Estatísticas da Wikinotícias todas as línguas

Zoom           
 

Type of dump from which metrics were extracted is unknown.
See also metrics definitions


For active and very active editors (columns C and D) each editor is counted only once, even if they contributed to several languages.
For a more complete breakdown and some trends see second table Edit activity levels of registered users
DataWikinoticiaristasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
dez 20150% +1% 0%   -6%      0%
nov 20150% -15% 0%   +5%      0%
out 20150% +18% 0%   -7%      0%
set 20150% +12% 0%   -7%      0%
ago 20150% +7% 0%   +85%      0%
jul 20150% -14% 0%   -27%      0%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
dez 20154233138510210 k1411,0 5,9 k      79 k
nov 20154220118411210 k1711,0 6,3 k      79 k
out 20154209109913209 k1911,0 6,0 k      78 k
set 201541998848209 k1911,0 6,5 k      78 k
ago 2015419111757208 k1511,0 6,9 k      78 k
jul 20154180 708208 k 11,0 3,7 k      78 k
jun 20154169198111207 k1611,0 5,1 k      77 k
mai 20154150201019207 k2011,0 6,1 k      77 k
abr 2015413018978206 k1911,0 7,1 k      77 k
mar 201541122211717205 k2611,020129,5 k687 Mb66,5 M167 k103 k624 k468 k76 k
fev 20154090 9918204 k3711,020107,3 k683 Mb66,1 M165 k103 k624 k466 k76 k
jan 20154077149813203 k3511,0200817 k679 Mb65,7 M162 k103 k623 k463 k75 k
dez 201440631210516202 k3411,020067,9 k674 Mb65,2 M157 k103 k623 k460 k67 k
nov 201440518879201 k3611,020026,4 k670 Mb64,8 M156 k102 k623 k458 k66 k
out 201440431710712200 k3211,020007,4 k666 Mb64,4 M155 k102 k622 k456 k66 k
set 20144026169716199 k3411,019988,2 k663 Mb64,0 M154 k102 k622 k454 k66 k
ago 201440101410012198 k1811,019987,6 k660 Mb63,7 M153 k105 k622 k452 k65 k
jul 20143996199911198 k2111,019977,8 k658 Mb63,4 M151 k112 k621 k451 k65 k
jun 20143977159814197 k2511,019969,4 k655 Mb63,2 M147 k112 k621 k449 k64 k
mai 20143962171037196 k2111,019956,4 k651 Mb62,9 M143 k111 k621 k447 k63 k
abr 20143945191018195 k2111,119938,2 k648 Mb62,6 M140 k111 k621 k445 k62 k
mar 201439261712110195 k2711,119898,5 k644 Mb62,2 M136 k110 k620 k443 k62 k
fev 201439091711110194 k2311,119876,4 k640 Mb61,9 M134 k110 k620 k441 k61 k
jan 201438921310512193 k2211,119866,5 k637 Mb61,6 M130 k109 k619 k439 k60 k
dez 20133879211079193 k2111,119846,3 k633 Mb61,3 M127 k109 k619 k437 k60 k
nov 20133858169715192 k2011,119825,3 k630 Mb61,0 M126 k108 k619 k435 k60 k
out 201338421711010191 k2011,119817,3 k628 Mb60,8 M125 k107 k618 k434 k59 k
set 201338252010910191 k1811,119807,5 k625 Mb60,6 M124 k107 k618 k432 k59 k
ago 201338052312215190 k2511,1197914 k622 Mb60,4 M124 k106 k618 k431 k58 k
