Estatísticas da Wikinotícias todas as línguas

Zoom           
 
January 2014: Unfortunately monthly database dump generation is delayed for many wikis. Reports will appear later than usual. Our sincere apologies for any inconvenience caused.
Upd. March 2: Dump generation was restarted on February 12. All dumps are up to date now for December, some not for January, some days to go. This is an intermediate update.

Note: data for months after Dec 2014 for one or more large projects (zh,de,ta) are not yet known.
For those months totals for all languages combined can not yet be shown.

Type of dump from which metrics were extracted is unknown.
See also metrics definitions


For active and very active editors (columns C and D) each editor is counted only once, even if they contributed to several languages.
For a more complete breakdown and some trends see second table Edit activity levels of registered users
DataWikinoticiaristasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
dez 20140% +21% +1%   +23%+1%+1%+1%0%0%0%+1%
nov 20140% -17% 0%   -12%+1%+1%+1%-0%0%0%+1%
out 20140% +8% 0%   -7%+1%+1%+1%0%0%0%+1%
set 20140% -2% 0%   +5%0%0%+1%-1%0%0%+1%
ago 20140% -1% 0%   -3%0%0%+1%-7%0%0%+1%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
dez 201440531210516222 k3610,019347,9 k674 Mb65,2 M149 k102 k622 k460 k44 k
nov 2014404110879221 k 10,019306,4 k670 Mb64,7 M148 k102 k622 k458 k44 k
out 201440311510512219 k 10,019277,4 k666 Mb64,3 M147 k102 k621 k456 k44 k
set 20144016159716218 k3310,119257,9 k662 Mb63,9 M146 k102 k621 k454 k43 k
ago 20144001129912217 k1910,119257,6 k660 Mb63,6 M145 k104 k621 k452 k43 k
jul 201439891910011217 k2510,119247,8 k658 Mb63,4 M143 k111 k620 k451 k43 k
jun 20143970159814216 k3110,119229,4 k655 Mb63,1 M139 k111 k620 k449 k42 k
mai 20143955181037215 k2210,119226,5 k651 Mb62,8 M134 k110 k620 k447 k41 k
abr 20143937201008214 k2010,019198,1 k648 Mb62,5 M131 k110 k620 k445 k41 k
mar 201439171712110214 k2910,019148,5 k644 Mb62,2 M128 k109 k619 k443 k40 k
fev 201439001811110213 k3010,019126,4 k640 Mb61,8 M125 k108 k619 k441 k39 k
jan 201438821210412212 k2410,119116,5 k637 Mb61,5 M122 k108 k618 k439 k39 k
dez 20133870191069211 k2210,119086,3 k633 Mb61,2 M119 k107 k618 k437 k39 k
nov 20133851169615210 k2110,119065,3 k630 Mb61,0 M117 k107 k618 k435 k38 k
out 201338351611010210 k2310,119047,3 k627 Mb60,7 M116 k106 k617 k434 k38 k
set 201338192110910209 k1810,119047,5 k625 Mb60,5 M116 k105 k617 k432 k37 k
ago 201337982312415209 k2610,1190214 k622 Mb60,3 M115 k105 k617 k430 k37 k
jul 201337751613019208 k4410,1190211 k619 Mb60,0 M114 k104 k617 k429 k37 k
