Estatísticas da Wikinotícias todas as línguas

Zoom           
 

Type of dump from which metrics were extracted is unknown.
See also metrics definitions


For active and very active editors (columns C and D) each editor is counted only once, even if they contributed to several languages.
For a more complete breakdown and some trends see second table Edit activity levels of registered users
DataWikinoticiaristasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
out 20140% +8% +1%   -6%+1%+1%+1%0%0%0%+1%
set 20140% -2% 0%   +4%0%+1%+1%-1%0%0%0%
ago 20140% -1% 0%   -2%0%0%+1%-7%0%0%+1%
jul 20140% +2% 0%-23%  -17%0%0%+3%0%0%0%+1%
jun 20140% -5% 0%+30%  +46%+1%0%+3%0%0%0%+2%
mai 20140% +3% 0%   -19%+1%0%+2%0%0%0%+1%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
out 201440391810512196 k 11,221407,5 k661 Mb63,9 M146 k102 k675 k456 k65 k
set 20144021149716195 k3211,221387,9 k657 Mb63,5 M144 k102 k674 k453 k64 k
ago 20144007139912194 k1911,221377,6 k654 Mb63,2 M143 k103 k673 k451 k64 k
jul 201439941610011194 k2011,221367,8 k652 Mb62,9 M142 k111 k673 k450 k64 k
jun 20143978139814193 k2611,221359,4 k649 Mb62,7 M138 k110 k672 k448 k63 k
mai 20143965171037192 k2011,221336,4 k646 Mb62,3 M133 k110 k671 k446 k62 k
abr 20143948161008192 k1711,221308,0 k643 Mb62,1 M130 k109 k670 k444 k61 k
mar 201439321712110191 k2811,221268,5 k639 Mb61,8 M127 k109 k669 k442 k60 k
fev 201439151811110190 k2311,221246,5 k635 Mb61,4 M124 k108 k668 k440 k60 k
jan 201438971410312190 k2111,221227,0 k632 Mb61,1 M120 k107 k667 k438 k59 k
dez 20133883181069189 k2111,321196,5 k628 Mb60,8 M117 k107 k667 k436 k59 k
nov 20133865139615188 k2111,221165,5 k625 Mb60,5 M116 k106 k666 k434 k59 k
out 201338521710810188 k2011,321157,3 k623 Mb60,3 M115 k106 k665 k433 k58 k
set 201338352310910187 k1711,321157,5 k620 Mb60,1 M115 k105 k664 k431 k58 k
ago 201338122212415186 k2411,2211314 k617 Mb59,8 M114 k105 k664 k430 k57 k
jul 201337901613019186 k3911,2211311 k615 Mb59,6 M113 k104 k663 k428 k57 k
jun 201337742212017184 k2911,221167,1 k611 Mb59,2 M111 k103 k663 k425 k56 k
mai 201337521612418184 k3411,321178,7 k608 Mb59,0 M109 k102 k662 k423 k56 k
abr 201337362714123183 k3811,3211720 k604 Mb58,6 M106 k100 k661 k420 k55 k
mar 201337092113319181 k3911,2211611 k599 Mb58,2 M104 k99 k660 k417 k47 k
fev 201336882315324180 k3811,3211412 k594 Mb57,8 M100 k97 k659 k414 k46 k
jan 201336652012418179 k3511,221139,6 k590 Mb57,4 M98 k95 k658 k412 k46 k
dez 201236452012019178 k3811,3211211 k586 Mb57,0 M95 k95 k657 k409 k45 k
nov 201236251511715177 k3911,3211010 k581 Mb56,6 M92 k94 k657 k406 k44 k
out 201236102111914176 k3411,321117,9 k577 Mb56,2 M91 k93 k656 k403 k44 k
set 201235891813421175 k2611,321128,9 k573 Mb55,9 M91 k91 k655 k400 k44 k
ago 201235711411925174 k3211,3211210 k570 Mb55,6 M90 k89 k655 k398 k44 k
jul 201235571613325173 k3811,321139,0 k567 Mb55,3 M89 k89 k654 k396 k43 k
jun 20123541612118171 k2711,421169,2 k564 Mb55,0 M89 k88 k654 k393 k43 k
mai 201235351412420171 k2911,421188,4 k562 Mb54,8 M88 k88 k653 k391 k43 k
abr 201235212913921170 k3211,421178,5 k559 Mb54,5 M87 k87 k653 k390 k43 k
mar 201234922014927169 k3411,421169,9 k555 Mb54,1 M87 k87 k652 k387 k43 k
fev 201234721913327168 k4011,4211511 k551 Mb53,7 M85 k86 k652 k385 k43 k
jan 201234532516029166 k4811,4211516 k547 Mb53,3 M83 k85 k651 k382 k42 k
