Estatísticas da Wikinotícias albanês

Zoom           
 
January 2014: Unfortunately monthly database dump generation is delayed for many wikis. Reports will appear later than usual. Our sincere apologies for any inconvenience caused.
Upd. March 2: Dump generation was restarted on February 12. All dumps are up to date now for December, some not for January, some days to go. This is an intermediate update.

Metrics have been collected from a full archive dump, which contains all revisions of every article, meta data and raw content.
See also metrics definitions


 
Monthly counts & Quarterly rankings: janeiro 2015
 
DataWikinoticiaristasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
jan 2015    0%    +2%+2%+20%0%+7%0% 
set 2014    0%    0%0%0%-13%0%0% 
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
jan 2015911 738 4,11351191,2 Mb167 k481182047944
dez 20148   737 4,11332 1,2 Mb164 k401181907944
nov 20148   737 4,11332 1,2 Mb164 k401181907944
out 20148   737 4,11332 1,2 Mb164 k401181907944
set 20148   737 4,1133251,2 Mb164 k401181907944
ago 20148   736 4,1133131,2 Mb164 k401351907934
jul 20148   736 4,11331 1,2 Mb164 k401351907934
jun 20148   736 4,11331 1,2 Mb164 k401351907934
mai 20148   736 4,11331 1,2 Mb164 k401351907934
abr 20148   736 4,11331 1,2 Mb164 k401351907934
mar 20148   736 4,11331 1,2 Mb164 k401351907934
fev 20148   736 4,1133111,2 Mb164 k401351907934
jan 20148   736 4,1133111,2 Mb164 k401351907934
dez 20138   736 4,11331 1,2 Mb164 k401351907934
nov 20138   736 4,11331 1,2 Mb164 k401351907934
out 20138   736 4,11331 1,2 Mb164 k401351907934
set 20138   736 4,11331 1,2 Mb164 k401351907934
ago 20138   736 4,1133111,2 Mb164 k401351907934
jul 20138   736 4,11331 1,2 Mb164 k401361907934
jun 20138   736 4,1133131,2 Mb164 k401361907934
mai 20138   736 41331 1,2 Mb164 k401351907924
abr 20138   736 4133121,2 Mb164 k401351907924
mar 20138   736 41331 1,2 Mb164 k401351907924
fev 20138 1 736 4133151,2 Mb164 k401351907924
jan 20138   735 41329 1,2 Mb163 k391351907924
dez 20128 11735 413295161,2 Mb163 k391351907924
nov 20128   734 3,31330 1,2 Mb163 k391191907904
out 20128   734 3,3133021,2 Mb163 k391191907904
set 20128 1 733 3,3133061,2 Mb163 k391191907884
ago 20128   733 3,31330 1,2 Mb163 k391221907884
jul 20128 1 733 3,3133061,2 Mb163 k391221907884
jun 20128   732 3,31328 1,2 Mb163 k391191907864
mai 20128 1 732 3,31328311,2 Mb163 k391191907864
abr 20128 1 724 3,31338171,2 Mb162 k371191907814
mar 20128 21722 3,313401101,2 Mb162 k371171907794
fev 20128 1 713 3,21335361,1 Mb159 k371071897624
jan 20128 1 707 3,21328311,1 Mb157 k371071887535
dez 20118 11704 3,113291351,1 Mb157 k37951877475
nov 20118 1 701 3133191,1 Mb156 k37881877415
out 2011812 700 31330231,1 Mb156 k37881877385
set 20117   699 2,91330 1,1 Mb156 k37691877365
ago 20117 2 699 2,91330171,1 Mb156 k37691877365
jul 20117 1 694 2,91333461,1 Mb155 k37691877315
jun 20117 2 690 2,91328181,1 Mb153 k38531807115
mai 20117 3 68222,913281471,1 Mb152 k37511796955
abr 2011723162632,913481621,0 Mb141 k36301776345
mar 2011514252653,21382725892 kb121 k35301765315
fev 20114 2 372 2,5144751658 kb90 k25491463735
jan 20114 2 35832,51453147636 kb87 k25491393584
dez 2010413227862,61576471524 kb73 k23491052724
nov 201032317933,41811256161 kb24 k14926833
