Estatísticas da Wikinotícias albanês

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist

Metrics have been collected from a full archive dump, which contains all revisions of every article, meta data and raw content.
See also metrics definitions


 
Monthly counts & Quarterly rankings: dezembro 2012
 
DataWikinoticiaristasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
dez 2012    0%    0%0%0%+13%0%0%0%
set 2012    0%    -0%-0%0%-2%0%0%0%
jul 2012    0%    0%0%0%+3%0%0%0%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
dez 20128 11716 4,213655161,2 Mb164 k3913535479324
nov 20128   715 3,41367 1,2 Mb164 k3911935479124
out 20128   715 3,4136721,2 Mb164 k3911935479124
set 20128 1 714 3,4136761,2 Mb163 k3911935378924
ago 20128   714 3,41367 1,2 Mb163 k3912235378924
jul 20128 1 714 3,4136761,2 Mb163 k3912235378924
jun 20128   713 3,41365 1,2 Mb163 k3911935278724
mai 20128 1 713 3,41365311,2 Mb163 k3911935278724
abr 20128 1 711 3,41365171,2 Mb162 k3711935078218
mar 20128 21710 3,413651101,2 Mb162 k3711734978017
fev 20128 1 701 3,31359361,1 Mb159 k3710734376317
jan 20128 1 697 3,21349311,1 Mb157 k3710734175416
dez 20118 11695 3,213481351,1 Mb157 k379533974815
nov 20118 1 692 3135091,1 Mb156 k378833774215
out 2011812 691 31350231,1 Mb156 k378833773915
set 20117   690 31349 1,1 Mb156 k376933673715
ago 20117 2 690 31349171,1 Mb156 k376933673715
jul 20117 1 686 31351461,1 Mb155 k376933673214
jun 20117 2 683 2,91344181,1 Mb154 k385332671213
mai 20117 3 67522,913441471,1 Mb152 k375132369613
abr 2011723162232,913601621,0 Mb141 k363030963510
mar 2011514252453,21391726894 kb122 k35302625328
fev 20114 2 373 2,5144851660 kb90 k25491473745
jan 20114 2 35932,51454147638 kb87 k25491403594
dez 2010413227962,61576472526 kb74 k23491062734
nov 201032317933,41811256161 kb24 k14926833
out 20101   1 9146214,7 kb20974942 
set 20101   1 81463 4,7 kb20974942 
ago 20101   1 8146314,7 kb20974942 
jul 20101   1 7146314,7 kb20974942 
jun 20101   1 61463 4,7 kb20974942 
mai 20101   1 6146344,7 kb20974942 
abr 20101   1 21955 4,9 kb27812231 
mar 20101   1 21955 4,9 kb27812231 
fev 20101   1 21955 4,9 kb27812231 
jan 20101   1 21955 4,9 kb27812231 
dez 20091   1 21955 4,9 kb27812231 
nov 20091   1 21955 4,9 kb27812231 
out 20091   1 21955 4,9 kb27812231 
set 20091   1 21955 4,9 kb27812231 
ago 20091   1 21955 4,9 kb27812231 
jul 20091   1 21955 4,9 kb27812231 
jun 20091   1 2195514,9 kb27812231 
mai 20091   1 11955 4,9 kb27812231 
abr 20091   1 11955 4,9 kb27812231 
mar 20091   1 11955 4,9 kb27812231 
fev 20091   1 11955 4,9 kb27812231 
jan 20091   1 11955 4,9 kb27812231 
dez 20081   1 11955 4,9 kb27812231 
nov 20081   1 11955 4,9 kb27812231 
out 20081   1 11955 4,9 kb27812231 
set 20081   1 11955 4,9 kb27812231 
ago 20081   1 11955 4,9 kb27812231 
jul 20081   1 11955 4,9 kb27812231 
jun 200811  1 1195514,9 kb27812231 
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
 WikinoticiaristasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikinoticiaristas (usuários registrados)
A = Wikinoticiaristas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikinoticiaristas que editaram pelo menos dez vezes desde que chegaram
C = Wikinoticiaristas que contribuíram cinco vezes ou mais este mês
D = Wikinoticiaristas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1  3  5  10  25  1  3  5  10  25  100  250  5  10 
dez 20125111111 31111 92111    
nov 2012            311      
out 20121           521    1 
set 2012111          322    11
ago 2012      3     622      
jul 2012111          61       
jun 2012            411      
mai 20121111   1     7111     
abr 20121111   21    322      
mar 2012322111  31    85211  1 
fev 201211111  2     74221    
jan 20124111   211   532211 3 
dez 2011211111  3111  52111    
nov 2011111    421   922111   
out 20116221   3     532    11
set 2011            411      
ago 2011322    1     81111    
jul 201133111  2     932111   
jun 2011222    3     124311    
mai 201183332  321   1155322 11
abr 2011333321  41    114432  11
mar 20118443321 7422  301196422  
fev 201133221        22222    
jan 201132222  1     432221   
out 20121           521    1 
jul 2012111          61       
abr 20121111   21    322      
jan 20124111   211   532211 3 
out 20116221   3     532    11
jul 201133111  2     932111   
abr 2011333321  41    114432  11
jan 201132222  1     432221   
out 20101                    
jul 20101                    
abr 2010                     
jan 2010                     
out 2009                     
jul 2009                     
abr 2009                     
jan 2009            1        
out 2008                     
jul 2008                     