jul 201337821713019189 k3811,0197911 k620 Mb60,1 M122 k106 k618 k429 k58 k
jun 201337652312017188 k3011,019827,6 k616 Mb59,7 M120 k104 k618 k426 k57 k
mai 201337421512418187 k3511,019848,7 k613 Mb59,5 M119 k103 k617 k424 k57 k
abr 201337272714123186 k3811,1198420 k609 Mb59,1 M116 k102 k617 k421 k56 k
mar 201337002013419185 k3911,0198411 k604 Mb58,7 M113 k100 k617 k418 k48 k
fev 201336802415424184 k3511,1198412 k599 Mb58,3 M110 k98 k616 k415 k47 k
jan 201336561912418183 k3511,019849,7 k594 Mb57,9 M107 k97 k616 k412 k47 k
dez 201236372212019182 k4011,1198310 k590 Mb57,5 M104 k96 k616 k409 k46 k
nov 201236151611715180 k4011,1198210 k585 Mb57,0 M102 k95 k615 k407 k45 k
out 201235992011914179 k3611,119838,5 k581 Mb56,7 M101 k94 k615 k403 k45 k
set 201235791813421178 k2711,119858,6 k577 Mb56,4 M100 k92 k615 k401 k45 k
ago 201235611311925177 k3011,119849,7 k574 Mb56,1 M100 k91 k615 k399 k44 k
jul 201235481513325176 k4011,119869,2 k571 Mb55,8 M99 k90 k614 k396 k44 k
jun 20123533512118175 k2811,119909,3 k568 Mb55,4 M98 k90 k614 k394 k44 k
mai 201235281512420174 k2911,219918,5 k565 Mb55,2 M98 k89 k614 k391 k44 k
abr 201235133013921173 k3311,219918,5 k562 Mb54,9 M97 k88 k614 k390 k44 k
mar 201234831814927172 k3211,219909,6 k559 Mb54,5 M96 k88 k613 k387 k44 k
fev 201234651813328171 k3611,2198911 k555 Mb54,1 M94 k87 k613 k385 k43 k
jan 201234473916329170 k4811,2198816 k551 Mb53,8 M92 k86 k613 k382 k43 k
dez 201134082114031169 k4111,2199051 k547 Mb53,3 M91 k85 k613 k379 k43 k
nov 201133871512720167 k3311,0204420 k541 Mb52,9 M89 k84 k612 k376 k31 k
out 201133723416026166 k4011,0204510 k538 Mb52,6 M88 k83 k612 k374 k30 k
set 201133381313117165 k6511,0204912 k534 Mb52,2 M87 k82 k612 k371 k29 k
ago 201133253315021163 k6011,1205612 k529 Mb51,7 M87 k81 k612 k366 k29 k
jul 201132921313524161 k5911,1206212 k524 Mb51,3 M86 k80 k611 k362 k29 k
jun 201132791314327159 k6011,1206612 k519 Mb50,7 M85 k80 k611 k358 k29 k
mai 201132662116528157 k6711,2206814 k514 Mb50,2 M84 k79 k611 k354 k28 k
abr 201132452416630155 k7211,3207016 k507 Mb49,5 M85 k78 k610 k348 k28 k
mar 201132213021639153 k7911,3207018 k500 Mb48,7 M82 k77 k610 k342 k28 k
fev 201131911817329151 k6911,4207114 k492 Mb47,8 M80 k75 k610 k334 k27 k
jan 201131732017129149 k7611,4207321 k486 Mb47,2 M79 k74 k609 k329 k27 k
dez 201031532416432146 k13811,5207248 k478 Mb46,4 M77 k73 k601 k323 k27 k
nov 201031292216426142 k9211,5206428 k461 Mb45,0 M75 k72 k568 k315 k26 k
out 201031071316321139 k13211,5206154 k450 Mb44,1 M74 k71 k551 k309 k26 k
set 201030942715618135 k11811,5205346 k433 Mb42,8 M72 k69 k518 k302 k26 k
ago 201030673618219132 k11111,4204347 k418 Mb41,6 M71 k69 k485 k295 k25 k
