spolutvůrce Wikipedie , 2 3 Tisíce lidí se v ČR přidaly k mezinárodnímu protestu proti ACTA , 3 3 Mění se česká ústava, senát do ní schválil přímou volbu prezidenta , 4 3 „STOP ACTA“ se ozývá z dalších měst , 5 3 „STOP ACTA“ znělo před Pražským hradem , 6 2 Odsouzený Dohnal končí v čele NKÚ , 7 2 Internetová dohoda vyvolala rozhořčení napříč Evropou , 8 2 11 lidí zahynulo při nehodě v kanadském Ontariu

mar 2012: 1 4 Končí vydávání tištěné Encyclopædia Britannica , 2 2 V Egyptě pohřbili papeže Koptské pravoslavné církve , 3 1 Dobeš podal demisi, Klaus ho jako ministra pochválil

abr 2012: 1 2 Connecticut zrušil trest smrti , 2 2 Pirate Parties International v Praze , 3 2 Český stát ocenil účastníky třetího odboje , 4 2 Soud přerušil egyptské zákonodárné shromáždění , 5 2 Malijští rebelové předají moc civilní vládě , 6 2 Papež ve velikonočním projevu vyzval k míru v Sýrii , 7 1 Pan Ki-mun je v Barmě, pro vládu i opozici

mai 2012: 1 3 Řecké volby bez jasné většiny, první zkusí sestavit koalici konzervativci , 2 2 V Pákistánu krátce blokovali Twitter kvůli obrázkům Mohameda , 3 2 Chelsea s Čechem vyhrála poprvé Ligu mistrů , 4 2 V primárkách demokratů v Západní Virginii získal 41 % vězeň , 5 2 Demolice plzeňského kulturního domu pomalu končí, azbest prý lidi neohrožuje , 6 2 Putin je znovu ruským prezidentem, má za sebou slib , 7 1 Devět zraněných po nehodě autobusu a železniční drezíny

jun 2012: 1 3 Rath ve sněmovně označil svůj případ za politický, poslanci ho ale vydali stíhání , 2 2 Americký zpěvák Loomis žaluje anglickou zpěvačku Cornishovou kvůli porušení autorských práv , 3 2 V Českých Budějovicích se diskutovalo o dostavbě 3. a 4. bloku Temelína , 4 2 Český pacient jako první člověk na světě žije už 70 dní s pumpou místo srdce

jul 2012: 1 5 Ruská Wikipedie protestuje proti plánované cenzuře Internetu , 2 3 V Nitře právě probíhá 6. ročník Letní školy esperanta , 3 3 Vážná nehoda na tahu Praha-Karlovy Vary zkomplikovala dopravu , 4 2 Záplavy v Nigérii mají desítky obětí , 5 2 12 mrtvých po masakru na premiéře Batmana , 6 2 Zákon o černé listině pro ruský Internet prošel, wikipedisté protestovali marně , 7 2 Odložený verdikt volebních komisařů: Egyptským prezidentem je Mursí , 8 1 Stovky milionů Indů jsou bez elektřiny

ago 2012: 1 2 Po 20 letech od rozdělení si Češi a Slováci přestávají rozumět

set 2012: 1 5 Ministr zdravotnictví kvůli otravám vyhlásil prohibici , 2 4 Výrobci protestují proti prohibici , 3 1 Nejméně sedmnáct cestujících zemřelo následkem pádu mahárášterského autobusu z mostu do řeky

out 2012: 1 3 Skončily volby do krajských zastupitelstev a třetiny Senátu 2012 , 2 2 Hurikán Sandy potopil repliku Bounty , 3 2 Začala vysílat televize Nova , 4 2 Pražské podzimní tramvajové výluky , 5 1 V ukrajinských volbách vítězí Janukovyč, většina je ale nejasná

nov 2012: 1 5 17. listopad 2012 , 2 4 25. listopad 2012 , 3 4 Češi vyhráli Davisův pohár , 4 4 16. listopad 2012 , 5 3 26. listopad 2012 , 6 3 Po dramatickém finiši v Brazílii získal Vettel třetí světový titul , 7 3 Jihočeské školy zasáhla hodinová stávka studentů , 8 3 18. listopad 2012 , 9 2 29. listopad 2012 , 10 2 28. listopad 2012 , 11 1 30. listopad 2012

dez 2012: 1 3 Sondy Grail ukončí svou misi nárazem do Měsíce , 2 3 5. prosinec 2012 , 3 2 30. prosinec 2012 , 4 2 28. prosinec 2012 , 5 2 27. prosinec 2012 , 6 2 22. prosinec 2012 , 7 2 Nastal zimní slunovrat , 8 2 21. prosinec 2012 , 9 2 20. prosinec 2012 , 10 2 18. prosinec 2012 , 11 2 Studenti: Nemůžeme za špatný psychický stav paní Baborové