jun 201337592112017206 k3410,119047,6 k616 Mb59,6 M112 k103 k617 k426 k36 k
mai 201337381712418205 k3910,119058,7 k612 Mb59,4 M110 k102 k616 k424 k36 k
abr 201337212714123204 k4610,1190520 k608 Mb59,0 M107 k100 k616 k421 k36 k
mar 201336942213319203 k4310,1190411 k603 Mb58,6 M105 k98 k616 k418 k28 k
fev 201336722315324201 k4210,1190312 k598 Mb58,2 M101 k97 k615 k415 k27 k
jan 201336491912418200 k3810,119029,8 k594 Mb57,8 M99 k95 k615 k412 k26 k
dez 201236302112019199 k4310,1190111 k590 Mb57,4 M96 k95 k615 k409 k26 k
nov 201236091611715198 k4410,1189910 k584 Mb57,0 M93 k94 k614 k406 k25 k
out 201235932011914196 k3710,119008,5 k581 Mb56,6 M92 k93 k614 k403 k25 k
set 201235731813421195 k3210,119008,7 k577 Mb56,3 M92 k91 k614 k401 k25 k
ago 201235551311925194 k3510,119009,7 k574 Mb56,0 M91 k89 k614 k398 k25 k
jul 201235421513325193 k4410,119019,2 k571 Mb55,7 M90 k89 k613 k396 k25 k
jun 20123527612118192 k3010,219049,3 k567 Mb55,3 M90 k88 k613 k393 k25 k
mai 201235211512420191 k3110,219048,6 k565 Mb55,1 M89 k88 k613 k391 k25 k
abr 201235063013921190 k3510,219048,6 k562 Mb54,8 M88 k87 k613 k389 k25 k
mar 201234761914927189 k3810,219029,9 k558 Mb54,4 M88 k86 k612 k387 k24 k
fev 201234572113327188 k4510,2190111 k554 Mb54,0 M86 k85 k612 k384 k24 k
jan 201234362816029186 k5310,2190016 k550 Mb53,6 M84 k84 k612 k381 k24 k
dez 201134082214031185 k46210,2190251 k545 Mb53,2 M83 k83 k612 k378 k24 k
nov 201133861712720170 k3810,8204420 k540 Mb52,7 M81 k82 k611 k375 k25 k
out 201133693116026169 k4310,7204610 k536 Mb52,4 M80 k82 k611 k373 k24 k
set 201133381313117168 k7110,8204913 k532 Mb52,0 M79 k80 k611 k369 k24 k
ago 201133253315021166 k6510,8205612 k527 Mb51,5 M79 k79 k611 k365 k24 k
jul 201132921613524164 k6610,9206312 k523 Mb51,1 M78 k79 k610 k361 k24 k
jun 201132761314327162 k7111,0206712 k518 Mb50,5 M77 k78 k610 k356 k24 k
mai 201132632216428159 k7711,0207115 k512 Mb49,9 M76 k77 k610 k352 k23 k
abr 201132412416629157 k8211,1207517 k505 Mb49,2 M77 k76 k609 k347 k23 k
mar 201132173321539155 k9611,2207620 k497 Mb48,4 M74 k75 k609 k340 k23 k
fev 201131842517329152 k8011,2207917 k489 Mb47,5 M72 k73 k609 k332 k23 k
jan 201131592317129149 k8311,3208422 k483 Mb46,8 M71 k73 k608 k326 k23 k
dez 201031362416432147 k14811,4208448 k474 Mb46,0 M69 k71 k600 k320 k22 k
nov 201031122516326142 k10611,4207729 k457 Mb44,5 M67 k70 k567 k311 k22 k
out 201030872116121139 k14111,5207855 k446 Mb43,6 M66 k69 k550 k306 k22 k
set 201030662815518135 k12411,4207246 k429 Mb42,3 M65 k67 k516 k298 k22 k
ago 201030384018219131 k13511,4206247 k413 Mb41,1 M64 k67 k484 k292 k22 k
jul 201029983315627127 k11911,4206147 k399 Mb39,9 M63 k67 k451 k286 k21 k