out 20101   1 9146214,7 kb20974912 
set 20101   1 81463 4,7 kb20974912 
ago 20101   1 8146314,7 kb20974912 
jul 20101   1 7146314,7 kb20974912 
jun 20101   1 61463 4,7 kb20974912 
mai 20101   1 6146344,7 kb20974912 
abr 20101   1 21955 4,9 kb27812231 
mar 20101   1 21955 4,9 kb27812231 
fev 20101   1 21955 4,9 kb27812231 
jan 20101   1 21955 4,9 kb27812231 
dez 20091   1 21955 4,9 kb27812231 
nov 20091   1 21955 4,9 kb27812231 
out 20091   1 21955 4,9 kb27812231 
set 20091   1 21955 4,9 kb27812231 
ago 20091   1 21955 4,9 kb27812231 
jul 20091   1 21955 4,9 kb27812231 
jun 20091   1 2195514,9 kb27812231 
mai 20091   1 11955 4,9 kb27812231 
abr 20091   1 11955 4,9 kb27812231 
mar 20091   1 11955 4,9 kb27812231 
fev 20091   1 11955 4,9 kb27812231 
jan 20091   1 11955 4,9 kb27812231 
dez 20081   1 11955 4,9 kb27812231 
nov 20081   1 11955 4,9 kb27812231 
out 20081   1 11955 4,9 kb27812231 
set 20081   1 11955 4,9 kb27812231 
ago 20081   1 11955 4,9 kb27812231 
jul 20081   1 11955 4,9 kb27812231 
jun 200811  1 1195514,9 kb27812231 
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
 WikinoticiaristasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikinoticiaristas (usuários registrados)
A = Wikinoticiaristas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikinoticiaristas que editaram pelo menos dez vezes desde que chegaram
C = Wikinoticiaristas que contribuíram cinco vezes ou mais este mês
D = Wikinoticiaristas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1  3  5  10  25  1  3  5  10  25  100  250  5  10  100 
Monthly counts for recent history of wiki
jan 20151111   11    211       
dez 2014      1     3         
nov 2014      21    21        
out 2014      1     2         
set 20141     3     71     111
ago 20142           32     1  
jul 2014                      
jun 2014                   11 
mai 2014      1     1         
abr 2014            7         
mar 2014      2     5         
fev 20141     1     4         
jan 20141     1     6211      
dez 2013      2     5         
nov 2013      1     1211       
out 2013      1     41        
set 2013      21    5211      
ago 20131     2     1         
jul 2013      1     51     1  
jun 2013            21111  21 
mai 2013      1     3      1  
abr 20132           5431      
mar 2013      3     4221   221
fev 2013111    2     31     11 
jan 2013            3      11 
Quarterly counts for entire history of wiki
jan 20151111   11    211       
out 2014      1     2         
jul 2014                      
abr 2014            7         
jan 20141     1     6211      
out 2013      1     41        
jul 2013      1     51     1  
abr 20132           5431      
jan 2013            3      11 
out 20121           521    1  
jul 2012111          61        
abr 20121111   21    222       
jan 201241111  211   522211 3  
out 20116221   3     521    11 
jul 201133111  2     932111    
abr 2011333321  41    114432  11 
jan 201132222  1     432221    
out 20101                     
jul 20101                     
abr 2010                      
jan 2010                      
out 2009                      
jul 2009                      
abr 2009                      
jan 2009            1         
out 2008                      
jul 2008                      