jan 2013: 1 4 4. leden 2013 , 2 3 30. leden 2013 , 3 3 20. leden 2013 , 4 3 Sečteno první kolo prezidentských voleb, postupují Zeman a Schwarzenberg , 5 3 1. leden 2013 , 6 2 29. leden 2013 , 7 2 27. leden 2013 , 8 2 26. leden 2013 , 9 1 Vítězslava Baborová rezignovala

fev 2013: 1 4 18. únor 2013 , 2 4 14. únor 2013 , 3 4 Papež Benedikt XVI. koncem února rezignuje , 4 4 11. únor 2013 , 5 4 10. únor 2013 , 6 4 3. únor 2013 , 7 3 15. únor 2013 , 8 3 13. únor 2013 , 9 3 12. únor 2013 , 10 2 21. únor 2013 , 11 2 19. únor 2013 , 12 2 Finále Mistrovství ČR v ledové ploché dráze 2013 , 13 1 Novým patriarchou bulharské pravoslavné církve je Neofyt

mar 2013: 1 4 Abelovu cenu za rok 2013 získal Pierre Deligne , 2 4 Novým papežem se stal Argentinec Bergoglio, přijal jméno František , 3 4 13. březen 2013 , 4 3 Vettel vyhrál Velkou cenu Malajsie F1 , 5 3 15. březen 2013 , 6 3 12. březen 2013 , 7 3 Američané objevili transneptunickou planetu , 8 2 19. březen 2013 , 9 1 27. březen 2013

abr 2013: 1 5 Venezuela má nového prezidenta , 2 5 Zemřela Železná lady – bývalá britská premiérka Margaret Thatcherová , 3 4 22. duben 2013 , 4 4 Obrazem: První minuty po explozích v Bostonu , 5 4 11. duben 2013 , 6 4 Napětí v Severní Koreji: Rozhovor se Scottem Snyderem a Robertem Kellym , 7 3 Výbuch továrny ve Westu srovnal část města se zemí , 8 3 Na Bostonském maratonu explodovaly dvě nálože , 9 3 15. duben 2013 , 10 3 12. duben 2013 , 11 3 Met obdrželo unikátní dar , 12 2 29. duben 2013 , 13 2 Syrský premiér přežil bombový útok , 14 2 Nizozemský diplomat odsouzen na 12 let vězení za špionáž pro Rusko , 15 1 Bollywood má už 100 let

mai 2013: 1 4 27. květen 2013 , 2 4 15. květen 2013 , 3 4 7. květen 2013 , 4 3 25. květen 2013 , 5 3 16. květen 2013 , 6 2 26. květen 2013 , 7 2 Čínská policie opět blokuje mariánské oslavy v Tung-lü , 8 2 24. květen 2013 , 9 2 23. květen 2013 , 10 2 Nový světový rekord v bezdrátovém přenosu dat , 11 2 22. květen 2013 , 12 2 Wikizprávy slaví páté výročí , 13 2 19. květen 2013 , 14 2 18. květen 2013 , 15 1 31. květen 2013

jun 2013: 1 5 Obrazem: Čechy sužuje velká voda , 2 4 1. červen 2013 , 3 3 Wikicitáty mají pět tisíc stránek , 4 3 13. červen 2013 , 5 3 2. červen 2013 , 6 2 24. červen 2013 , 7 2 14. červen 2013 , 8 1 Nico Rosberg se stal vítězem VC Británie

jul 2013: 1 2 7. červenec 2013 , 2 2 29. červen 2013 , 3 1 V Martinu právě probíhá 7. ročník Letní školy esperanta

ago 2013: 1 3 Padesát tisíc hesel českého Wikislovníku , 2 1 20. srpen 2013

set 2013: 1 2 Rozhovor s odborníky o čínské, íránské a ruské podpoře Asadova režimu

out 2013: 1 2 Zemřela Marcia Wallaceová, hlas učitelky Edny Krabappelové ze Simpsonových , 2 2 Zemřel Lou Reed , 3 2 Skončily mimořádné volby do Poslanecké sněmovny Parlamentu ČR , 4 2 Adobe postihl rozsáhlý únik citlivých dat , 5 2 1. říjen 2013 , 6 1 31. říjen 2013

nov 2013: 1 3 Tajfun Haiyan zabil více než 1000 osob , 2 2 Fotopast ve Vietnamu zaznamenala kriticky ohroženou saolu , 3 2 7. listopad 2013 , 4 2 Matoušovo evangelium inspirací k heslům pro dny mládeže , 5 2 6. listopad 2013 , 6 2 2. listopad 2013 , 7 2 30. říjen 2013 , 8 1 26. listopad 2013