jun 201029653818330123 k13611,4205046 k384 Mb38,6 M62 k65 k418 k280 k21 k
mai 201029273018930119 k12911,3203951 k368 Mb37,3 M60 k63 k385 k272 k21 k
abr 201028973117229115 k13011,3202747 k351 Mb35,9 M59 k63 k352 k265 k21 k
mar 201028662016823111 k13111,3201350 k336 Mb34,7 M58 k62 k320 k259 k21 k
fev 201028462816523107 k13211,3200240 k320 Mb33,4 M57 k61 k287 k251 k20 k
jan 201028183318033103 k12711,3199558 k307 Mb32,2 M56 k60 k261 k245 k20 k
dez 20092785261662699 k13011,2197849 k291 Mb30,9 M55 k58 k228 k237 k20 k
nov 20092759231732995 k13011,1196345 k275 Mb29,6 M54 k57 k195 k230 k20 k
out 20092736281793591 k15811,1195055 k260 Mb28,4 M53 k56 k163 k223 k19 k
set 20092708281802786 k14211,1194944 k244 Mb27,0 M52 k55 k133 k215 k19 k
ago 20092680351813082 k13711,1193952 k229 Mb25,8 M51 k54 k102 k207 k19 k
jul 20092645301702678 k11611,1192153 k213 Mb24,4 M50 k53 k69 k200 k19 k
jun 20092615441972474 k9210,9189842 k199 Mb23,2 M49 k52 k40 k194 k19 k
mai 20092571311592371 k5410,7190111 k191 Mb22,4 M48 k51 k31 k188 k18 k
abr 20092540321712370 k3910,9189912 k187 Mb21,9 M48 k49 k30 k184 k18 k
mar 20092508281642468 k4510,9189514 k183 Mb21,5 M47 k48 k30 k181 k18 k
fev 20092480201731767 k3610,9189311 k179 Mb21,0 M46 k48 k30 k178 k18 k
jan 20092460341802566 k3910,9189011 k176 Mb20,6 M45 k46 k29 k175 k18 k
dez 20082426442012765 k4910,9188613 k172 Mb20,2 M44 k46 k29 k171 k17 k
nov 20082382341992963 k5211,0189313 k169 Mb19,8 M43 k45 k29 k167 k17 k
out 20082348382123562 k6011,1189417 k165 Mb19,3 M42 k44 k28 k164 k17 k
set 20082310352173560 k7611,1189215 k160 Mb18,8 M40 k43 k28 k159 k16 k
ago 20082275442463257 k5411,3190314 k155 Mb18,1 M38 k42 k27 k154 k16 k
jul 20082231492133056 k5611,4190912 k150 Mb17,6 M37 k41 k26 k150 k16 k
jun 20082182522293354 k5911,5191815 k146 Mb17,1 M36 k40 k26 k146 k15 k
mai 20082130282102552 k4611,6192413 k142 Mb16,6 M34 k39 k25 k141 k15 k
abr 20082102271952851 k4811,7192214 k138 Mb16,2 M33 k38 k25 k137 k15 k
mar 20082075362083149 k5011,8192417 k134 Mb15,7 M32 k37 k25 k133 k15 k
fev 20082039522433948 k6111,8191617 k129 Mb15,1 M30 k35 k24 k128 k14 k
jan 20081987442414446 k5411,9191217 k124 Mb14,5 M29 k33 k23 k123 k14 k
dez 20071943352083544 k4611,9191916 k120 Mb14,0 M27 k31 k23 k119 k14 k
nov 20071908402163543 k5412,0192316 k116 Mb13,6 M25 k30 k22 k115 k13 k
out 20071868552353241 k6512,1192019 k112 Mb13,1 M24 k29 k22 k111 k13 k
set 20071813472153239 k5912,2191023 k106 Mb12,4 M22 k28 k21 k106 k13 k
ago 20071766481982837 k4612,2191115 k101 Mb11,8 M20 k27 k20 k102 k12 k
jul 20071718432153136 k4912,3191216 k97 Mb11,4 M19 k27 k20 k98 k12 k