 

Distribuição de edições de artigos por wikinoticiaristas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikinoticiaristasEdições total
140100.0%2,949100.0%
31537.5%2,91498.8%
10820.0%2,88097.7%
32615.0%2,85396.7%
100512.5%2,79194.6%
316410.0%2,59988.1%

 

1 wikinoticiaristas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions
agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
MargottUC7+331615--ago 12, 201417111--

 

20 wikinoticiaristas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
OlsiUC1983abr 01, 20111400ago 14, 2013534
Mikullovci11UC2797nov 26, 20101526mar 31, 20121035
LaijmovaUC3417nov 13, 20101539mar 13, 20111419
SPQRobinUC4402mar 18, 20111414mar 18, 20111414
Olsi HysaUC5192out 08, 20101575mar 08, 20111424
DardaniusUC662abr 23, 20111378ago 02, 20111277
Albanian04UC811out 12, 20111206out 20, 20111198
CommonsDelinkerUC96dez 07, 20101515mar 03, 20111429
XiglofreUC106mai 03, 20111368jul 23, 20111287
PlanetiUC115mar 19, 20111413mar 19, 20111413
PASSWORDUC125fev 18, 2013711fev 18, 2013711
WikiLajmUC134dez 06, 20101516dez 06, 20101516
XalDUC144out 20, 20111198dez 19, 20111138
LaslovargaUC154out 21, 20111197dez 15, 2012776
MjbmrUC163mar 21, 20111411mar 21, 20111411
RomaineUC172mai 08, 20101728jul 24, 20101651
KurreshtjaUC182nov 24, 20101528nov 24, 20101528
EuriditiUC192mai 03, 20111368mai 11, 20111360
Quentinv57UC202fev 12, 20121083fev 12, 20121083
KrassotkinUC212dez 15, 2012776dez 16, 2012775

  

8 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
GrondinBotUC16out 24, 20111194dez 16, 2012775--
VolkovBotUC23jun 15, 20111325abr 16, 20121019--
タチコマ robotUC33jan 10, 20121116mai 23, 2012982--
DexbotUC43set 01, 2014151set 01, 2014151--
MjbmrbotUC52mar 24, 20111408mar 24, 20111408--
KamikazeBotUC61out 19, 20111199out 19, 20111199--
CarsracBotUC71jan 21, 20121105jan 21, 20121105--
JAnDbotUC81jun 13, 2013596jun 13, 2013596--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110
jan 201576328470 662591728287    15
dez 201476128070 662591728287     
nov 201476127770 662591728287     
out 201476127470 662591728287     
set 201476127370 662591728287    2
ago 201476026870 662591728287    3
jul 201475826670 662591728287     
jun 201475826670 662591728287     
mai 201475826670 662591728287     
abr 201475826670 662591728287     
mar 201475826269 662591728287     
fev 201475825869 662591728287    1
jan 201475825569 662591728287    1
dez 201375824469 662591728287     
nov 201375824169 662591728287     
out 201375823569 662591728286     
set 201375823169 662591728286     
ago 201375821369 662591728286    1
jul 201375821169 662591728286     
jun 201375820869 662591728286     
mai 201375820768 662441728286     
abr 201375820668 662441728286    2
mar 201375820468 662441726286     
fev 201375819868 662441726285    5
jan 201375619268 662441726285     
dez 201275618868 662441726285    511
nov 201275518366 632401724284     
out 201275518266 632401724284    2
set 201275417866 632401722284    6
ago 201275417366 632391722284     
jul 201275416566 632381721284    6
jun 201275316166 622381720284     
mai 201275315066 622371720284    29
abr 201274314466 612371719282    16
mar 201274113666 612371717282    109
fev 201273213262 612251707282    32
jan 201272711550 592201704282    28
dez 201172410849 511991691282    133
nov 201172110347 411911688282    9
out 20117209030 251821642212    21
set 20117198430 251811641212     
ago 20117197930 251811641212    15
jul 20117147530 25181 605212    44
jun 20117106221 6152 599201    16
mai 20117025620 6147 550191    144
abr 20116324518 6113 48218     162
mar 20115323017 6101 45916     721
fev 2011376 4  67 4129     51
jan 2011361 4  66 3359     146
dez 2010281 3  46 2479     463
nov 201081 3  30 306     249
out 2010     2 1      1
set 2010     2 1       
ago 2010     2 1      1
jul 2010     2 1      1
jun 2010     2 1       
mai 2010     2 1      1
abr 2010     2 1       
mar 2010     2 1       
fev 2010     2 1       
jan 2010     2 1       
dez 2009     2 1       
nov 2009     2 1       
out 2009     2 1       
set 2009     2 1       
ago 2009     2 1       
jul 2009     2 1       
jun 2009     2 1      1
mai 2009     2 1       
abr 2009     2 1       
mar 2009     2 1       
fev 2009     2 1       
jan 2009     2 1       
dez 2008     1 1       
nov 2008     1 1       
out 2008     1 1       
set 2008     1 1       
ago 2008     1 1       
jul 2008     1 1       
jun 2008     1 1      1