 

Distribuição de edições de artigos por wikinoticiaristas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikinoticiaristasEdições total
131100.0%2,916100.0%
31341.9%2,89499.2%
10722.6%2,86598.3%
32619.4%2,85497.9%
100516.1%2,79295.7%
316412.9%2,60089.2%

 

5 wikinoticiaristas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions
agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
OlsiUC1+19825061,11572abr 01, 2011639321--
LaslovargaUC13 041--out 21, 2011436----
KrassotkinUC17...22--dez 15, 201215----
JaumeBGUC30...11--dez 15, 201215----
HosiryuhosiUC31...113-dez 15, 201215----

 

20 wikinoticiaristas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
Mikullovci11UC2797nov 26, 2010765mar 31, 2012274
LaijmovaUC3418nov 13, 2010778mar 13, 2011658
SPQRobinUC4403mar 18, 2011653mar 18, 2011653
Olsi HysaUC5192out 08, 2010814mar 08, 2011663
DardaniusUC662abr 23, 2011617ago 02, 2011516
Albanian04UC711out 12, 2011445out 20, 2011437
CommonsDelinkerUC86dez 07, 2010754mar 03, 2011668
XiglofreUC96mai 03, 2011607jul 23, 2011526
PlanetiUC105mar 19, 2011652mar 19, 2011652
WikiLajmUC114dez 06, 2010755dez 06, 2010755
XalDUC124out 20, 2011437dez 19, 2011377
RomaineUC142mai 08, 2010967jul 24, 2010890
KurreshtjaUC152nov 24, 2010767nov 24, 2010767
EuriditiUC162mai 03, 2011607mai 03, 2011607
CradelUC181jun 13, 20081661jun 13, 20081661
JosephUC191jun 03, 20091306jun 03, 20091306
Andrijko Z.UC201ago 24, 2010859ago 24, 2010859
Microchip08UC211mar 24, 2011647mar 24, 2011647
UC221mar 26, 2011645mar 26, 2011645
AlexanderpsUC231mai 02, 2011608mai 02, 2011608

  