jun 20071675341922334 k4812,3191118 k93 Mb10,9 M18 k25 k19 k95 k11 k
mai 20071641612063333 k4412,3191716 k90 Mb10,5 M17 k25 k19 k91 k11 k
abr 20071580611923232 k3512,4191316 k86 Mb10,0 M15 k25 k18 k87 k10 k
mar 20071519391882931 k3512,2190415 k83 Mb9,6 M14 k24 k18 k84 k9,9 k
fev 20071480371772630 k3812,2188614 k79 Mb9,2 M14 k23 k17 k81 k9,5 k
jan 20071443552062929 k3312,1187814 k76 Mb8,9 M13 k23 k17 k78 k9,0 k
dez 20061388432072927 k3012,0187214 k73 Mb8,5 M15 k22 k16 k75 k8,6 k
nov 20061345572192927 k3811,9187019 k70 Mb8,2 M15 k21 k16 k72 k8,4 k
out 20061288542282325 k3211,7184914 k67 Mb7,8 M14 k20 k15 k69 k8,0 k
set 20061234552113024 k4411,7183614 k63 Mb7,4 M14 k20 k15 k66 k7,5 k
ago 20061179582073223 k4011,8186016 k60 Mb7,1 M13 k19 k15 k63 k7,1 k
jul 20061121552212822 k3911,7185615 k57 Mb6,7 M12 k18 k14 k59 k6,7 k
jun 20061066432392821 k4111,6186216 k54 Mb6,3 M11 k16 k14 k56 k6,3 k
mai 20061023772493019 k4211,6185815 k51 Mb5,9 M10 k15 k12 k53 k5,9 k
abr 2006946522012518 k3411,5185812 k47 Mb5,5 M9,4 k14 k11 k50 k5,5 k
mar 2006894712373717 k3911,5185914 k44 Mb5,2 M8,8 k13 k11 k47 k5,2 k
fev 2006823441982916 k3111,5185614 k41 Mb4,8 M8,2 k12 k10 k44 k4,8 k
jan 2006779572423315 k4711,2183518 k38 Mb4,5 M7,8 k12 k10,0 k41 k4,6 k
dez 2005722511994214 k4211,1182616 k34 Mb4,0 M7,3 k11 k9,3 k37 k4,1 k
nov 2005671401723512 k3011,0183411 k31 Mb3,6 M6,7 k9,2 k8,7 k34 k3,7 k
out 2005631641923111 k4710,8182116 k29 Mb3,4 M6,4 k8,6 k8,2 k32 k3,4 k
set 200556750189379,9 k4710,8183015 k25 Mb2,9 M3,7 k7,6 k7,8 k28 k3,0 k
ago 200551765213368,5 k4410,9179317 k21 Mb2,4 M3,2 k6,7 k7,2 k24 k2,6 k
jul 200545291232337,1 k4510,5181719 k17 Mb2,1 M2,8 k5,6 k6,6 k20 k2,1 k
jun 200536141141195,8 k329,8185010 k14 Mb1,7 M2,1 k4,2 k6,3 k17 k1,5 k
mai 200532049135204,8 k359,6184710 k12 Mb1,4 M1,6 k3,7 k5,9 k14 k1,2 k
abr 200527160158293,7 k489,7181612 k8,9 Mb1,1 M1,3 k3,0 k5,5 k11 k987
mar 200521151109142,2 k2910,418027,6 k5,5 Mb641 k8031,6 k4,9 k7,5 k670
fev 200516053109121,3 k2111,817415,0 k3,2 Mb370 k6236254,2 k4,6 k402
jan 2005107287197691114,217643,9 k1,8 Mb210 k4152357483,0 k251
dez 2004796310774261216,318515,7 k1,0 Mb120 k30423831,9 k114
nov 2004161626373216,818021,2 k177 kb21 k11981829935
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
 WikinoticiaristasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikinoticiaristas (usuários registrados)
A = Wikinoticiaristas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikinoticiaristas que editaram pelo menos dez vezes desde que chegaram
C = Wikinoticiaristas que contribuíram cinco vezes ou mais este mês
D = Wikinoticiaristas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users