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

jun 2008: 1 1 Faqja kryesore

jun 2009: 1 1 Faqja kryesore

mai 2010: 1 1 Faqja kryesore

jul 2010: 1 1 Faqja kryesore

ago 2010: 1 1 Faqja kryesore

out 2010: 1 1 Faqja kryesore

nov 2010: 1 4 Faqja kryesore , 2 3 Facebook po na njeh gjithnjë e më shumë , 3 2 Zvicer, 45 milione dollare per diamantin e kuq , 4 2 Vritet gabimisht qeni-hero , 5 2 Vizat, Basha: Agjencitë të bëjnë kujdes , 6 2 Tragjedi në Fratar , 7 2 Topalli: Progresi i Shqipërisë , 8 2 Tiranë, në pranga gjashtë grabitës , 9 2 Tiranë, festohet 66 vjetori i çlirimit , 10 2 Studentët: Bëni transparencën , 11 2 Shqipëria, e 58-ta në renditjen e FIFA , 12 2 Shqipëri- Maqedoni , 13 2 Shkatërrohet organizata italo-shqiptare , 14 2 Sekuestrohen ushqime të skaduara në supermarkete , 15 2 Rrugët, mblidhen ministrat e rajonit , 16 2 Rama letër Berishës: Hetim materialeve zgjedhore, jo fletëve , 17 2 Rama: Xhami e re në Tiranë , 18 2 Rama: Berisha e ka ofertën e socialistëve , 19 2 Nën paralajmërimet për terror - Konferenca e ministrave të Brendshëm në Hamburg , 20 1 Livadhi

dez 2010: 1 3 Faqja kryesore , 2 2 NBA All Star Game: Wade shkëlqen në fitoren e Lindjes , 3 2 Moti në Shqipëri , 4 2 Moti në Maqedoni , 5 1 Zvicer, 45 milione dollare per diamantin e kuq

jan 2011: 1 2 Obama pergezon popullin sudanez , 2 2 Analizë e re gjaku që dallon qelizat kanceroze , 3 2 Faqja kryesore , 4 1 Stamboll: Ulje e detyruar e avionit

fev 2011: 1 2 Shqipëria noton në ujë zgjerohet përmbytja , 2 2 Shkodër 10 mijë ha tokë nën ujë Berisha: Banorët të evakuohen , 3 2 Rëndohet situata nga përmbytjet , 4 1 Zona verilndore:Situate e akseve rrugore eshte permiresuar

mar 2011: 1 4 Faqja kryesore , 2 2 Aurela Gaçe dërgon veri, jug dhe Çamëri në \"Eurosong\" , 3 2 Gjilanasit në Ulqin për karate , 4 2 Pacolli mbështet idenë e minishengenit , 5 2 Wilshere: Do ta fitojmë Ligën e Kampionëve , 6 2 Vizat, Basha: Agjencitë të bëjnë kujdes , 7 2 Vejusha gazmore së shpejti në skenën e Teatrit të Operas , 8 2 Tsunami shkatërron Japoninë, 337 viktima qindra kufoma në plazhe , 9 2 Tri shfaqje ne Teatrin Kombetar , 10 2 Tragjedi në Fratar , 11 2 Topalli: Progresi i Shqipërisë , 12 2 Tiranë, rihapet kinema Agimi , 13 2 Tiranë, në pranga gjashtë grabitës , 14 2 Tiranë, festohet 66 vjetori i çlirimit , 15 2 Studentët: Bëni transparencën , 16 2 Shqiptarët hyjnë në 2011 me çmime të çmendura , 17 2 Shqiptarët duan referendum në Mal të Zi , 18 2 Shkatërrohet organizata italo-shqiptare , 19 2 ShBA: Obama i kërkon Sarkozysë dhe Cameronit një strategji për Libinë , 20 2 Sekuestrohen ushqime të skaduara në supermarkete , 21 2 Rusi, Zeniti fiton Superkupën, mund 1-0 CSKA Moskën , 22 2 Rritja ekonomike, Shqipëria e para , 23 2 Rritet prania ushtarake rreth Libisë 2 luftanije USA, në Kretë , 24 2 Rooney paralajmëron Unitedin: Kujdes nga Arsenali , 25 2 Rikthehen Tre tenorët në Pallatin e Kongreseve