dez 2013: 1 1 3. květen 2013

jan 2014: 1 2 Z Varšavy do Poznaně rychlostí 250 km/h , 2 1 Vyšel LibreOffice 4.2: změny v uživatelském prostředí i ve zdrojovém kódu

fev 2014: 1 5 První letošní české olympijské zlato: Samková je vítězkou , 2 4 Obrazem: V Kyjevě propukla pouliční válka , 3 4 Sáblíková neobhájila zlato na trojce, ale je druhá , 4 4 McDonald's otevřel první pobočku ve Vietnamu , 5 3 V Praze se sešlo několik set lidí na podporu protestů na Ukrajině , 6 3 Čeští biatlonisté zažívají žně, ve smíšené štafetě stříbrní , 7 3 Čeští hokejisté vyřadili v Soči Slovensko a postupují do čtvrtfinále , 8 2 Během protestů na Ukrajině zemřel přispěvatel do Wikipedie a Wikizpráv , 9 2 20. únor 2014

mar 2014: 1 5 Kyjev zakázal ruské televize, Moskva protestuje , 2 5 Ruská vojska se houfují na ukrajinských hranicích , 3 4 Poslankyni hrozí až desetiletý trest, popírá justiční vraždu , 4 4 Rusko očekává odliv zahraničního kapitálu , 5 3 Tři roky vězení za organizaci fotografování nahých dětí , 6 1 Zemřel katalánský kněz a teolog Modest Prats

abr 2014: 1 5 Rusko označilo zasedání Rady bezpečnosti OSN o Krymu za nevhodné , 2 4 Lipnická a další moskevští vítězové ze Soči dostanou byty , 3 4 Generální prokurátor: V Rusku je více než tisíc neprávem zadržovaných , 4 4 Vladimir Kličko sní o startu na olympiádě v Riu , 5 4 Britské stíhačky startovaly kvůli ruským bombardérům , 6 4 Ruský ministr zahraničí vyhrožuje Ukrajině válkou , 7 4 Hlavní vyjednavač mise OBSE se setkal s vůdcem separatistů ve Slovjansku , 8 4 Primátorské volby v Novosibirsku vyhrál komunista Lokoť , 9 4 Evropa je a bude závislá na dodávkách ruského plynu , 10 4 Ministr vnitra rozpustil samosprávu města Battipaglia kvůli infiltraci mafií , 11 4 Žirinovskij chce z Dumy vyhnat poslance, kteří nesouhlasí s připojením Krymu , 12 4 Indické státní instituce přecházejí na Linux, končí podpora Windows XP , 13 3 Slovensko bude dodávat Ukrajině plyn , 14 3 Generální prokurátor Krymu varuje Tatary , 15 3 Silný vítr zabíjel a působil škody v Omské oblasti , 16 3 Chodorkovskij: Nesouhlasíme s Putinovou politikou k Ukrajině , 17 3 Čínský soud zamítl žalobu kvůli znečištění vody ve městě Lan-čou , 18 3 Divadlo Na Tagance oslavilo 50 let existence

mai 2014: 1 3 Teplé počasí plní pláže , 2 3 Minkult zakázal promítání filmu o sovětském válečném zločinu v Čečensku , 3 3 Ve Volgogradu po prosincovém útoku znovu otevřeli nádraží , 4 3 Prvomájové oslavy v Rusku byly největší v Moskvě a v Simferopoli , 5 3 Německo bude rozvíjet mírovou spolupráci s Ruskou federací , 6 2 Putin vyznamenal hokejové mistry světa z Minsku , 7 1 Eschenbach a Lang Lang hráli s Vídeňskými filharmoniky v Schönbrunnu

jun 2014: 1 4 Na seznamu UNESCO je už přes 1000 památek. , 2 4 Ricciardo zvítězil ve VC Kanady , 3 3 Stoletý stíhací pluk v Buturlinovce oslavili, brzy ho i obnoví , 4 3 Ruské děti pojedou do ozdravoven na Krymu , 5 2 Většině bytových družstev hrozí pokuty i likvidace , 6 2 Nový španělský král Filip složil slib , 7 2 V Brazílii začalo mistrovství světa ve fotbale, domácí porazili Chorvatsko

No data on this page have been normalized to 30 day months (as WMF does on certain traffic reports).
Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Sábado, 2 de agosto 2014 20:39

Dump file cswikinews-20140725-pages-meta-history.xml.7z (full dump), size 4.2 Mb as 7z -> 158 Mb
Dump processed till Jun 30, 2014, on server stat1002, ready at Fri-25/07/2014-14:49 after 23 sec.

Versão do script:2.6
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.