jul 201030313415727128 k11611,4204247 k403 Mb40,4 M70 k68 k452 k289 k24 k
jun 201029973718430125 k13311,3203246 k388 Mb39,2 M69 k67 k419 k283 k24 k
mai 201029603119030121 k12311,3202151 k372 Mb37,8 M68 k65 k387 k276 k24 k
abr 201029293117329117 k12911,3200947 k356 Mb36,5 M67 k64 k354 k269 k23 k
mar 201028982016923113 k13211,2199650 k341 Mb35,2 M65 k63 k322 k262 k23 k
fev 201028782816623109 k13211,2198540 k325 Mb33,9 M64 k62 k288 k255 k23 k
jan 201028503418133105 k12611,2197759 k311 Mb32,8 M63 k61 k263 k248 k23 k
dez 200928162516726101 k12811,1196149 k295 Mb31,4 M62 k60 k229 k241 k22 k
nov 20092791241752997 k12711,0194645 k280 Mb30,1 M61 k58 k196 k233 k22 k
out 20092767281793593 k14311,0193355 k265 Mb28,9 M61 k58 k164 k227 k21 k
set 20092739281802789 k13710,9193144 k249 Mb27,6 M59 k56 k134 k218 k21 k
ago 20092711341833085 k13410,9192052 k234 Mb26,3 M59 k55 k103 k211 k20 k
jul 20092677301702681 k11210,9190253 k218 Mb24,9 M58 k54 k71 k204 k20 k
jun 20092647442002477 k9110,7188142 k203 Mb23,7 M57 k53 k41 k198 k20 k
mai 20092603331612374 k4910,5188411 k196 Mb23,0 M56 k52 k32 k192 k20 k
abr 20092570321712373 k3510,6187912 k191 Mb22,4 M55 k50 k32 k188 k19 k
mar 20092538271652472 k4210,5187315 k188 Mb22,0 M54 k49 k31 k185 k19 k
fev 20092511201731770 k3610,5187011 k184 Mb21,5 M54 k48 k31 k181 k18 k
jan 20092491341812569 k4010,5186611 k181 Mb21,2 M53 k47 k31 k178 k18 k
dez 20082457442022768 k4910,5186213 k177 Mb20,7 M52 k46 k30 k175 k18 k
nov 20082413342002966 k5010,6186813 k173 Mb20,3 M51 k46 k30 k171 k18 k
out 20082379392133465 k6010,7187017 k170 Mb19,9 M49 k45 k29 k167 k17 k
set 20082340352173563 k7410,7186715 k164 Mb19,3 M48 k44 k29 k163 k17 k
ago 20082305472473261 k5310,9187514 k159 Mb18,7 M46 k43 k28 k158 k17 k
jul 20082258492133059 k5710,9188012 k155 Mb18,1 M45 k42 k27 k154 k16 k
jun 20082209512293357 k6011,1188815 k151 Mb17,6 M43 k41 k27 k149 k16 k
mai 20082158282102556 k4411,1189313 k146 Mb17,1 M41 k40 k26 k145 k16 k
abr 20082130271952854 k4711,2189115 k142 Mb16,7 M40 k38 k26 k140 k15 k
mar 20082103372093153 k5111,2189317 k138 Mb16,2 M39 k38 k26 k136 k15 k
fev 20082066522453951 k6211,3188617 k133 Mb15,6 M37 k36 k25 k131 k15 k
jan 20082014532424449 k6811,3188218 k128 Mb15,0 M36 k33 k24 k126 k15 k
dez 20071961342083547 k4511,5189016 k124 Mb14,5 M33 k32 k24 k121 k14 k
nov 20071927402173546 k5511,4189216 k120 Mb14,0 M31 k31 k23 k118 k14 k
out 20071887552363244 k6511,5188819 k115 Mb13,5 M29 k30 k23 k113 k13 k
set 20071832482163242 k6011,6187823 k109 Mb12,8 M27 k29 k22 k109 k13 k
ago 20071784492002840 k4611,6187715 k105 Mb12,2 M25 k28 k21 k105 k12 k
jul 20071735432163139 k4711,6187616 k101 Mb11,8 M24 k27 k21 k101 k12 k