5 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
GrondinBotUC16out 24, 2011433dez 16, 201214--
VolkovBotUC23jun 15, 2011564abr 16, 2012258--
MjbmrbotUC32mar 24, 2011647mar 24, 2011647--
KamikazeBotUC41out 19, 2011438out 19, 2011438--
CarsracBotUC51jan 21, 2012344jan 21, 2012344--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110
dez 201275721868 722441726285    511
nov 201275621266 692401724284     
out 201275621166 692401724284    2
set 201275520766 692401722284    6
ago 201275520166 692391722284     
jul 201275518866 692381721284    6
out 201275621166 692401724284    2
jul 201275518866 692381721284    6
abr 201274416666 672371719282    16
jan 201272812950 642201704282    28
out 201172110130 261821642212    21
jul 20117158130 26181 605212    44
abr 20116334718 7113 48218     162
jan 2011362 4  66 3359     146
out 2010     2 1      1
jul 2010     2 1      1
abr 2010     2 1       
jan 2010     2 1       
out 2009     2 1       
jul 2009     2 1       
abr 2009     2 1       
jan 2009     2 1       
out 2008     1 1       
jul 2008     1 1       

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

jun 2008: 1 1 Faqja kryesore

jun 2009: 1 1 Faqja kryesore

mai 2010: 1 1 Faqja kryesore

jul 2010: 1 1 Faqja kryesore

ago 2010: 1 1 Faqja kryesore

out 2010: 1 1 Faqja kryesore

nov 2010: 1 4 Faqja kryesore , 2 3 Facebook po na njeh gjithnjë e më shumë , 3 2 Zvicer, 45 milione dollare per diamantin e kuq , 4 2 Vritet gabimisht qeni-hero , 5 2 Vizat, Basha: Agjencitë të bëjnë kujdes , 6 2 Tragjedi në Fratar , 7 2 Topalli: Progresi i Shqipërisë , 8 2 Tiranë, në pranga gjashtë grabitës , 9 2 Tiranë, festohet 66 vjetori i çlirimit , 10 2 Studentët: Bëni transparencën , 11 2 Shqipëria, e 58-ta në renditjen e FIFA , 12 2 Shqipëri- Maqedoni , 13 2 Shkatërrohet organizata italo-shqiptare , 14 2 Sekuestrohen ushqime të skaduara në supermarkete , 15 2 Rrugët, mblidhen ministrat e rajonit , 16 2 Rama letër Berishës: Hetim materialeve zgjedhore, jo fletëve , 17 2 Rama: Xhami e re në Tiranë , 18 2 Rama: Berisha e ka ofertën e socialistëve , 19 2 Nën paralajmërimet për terror - Konferenca e ministrave të Brendshëm në Hamburg , 20 1 Livadhi

dez 2010: 1 3 Faqja kryesore , 2 2 NBA All Star Game: Wade shkëlqen në fitoren e Lindjes , 3 2 Moti në Shqipëri , 4 2 Moti në Maqedoni , 5 1 Zvicer, 45 milione dollare per diamantin e kuq

jan 2011: 1 2 Obama pergezon popullin sudanez , 2 2 Analizë e re gjaku që dallon qelizat kanceroze , 3 2 Faqja kryesore , 4 1 Stamboll: Ulje e detyruar e avionit

fev 2011: 1 2 Shqipëria noton në ujë zgjerohet përmbytja , 2 2 Shkodër 10 mijë ha tokë nën ujë Berisha: Banorët të evakuohen , 3 2 Rëndohet situata nga përmbytjet , 4 1 Zona verilndore:Situate e akseve rrugore eshte permiresuar