Articles = namespace 0 only.

Notes on count methodology:
Before user activity is counted, edits per user per month are totalled for all languages. So each user is counted only once.
Before July 2012 WMF used a rough approximation for establishing total editor counts:
Users who contributed to several wikis could be counted twice or more (only for wikis where their monthy activity reached any given threshold)

In each column all editors with at least x edits are included.
For example, an editor with 12 edits in some month would be counted in columns 1,2,5,10.

 
YoY = Year over Year change

MoM/PoM: Unofficial quasi-normalized metrics, meant for quick and rough monthly trend assesment:
* = As a rough 'normalization' currently only first 28 days per month are taken into account
MoM = Month over Month change
PoM = Percentage of Maximum, (= highest value ever in that column)
PoM = Note how a short month can have PoM 100% even when the absolute editor count is less than the all-time maximum for that column

  Users  Trends
Edits ≥ 1  3  5  10  25  100  250  1000  2500  5 YoY100 YoY 5 MoM100 MoM 5 PoM100 PoM
jan 2015        -- -- --
dez 201425214410574381641  -0.9%77.8% 16.5%50.0% 41.6%29.3%
nov 201419511287603596   -9.4%- -13.3%- 35.7%19.5%
out 201424213110575351261  -4.5%20.0% 4.3%-20.0% 41.2%29.3%
set 2014199121977140167   -11.0%60.0% 2.2%36.4% 39.5%36.6%
ago 2014209128996637124   -20.2%-20.0% -5.2%0.0% 38.7%26.8%
jul 201422813710066431151  -23.1%-42.1% 4.3%-21.4% 40.8%26.8%
jun 20142311399870431491  -18.3%-17.6% -6.1%133.3% 39.1%34.1%
mai 20142531461037134761  -16.9%- 3.1%- 41.6%14.6%
abr 20142671511006635852  -29.1%- -17.9%- 40.3%19.5%
mar 201426815412182431063  -9.0%-47.4% 5.4%- 49.2%22.0%
fev 201425415311179431041  -27.5%-58.3% 12.1%0.0% 46.6%24.4%
jan 201422512310476451251  -16.1%-33.3% 4.2%25.0% 41.6%24.4%
dez 20132251351067038921  -11.7%- 4.4%- 39.9%19.5%
nov 2013227130966439153   -17.9%0.0% -9.9%66.7% 38.2%36.6%
out 20132601431107341103   -7.6%-28.6% -3.8%- 42.4%22.0%
set 201323714710974341041  -18.7%-52.4% -11.8%- 44.1%22.0%
ago 201324914612483441561  4.2%-40.0% -2.5%-11.8% 50.0%36.6%
jul 20132891581308958198   -2.3%-24.0% 2.5%0.0% 51.3%41.5%
jun 20132791561208450177   -0.8%-5.6% 0.8%0.0% 50.0%41.5%
mai 201329715512488481861  0.0%-10.0% -13.2%-26.1% 49.6%41.5%
abr 20133271791411026323101  1.4%9.5% 7.1%35.3% 57.1%56.1%
mar 201330917813390601972  -10.7%-29.6% -17.0%-29.2% 53.4%41.5%
fev 20133001901531036924112  15.0%-11.1% 40.4%71.4% 64.3%58.5%
jan 201327516412488501882  -22.5%-37.9% 0.0%-12.5% 45.8%34.1%
dez 201224614712084441992  -14.3%-38.7% -4.4%6.7% 45.8%39.0%
nov 201224514411783541582  -7.9%-25.0% 1.8%7.1% 47.9%36.6%
out 201224015411990511471  -25.6%-46.2% -13.2%-33.3% 47.1%34.1%
set 2012283172134895421111  2.3%23.5% 16.2%10.5% 54.2%51.2%
ago 201224914811992542591  -20.7%19.0% -12.6%-13.6% 46.6%46.3%
jul 201225716313310058258   -1.5%4.2% 10.4%37.5% 53.4%53.7%
jun 201225515812184561881  -15.4%-33.3% -4.2%-20.0% 48.3%39.0%