jun 20071692341922337 k4811,6187418 k97 Mb11,3 M23 k26 k20 k97 k11 k
mai 20071658592063336 k4311,6187816 k93 Mb10,9 M22 k26 k20 k94 k11 k
abr 20071599631943235 k3611,6187416 k90 Mb10,5 M21 k25 k19 k90 k11 k
mar 20071536391902934 k3511,5186415 k86 Mb10,1 M20 k25 k19 k87 k10 k
fev 20071497371782632 k3711,4184714 k83 Mb9,7 M19 k24 k18 k84 k9,8 k
jan 20071460552082931 k3311,3183814 k80 Mb9,3 M19 k23 k18 k81 k9,3 k
dez 20061405452092830 k4211,2183214 k77 Mb8,9 M20 k23 k17 k78 k9,0 k
nov 20061360562202929 k3811,2182619 k74 Mb8,6 M20 k22 k17 k75 k8,7 k
out 20061304552302228 k3311,0180414 k70 Mb8,2 M19 k21 k16 k71 k8,3 k
set 20061249552113027 k4510,9179114 k67 Mb7,8 M19 k20 k16 k69 k7,8 k
ago 20061194582103226 k4011,0181016 k64 Mb7,5 M18 k20 k16 k66 k7,4 k
jul 20061136542272824 k3910,9180415 k60 Mb7,1 M17 k18 k15 k62 k7,0 k
jun 20061082432422823 k4110,8180616 k57 Mb6,7 M16 k17 k15 k59 k6,6 k
mai 20061039772523122 k4210,7180015 k54 Mb6,3 M15 k15 k13 k55 k6,2 k
abr 2006962522042520 k3410,7179712 k51 Mb5,9 M14 k14 k12 k52 k5,8 k
mar 2006910732413719 k5910,6179517 k48 Mb5,6 M14 k14 k12 k50 k5,5 k
fev 2006837462002918 k4410,7180515 k43 Mb5,1 M9,8 k13 k11 k46 k5,0 k
jan 2006791592453316 k5910,5179219 k40 Mb4,7 M8,9 k12 k10 k43 k4,8 k
dez 2005732542024315 k5610,6179218 k36 Mb4,2 M8,0 k11 k9,5 k39 k4,3 k
nov 2005678391733513 k3210,6181112 k32 Mb3,7 M7,1 k9,5 k8,8 k35 k3,8 k
out 2005639641943112 k4810,5179817 k29 Mb3,4 M6,7 k8,9 k8,3 k33 k3,5 k
set 2005575491933710 k4710,4180215 k25 Mb3,0 M4,0 k7,9 k7,9 k29 k3,1 k
ago 200552666218379,0 k4410,4176117 k21 Mb2,5 M3,5 k7,0 k7,3 k25 k2,7 k
jul 200546093240337,6 k4610,1177919 k18 Mb2,1 M3,1 k5,8 k6,7 k21 k2,2 k
jun 200536741145216,2 k339,3180210 k15 Mb1,7 M2,4 k4,5 k6,4 k17 k1,6 k
mai 200532650141215,2 k349,1179210 k12 Mb1,4 M1,9 k3,9 k6,0 k15 k1,3 k
abr 200527660164304,1 k499,0175513 k9,4 Mb1,1 M1,6 k3,1 k5,6 k12 k1,0 k
mar 200521654111172,6 k319,317107,9 k5,9 Mb688 k1,1 k1,7 k5,0 k8,0 k720
fev 200516254113101,6 k2810,116205,5 k3,6 Mb404 k8867414,2 k4,9 k426
jan 2005108327198411313,117064,1 k1,8 Mb216 k5492577583,1 k263
dez 2004766010784291116,218345,7 k1,0 Mb120 k30423831,9 k132
nov 2004161626375216,418021,2 k177 kb21 k11981829938
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
 WikinoticiaristasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikinoticiaristas (usuários registrados)
A = Wikinoticiaristas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikinoticiaristas que editaram pelo menos dez vezes desde que chegaram
C = Wikinoticiaristas que contribuíram cinco vezes ou mais este mês
D = Wikinoticiaristas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users