abr 2011: 1 2 Rinis beteja në Misratë, \"Stalingradin\" e Libisë , 2 2 Funeral i përgjakur në Siri: Së paku 8 të vrarë , 3 2 Trupat e Gadafit po tërhiqen nga Misrata , 4 2 Rama: Projektet për Kombinatin i mban peng Iliri e Saliu , 5 2 Pacolli: I gatshëm të respektojë plotësisht aktgykimin e kushtetueses , 6 1 Mposhtet Reali në \"Santiago Bernabeu\"

mai 2011: 1 7 Vritet Osama bin Laden , 2 3 Rezultatet e zgjedhjeve vendore 2011 në Shqipëri/Vlorë , 3 1 Rama: Drejtësia të japë drejtësi

jun 2011: 1 1 Më 6 korrik beteja e fundit ligjore për Tiranën

jul 2011: 1 2 Sudani i Jugut fiton pavarësinë , 2 1 Në plazhin e Durrësit mbytet një 70-vjeçar

ago 2011: 1 2 Arrihet marrëveshja mes KFOR-it dhe palës serbe , 2 2 Berisha me rekord të ri në not , 3 2 Thaçi: Kufiri, çështje ekzistenciale për Kosovën

out 2011: 1 5 Vritet Gadafi , 2 2 Faqja kryesore

nov 2011: 1 1 Kapet i gjallë djali i Gadafit

dez 2011: 1 2 Shuhet Václav Havel , 2 1 Gianni De Biasi zyrtarisht trajneri i kombëtares shqiptare

jan 2012: 1 4 Wikipedia në gjuhën angleze mbyllet për 24 orë , 2 1 Rama: Të hetohen Berisha dhe Basha

fev 2012: 1 2 Livadhi , 2 1 Kandahar, vriten 2 komando shqiptare

mar 2012: 1 2 Francë, 4 viktima në një shkollë hebraike , 2 1 DASH reagon ndaj arrestimeve të fundit në Kosovë dhe Serbi

abr 2012: 1 1 Serbi, Presidenti Tadiç deklaron largimin nga posti; hapet rruga për zgjedhje

mai 2012: 1 1 Tragjedi në Himarë, 14 të vdekur e 19 të plagosur

jul 2012: 1 1 Sipas një studimi, pasiviteti është po aq vdekjeprurës sa duhani

set 2012: 1 1 Sipas një studimi, pasiviteti është po aq vdekjeprurës sa duhani

out 2012: 1 1 Tiranë: Disa grevistë në gjendje të rëndë

dez 2012: 1 5 Dhjetëra të vdekur në një shkollë në SHBA

fev 2013: 1 1 Kivi, mrekullia ekzotike per shendetin

abr 2013: 1 2 Hapësirë, \"Endeavour\" mbyll me sukses udhëtimin e fundit në Orbit

ago 2013: 1 1 Faqja kryesore

jan 2014: 1 1 Rehn: Kriza e Euros kerkon veprime te shpejta

fev 2014: 1 1 Zemërim në Bukuresht - Grindje për hyrjen në Shengen të Rumanisë dhe Bullgarisë

ago 2014: 1 1 I merret fryma Shkollës \"Foto Puka\" Lushnje

set 2014: 1 1 Fyle: PD, jo politikë në rrugë

jan 2015: 1 1 U zhvillua në Kiev Wikimedia CEE Meeting 2014

No data on this page have been normalized to 30 day months (as WMF does on certain traffic reports).
Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Terça-feira, 3 de março 2015 04:26

Dump file sqwikinews-20150213-pages-meta-history.xml.7z (full dump), size 1013 kb as 7z -> 17 Mb
Dump processed till Jan 31, 2015, on server stat1002, ready at Fri-13/02/2015-07:36 after 7 sec.

Versão do script:2.6
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.