mai 20122561591249356207   -24.4%-28.6% -12.4%11.1% 50.4%48.8%
abr 201227616813910763216   -16.3%-27.6% -5.5%-28.0% 57.6%43.9%
mar 20122971711491026427101  -30.7%-30.8% 12.4%-3.8% 60.9%61.0%
fev 201230417513310265279   -23.1%-6.9% -19.4%-7.1% 54.2%63.4%
jan 20123692051601167429121  -6.4%0.0% 19.4%3.7% 67.2%68.3%
dez 20112881691401096831111  -14.6%-3.1% 8.1%42.1% 56.3%65.9%
nov 201126615612793582011   -22.1%-23.1% -20.0%-20.8% 52.1%46.3%
out 2011357200160105682611   -0.6%23.8% 21.1%41.2% 65.1%58.5%
set 201127617013185561772  -15.5%-5.6% -11.7%-15.0% 53.8%41.5%
ago 2011350201150114702172  -17.6%10.5% 9.8%-13.0% 60.9%48.8%
jul 20112901671351006324112  -13.5%-11.1% -5.7%-11.5% 55.5%56.1%
jun 2011315186143997027111  -21.9%-10.0% -10.8%4.0% 58.8%63.4%
mai 20114092191641046928101  -13.2%-6.7% -1.3%-13.8% 66.0%61.0%
abr 20113602051661247229132  -3.5%0.0% -23.6%-19.4% 66.8%70.7%
mar 201144326221515110039151  28.0%69.6% 20.2%24.1% 87.4%87.8%
fev 20113302071731248229132  4.8%26.1% 8.8%20.8% 72.7%70.7%
jan 2011365211171126772982  -5.0%-12.1% 0.0%-22.6% 66.8%58.5%
dez 2010327209164125803291  -1.2%23.1% 0.0%29.2% 66.8%75.6%
nov 2010354208163117702691  -5.8%-10.3% 1.3%41.2% 66.8%58.5%
out 20103442161611207121121  -10.1%-40.0% 6.1%-5.6% 66.0%41.5%
set 2010353191155115701871  -13.9%-33.3% -15.9%5.9% 62.2%43.9%
ago 20103612281821348819711 0.6%-36.7% 17.3%-26.1% 73.9%41.5%
jul 20103722031561167927111  -8.2%3.8% -16.2%-14.8% 63.0%56.1%
jun 201036221918313483307   -7.1%25.0% 2.3%-6.9% 75.2%65.9%
mai 201041724418912880301311 18.9%30.4% 8.7%11.5% 73.5%70.7%
abr 20104352321721297429112  0.6%26.1% 3.9%13.0% 67.6%63.4%
mar 20103542081681116823911 2.4%-4.2% -6.1%0.0% 65.1%56.1%
fev 2010368206165126782310   -4.6%35.3% -4.6%-23.3% 69.3%56.1%
jan 201041522718013085331421 0.0%32.0% 11.6%30.4% 72.7%73.2%
dez 20093582031661176626101  -17.4%-3.7% -7.2%-17.9% 65.1%56.1%
nov 20093762231731227429101  -13.1%0.0% -1.8%-6.7% 70.2%68.3%
out 200940522917913374351531 -15.6%0.0% -1.7%11.1% 71.4%73.2%
set 2009378222180128742710   -17.1%-22.9% 1.2%0.0% 72.7%65.9%
ago 20093722241811297630131  -26.4%-6.2% 5.6%12.5% 71.8%65.9%
jul 200940322617011772261111 -20.2%-13.3% -11.5%0.0% 68.1%58.5%
jun 2009471257197128712411   -14.0%-27.3% 24.5%9.1% 76.9%58.5%
mai 2009387216159110662381  -24.3%-8.0% -8.7%4.8% 61.8%53.7%
abr 2009432222171117592382  -12.3%-17.9% 6.6%-4.5% 67.6%51.2%
mar 200942822816411062241121 -21.2%-22.6% -12.7%29.4% 63.4%53.7%
fev 2009407218173108581751  -28.8%-56.4% 0.0%-19.0% 72.7%41.5%
jan 2009470244180120692510   -25.3%-43.2% -9.9%-19.2% 72.7%51.2%
dez 2008547294201130752781  -3.4%-22.9% 0.5%-7.1% 80.7%63.4%
nov 2008431246199137842911   -7.9%-17.1% -5.0%-12.5% 80.3%68.3%
out 20084512652121579135111  -9.8%9.4% -4.7%-8.6% 84.5%78.0%
set 2008479277217149863512   0.9%9.4% -10.6%9.4% 88.7%85.4%
ago 20085243192461751003210   24.2%14.3% 19.2%28.0% 99.2%78.0%
jul 2008459274213141723010   -0.9%-3.2% -11.6%-24.2% 83.2%61.0%