Articles = namespace 0 only.

Notes on count methodology:
Before user activity is counted, edits per user per month are totalled for all languages. So each user is counted only once.
Before July 2012 WMF used a rough approximation for establishing total editor counts:
Users who contributed to several wikis could be counted twice or more (only for wikis where their monthy activity reached any given threshold)

In each column all editors with at least x edits are included.
For example, an editor with 12 edits in some month would be counted in columns 1,2,5,10.

 
YoY = Year over Year change

MoM/PoM: Unofficial quasi-normalized metrics, meant for quick and rough monthly trend assesment:
* = As a rough 'normalization' currently only first 28 days per month are taken into account
MoM = Month over Month change
PoM = Percentage of Maximum, (= highest value ever in that column)
PoM = Note how a short month can have PoM 100% even when the absolute editor count is less than the all-time maximum for that column

  Users  Trends
Edits ≥ 1  3  5  10  25  100  250  1000  2500  5 YoY100 YoY 5 MoM100 MoM 5 PoM100 PoM
dez 2015172988559311031  -19.0%-37.5% -4.8%- 32.9%21.4%
nov 20152081158467371142  -3.4%22.2% -3.5%25.0% 34.6%23.8%
out 20152121209965371321  -7.5%8.3% 8.9%- 35.8%19.0%
set 2015183110846031842  -13.4%- 11.3%- 32.9%16.7%
ago 201517094756229751  -25.0%- 16.4%- 29.6%16.7%
jul 20151869670513283   -29.3%- -22.8%- 25.4%16.7%
jun 2015194111816132114   -17.3%-21.4% -19.4%37.5% 32.9%26.2%
mai 20152461371016135951  -1.9%- 5.4%- 40.8%19.0%
abr 2015208131976837852  -4.0%- -17.7%- 38.8%16.7%
mar 201527015211777471792  -3.3%70.0% 14.1%-16.7% 47.1%35.7%
fev 20152271209972461861  -10.8%80.0% 7.6%38.5% 41.2%42.9%
jan 201525513098674013931 -6.7%8.3% -8.0%8.3% 38.3%31.0%
dez 201424814310574381641  -1.9%77.8% 17.6%50.0% 41.7%28.6%
nov 201419211287603596   -10.3%- -15.0%- 35.4%19.0%
out 201424513210777351261  -2.7%20.0% 6.4%-20.0% 41.7%28.6%
set 2014197120977140167   -11.0%60.0% 1.1%36.4% 39.2%35.7%
ago 20142111281006637124   -18.0%-20.0% -2.1%0.0% 38.8%26.2%
jul 20142301389967431151  -23.8%-42.1% 2.2%-21.4% 39.6%26.2%
jun 20142311399870431491  -18.3%-17.6% -6.1%133.3% 38.8%33.3%
mai 20142531461037134761  -16.9%- 2.1%- 41.2%14.3%
abr 20142691521016736852  -28.4%- -17.1%- 40.4%19.0%
mar 201426815412181431063  -9.7%-47.4% 5.4%- 48.8%21.4%
fev 201425515411178431041  -27.9%-58.3% 11.0%0.0% 46.2%23.8%
jan 201422612410577451251  -15.3%-33.3% 4.2%25.0% 41.7%23.8%
out 20152121209965371321  -7.5%8.3% 8.9%- 35.8%19.0%
jul 20151869670513283   -29.3%- -22.8%- 25.4%16.7%
abr 2015208131976837852  -4.0%- -17.7%- 38.8%16.7%
jan 201525513098674013931 -6.7%8.3% -8.0%8.3% 38.3%31.0%