mar 2011: 1 4 Faqja kryesore , 2 2 Aurela Gaçe dërgon veri, jug dhe Çamëri në \"Eurosong\" , 3 2 Gjilanasit në Ulqin për karate , 4 2 Pacolli mbështet idenë e minishengenit , 5 2 Wilshere: Do ta fitojmë Ligën e Kampionëve , 6 2 Vizat, Basha: Agjencitë të bëjnë kujdes , 7 2 Vejusha gazmore së shpejti në skenën e Teatrit të Operas , 8 2 Tsunami shkatërron Japoninë, 337 viktima qindra kufoma në plazhe , 9 2 Tri shfaqje ne Teatrin Kombetar , 10 2 Tragjedi në Fratar , 11 2 Topalli: Progresi i Shqipërisë , 12 2 Tiranë, rihapet kinema Agimi , 13 2 Tiranë, në pranga gjashtë grabitës , 14 2 Tiranë, festohet 66 vjetori i çlirimit , 15 2 Studentët: Bëni transparencën , 16 2 Shqiptarët hyjnë në 2011 me çmime të çmendura , 17 2 Shqiptarët duan referendum në Mal të Zi , 18 2 Shkatërrohet organizata italo-shqiptare , 19 2 ShBA: Obama i kërkon Sarkozysë dhe Cameronit një strategji për Libinë , 20 2 Sekuestrohen ushqime të skaduara në supermarkete , 21 2 Rusi, Zeniti fiton Superkupën, mund 1-0 CSKA Moskën , 22 2 Rritja ekonomike, Shqipëria e para , 23 2 Rritet prania ushtarake rreth Libisë 2 luftanije USA, në Kretë , 24 2 Rooney paralajmëron Unitedin: Kujdes nga Arsenali , 25 2 Rikthehen Tre tenorët në Pallatin e Kongreseve

abr 2011: 1 2 Rinis beteja në Misratë, \"Stalingradin\" e Libisë , 2 2 Funeral i përgjakur në Siri: Së paku 8 të vrarë , 3 2 Trupat e Gadafit po tërhiqen nga Misrata , 4 2 Rama: Projektet për Kombinatin i mban peng Iliri e Saliu , 5 2 Pacolli: I gatshëm të respektojë plotësisht aktgykimin e kushtetueses , 6 1 Mposhtet Reali në \"Santiago Bernabeu\"

mai 2011: 1 7 Vritet Osama bin Laden , 2 3 Rezultatet e zgjedhjeve vendore 2011 në Shqipëri/Vlorë , 3 1 Rama: Drejtësia të japë drejtësi

jun 2011: 1 1 Më 6 korrik beteja e fundit ligjore për Tiranën

jul 2011: 1 2 Sudani i Jugut fiton pavarësinë , 2 1 Në plazhin e Durrësit mbytet një 70-vjeçar

ago 2011: 1 2 Arrihet marrëveshja mes KFOR-it dhe palës serbe , 2 2 Berisha me rekord të ri në not , 3 2 Thaçi: Kufiri, çështje ekzistenciale për Kosovën

out 2011: 1 5 Vritet Gadafi , 2 2 Faqja kryesore

nov 2011: 1 1 Kapet i gjallë djali i Gadafit

dez 2011: 1 2 Shuhet Václav Havel , 2 1 Gianni De Biasi zyrtarisht trajneri i kombëtares shqiptare

jan 2012: 1 4 Wikipedia në gjuhën angleze mbyllet për 24 orë , 2 1 Rama: Të hetohen Berisha dhe Basha

fev 2012: 1 2 Livadhi , 2 1 Kandahar, vriten 2 komando shqiptare

mar 2012: 1 2 Francë, 4 viktima në një shkollë hebraike , 2 1 DASH reagon ndaj arrestimeve të fundit në Kosovë dhe Serbi

abr 2012: 1 1 Serbi, Presidenti Tadiç deklaron largimin nga posti; hapet rruga për zgjedhje

mai 2012: 1 1 Tragjedi në Himarë, 14 të vdekur e 19 të plagosur

jul 2012: 1 1 Sipas një studimi, pasiviteti është po aq vdekjeprurës sa duhani

set 2012: 1 1 Sipas një studimi, pasiviteti është po aq vdekjeprurës sa duhani

out 2012: 1 1 Tiranë: Disa grevistë në gjendje të rëndë

dez 2012: 1 5 Dhjetëra të vdekur në një shkollë në SHBA

Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Sábado, 12 de janeiro 2013 06:50

Dump file sqwikinews-20130106-pages-meta-history.xml.7z (full dump), size 916 kb as 7z -> 14 Mb
Dump processed till Dec 31, 2012, on server stat1, ready at Tue-08/01/2013-11:54 after 5 sec.

Versão do script:2.6
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.