jun 2008500304229159943316   19.3%43.5% 17.3%50.0% 94.1%80.5%
mai 20084072562101417625102  1.9%-24.2% 0.0%-8.3% 80.3%53.7%
abr 2008414259195131762882  1.6%-12.5% -4.5%-20.0% 80.3%58.5%
mar 20084122572081518931141  10.6%6.9% -16.0%-23.1% 84.0%73.2%
fev 20085233052431811203914   37.3%50.0% 4.8%0.0% 100.0%95.1%
jan 20084773022411771164412   17.0%51.7% 13.5%14.7% 95.4%95.1%
dez 2007427254208155793511   0.5%20.7% -0.5%0.0% 84.0%82.9%
nov 2007428265216158923515   -1.4%20.7% -5.6%9.7% 84.5%82.9%
out 20074582892351619232152  3.1%39.1% 5.4%6.9% 89.5%75.6%
set 20074162622151408432122  1.9%6.7% 12.8%16.0% 84.9%70.7%
ago 20074382521981408228101  -4.3%-12.5% -13.5%-16.7% 75.2%61.0%
jul 200745226021515310131111  -2.7%10.7% 22.5%36.4% 87.0%73.2%
jun 20074152501921378323621 -19.7%-17.9% -15.1%-33.3% 71.0%53.7%
mai 20074402702061498033142  -17.3%10.0% 7.0%13.8% 83.6%80.5%
abr 2007453258192134773214   -4.5%28.0% 3.3%3.6% 78.2%70.7%
mar 2007413238188134722917   -20.7%-21.6% 1.7%7.7% 75.6%68.3%
fev 20074332311771176926111  -10.6%-10.3% -8.8%-3.7% 74.4%63.4%
jan 200746027420613279299   -14.9%-12.1% 7.8%22.7% 81.5%65.9%
dez 2006484271207130792981  4.0%-31.0% -15.9%-18.5% 75.6%53.7%
nov 2006442277219147872991  27.3%-17.1% -1.8%35.0% 89.9%65.9%
out 20065063042281559223101  18.8%-25.8% 7.9%-28.6% 91.6%48.8%
set 2006493282211141833011   11.6%-18.9% 5.8%-3.4% 84.9%68.3%
ago 20064982832071358632161  -2.8%-11.1% -10.3%16.0% 80.3%70.7%
jul 20064882922211447328141  -4.7%-15.2% -5.3%0.0% 89.5%61.0%
jun 20065173072391568428111  69.5%47.4% -5.1%-13.8% 94.5%61.0%
mai 2006511313249169923011   84.4%50.0% 24.1%31.8% 99.6%70.7%
abr 200642425920114278259   27.2%-13.8% -13.2%-31.2% 80.3%53.7%
mar 200648030523716684371611 117.4%164.3% 11.1%10.3% 92.4%78.0%
fev 2006459264198140872971  81.7%141.7% -12.0%-6.5% 83.2%70.7%
jan 20065373102421621023315   240.8%266.7% 22.3%-24.4% 94.5%75.6%
dez 20054362611991468942122  86.0%500.0% 12.9%28.1% 77.3%100.0%
nov 200537121617211772354   561.5%1066.7% -11.4%14.3% 68.5%78.0%
out 2005392248192138803116   -- -0.5%-24.3% 77.3%68.3%
set 2005434253189129783713   -- -6.6%15.6% 77.7%90.2%
ago 20054532732131458236131  -- -10.4%3.2% 83.2%78.0%
jul 20055183142321589533151  -- 67.4%72.2% 92.9%75.6%
jun 200530219214199611961  -- 3.1%0.0% 55.5%43.9%
mai 200529417913510062209   -- -17.4%-28.0% 53.8%43.9%
abr 20053202091581057129111  -- 46.2%108.3% 65.1%61.0%
mar 200523814310987551441  -- -2.8%0.0% 44.5%29.3%
fev 20052361411097238123   -- 91.2%50.0% 45.8%29.3%
jan 200518110071463191   -- -39.4%- 23.9%19.5%
dez 2004285157107693371   -- 327.3%- 39.5%14.6%
nov 200459342617931   -- -- 9.2%4.9%

No data on this page have been normalized to 30 day months (as WMF does on certain traffic reports).
Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Terça-feira, 3 de março 2015 04:26 a partir de cópias do banco de dados SQL de Sábado, 31 de janeiro 2015

Versão do script:2.6
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.