out 201424513210777351261  -2.7%20.0% 6.4%-20.0% 41.7%28.6%
jul 20142301389967431151  -23.8%-42.1% 2.2%-21.4% 39.6%26.2%
abr 20142691521016736852  -28.4%- -17.1%- 40.4%19.0%
jan 201422612410577451251  -15.3%-33.3% 4.2%25.0% 41.7%23.8%
out 20132581431107341103   -7.6%-28.6% -3.8%- 42.1%21.4%
jul 20132891581308958198   -2.3%-24.0% 2.5%0.0% 50.8%40.5%
abr 20133301791411026323101  1.4%9.5% 6.2%35.3% 56.7%54.8%
jan 201327816512488501882  -23.9%-37.9% 0.0%-12.5% 45.4%33.3%
out 201224015411990511471  -25.6%-46.2% -13.2%-33.3% 46.7%33.3%
jul 201225716313310058258   -1.5%4.2% 10.4%37.5% 52.9%52.4%
abr 201227716813910763216   -16.3%-30.0% -5.5%-28.0% 57.1%42.9%
jan 20123712101631187729121  -4.7%0.0% 21.6%3.7% 67.9%66.7%
out 2011357200160105682611   -1.8%23.8% 21.1%41.2% 64.6%57.1%
jul 20112911671351006324112  -14.0%-11.1% -5.7%-11.5% 55.0%54.8%
abr 20113632051661247330132  -4.0%3.4% -23.6%-16.7% 66.2%71.4%
jan 2011366211171126772982  -5.5%-12.1% 0.0%-22.6% 66.2%57.1%
out 20103482171631217121121  -8.9%-40.0% 6.7%-5.6% 66.2%40.5%
jul 20103722041571177827111  -7.6%3.8% -16.1%-14.8% 62.9%54.8%
abr 20104362341731297429112  1.2%26.1% 4.5%13.0% 67.5%61.9%
jan 201041622818113185331421 0.0%32.0% 11.5%30.4% 72.5%71.4%
out 200940822917913374351531 -16.0%2.9% -1.7%11.1% 70.8%71.4%
jul 200940722817011772261111 -20.2%-13.3% -12.9%0.0% 67.5%57.1%
abr 2009434223171117592382  -12.3%-17.9% 5.9%-4.5% 67.1%50.0%
jan 2009476247181120692510   -25.2%-43.2% -9.8%-19.2% 72.5%50.0%
out 20084542672131589234111  -9.7%6.2% -4.3%-11.4% 84.2%73.8%
jul 2008463275213141723010   -1.4%-3.2% -11.6%-24.2% 82.5%59.5%
abr 2008416259195131762882  0.5%-12.5% -5.0%-20.0% 79.6%57.1%
jan 20084833032421771174412   16.3%51.7% 14.0%11.8% 95.0%90.5%
out 20074592902361619232152  2.6%45.5% 5.9%6.9% 89.2%73.8%
jul 200745526121615410131111  -4.8%10.7% 22.4%36.4% 86.7%71.4%
abr 2007458259194134773214   -4.9%28.0% 3.3%3.6% 78.3%69.0%
jan 200747027620813278299   -15.1%-12.1% 6.6%22.7% 80.4%64.3%
out 20065183072301549222101  18.6%-29.0% 7.9%-28.6% 90.8%47.6%
jul 20065013022271457528131  -5.4%-15.2% -4.4%0.0% 90.8%59.5%
abr 200643126320414476259   24.4%-16.7% -12.2%-31.2% 81.2%52.4%
jan 20065543152451651053315   245.1%266.7% 21.9%-26.2% 95.0%73.8%
out 2005402252194141813116   -- -2.1%-24.3% 77.1%66.7%
jul 20055303222401649833151  -- 69.6%55.0% 95.4%73.8%
abr 20053322141641107430101  -- 49.1%85.7% 67.1%61.9%
jan 200518710071463191   -- -39.4%- 23.8%19.0%

Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Quinta-feira, 21 de janeiro 2016 21:07 a partir de cópias do banco de dados SQL de Quinta-feira, 31 de dezembro 2015

Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.