dez 201134282214031165 k4111,4211751 k542 Mb52,9 M82 k84 k651 k379 k42 k
nov 201134061812720164 k3311,2211617 k537 Mb52,4 M80 k82 k650 k375 k30 k
out 201133882816026163 k3911,2211610 k533 Mb52,1 M79 k82 k650 k373 k30 k
set 201133601313117161 k6811,2211713 k529 Mb51,7 M78 k80 k649 k370 k29 k
ago 201133473615021159 k6111,3212412 k524 Mb51,2 M78 k80 k649 k365 k29 k
jul 201133111513524157 k6611,3213012 k520 Mb50,8 M77 k79 k648 k361 k29 k
jun 201132961214327155 k6611,4213413 k514 Mb50,2 M76 k78 k647 k356 k29 k
mai 201132842216428154 k6811,5213814 k509 Mb49,6 M75 k77 k647 k352 k28 k
abr 201132622116629151 k7211,5214116 k503 Mb49,0 M74 k76 k645 k347 k28 k
mar 201132413121539149 k8011,6214219 k496 Mb48,2 M73 k75 k642 k341 k27 k
fev 201132102617329147 k7511,7214417 k489 Mb47,4 M72 k74 k638 k333 k27 k
jan 201131842617129145 k7611,7214622 k483 Mb46,7 M71 k73 k635 k328 k27 k
dez 201031582616432142 k13911,7214548 k474 Mb45,9 M69 k71 k623 k322 k26 k
nov 201031322416326138 k8911,8213728 k456 Mb44,5 M67 k70 k587 k313 k26 k
out 201031082316121135 k13511,8213455 k446 Mb43,6 M66 k69 k568 k307 k25 k
set 201030853015518131 k11811,7212546 k429 Mb42,3 M64 k67 k533 k300 k25 k
ago 201030554618219128 k11211,7211547 k414 Mb41,1 M63 k67 k500 k293 k25 k
jul 201030093415627124 k11611,7210347 k399 Mb39,9 M63 k66 k467 k287 k24 k
jun 201029753718330120 k12911,6209146 k384 Mb38,6 M62 k65 k434 k281 k23 k
mai 201029382918930117 k12211,6207950 k368 Mb37,3 M60 k63 k401 k274 k23 k
abr 201029093317229113 k12511,5206547 k352 Mb36,0 M59 k62 k368 k267 k23 k
mar 201028762116823109 k12611,5205249 k337 Mb34,7 M58 k61 k336 k260 k22 k
fev 201028552616523105 k12511,5204039 k321 Mb33,4 M57 k61 k302 k253 k22 k
jan 201028293018033102 k12611,5203158 k308 Mb32,3 M56 k59 k276 k246 k22 k
dez 20092799251662698 k12911,4201449 k292 Mb31,0 M55 k58 k242 k239 k22 k
nov 20092774251732994 k12711,3200046 k276 Mb29,7 M54 k57 k209 k231 k21 k
out 20092749301793590 k14311,3198655 k262 Mb28,5 M53 k56 k177 k225 k21 k
set 20092719281802785 k13811,3197744 k245 Mb27,1 M52 k55 k146 k216 k20 k
ago 20092691341813081 k13211,3196553 k230 Mb25,8 M51 k54 k115 k209 k20 k
jul 20092657281702677 k11011,2194553 k214 Mb24,5 M50 k53 k81 k202 k20 k
jun 20092629461972473 k8911,0192042 k200 Mb23,3 M50 k52 k51 k195 k19 k
mai 20092583301592371 k5110,8192212 k193 Mb22,5 M48 k51 k42 k190 k19 k
abr 20092553311712369 k3010,9191812 k188 Mb22,0 M48 k49 k41 k185 k19 k
mar 20092522231642468 k3510,9190713 k184 Mb21,6 M47 k48 k41 k183 k18 k
fev 20092499181731767 k3410,9190011 k181 Mb21,1 M46 k47 k40 k179 k18 k
jan 20092481351802566 k3910,9189511 k178 Mb20,8 M45 k46 k40 k176 k18 k
dez 20082446442012765 k4910,9189113 k174 Mb20,4 M44 k45 k39 k173 k18 k
nov 20082402341992963 k5211,0189813 k171 Mb19,9 M43 k45 k39 k169 k17 k
out 20082368392123562 k6011,1190017 k167 Mb19,5 M42 k44 k38 k165 k17 k
set 20082329352173560 k7411,1189815 k162 Mb18,9 M40 k43 k37 k161 k17 k
ago 20082294442463258 k5311,3190714 k157 Mb18,3 M39 k42 k36 k156 k16 k
jul 20082250492133056 k5611,4191313 k152 Mb17,8 M37 k41 k35 k152 k16 k
jun 20082201522293354 k5911,5192215 k148 Mb17,3 M36 k40 k34 k148 k16 k
mai 20082149312102553 k4611,6192513 k143 Mb16,7 M34 k39 k33 k143 k15 k
abr 20082118281952851 k4811,7192315 k139 Mb16,3 M33 k38 k33 k139 k15 k
mar 20082090372083150 k5111,7192317 k135 Mb15,8 M32 k37 k32 k134 k15 k
fev 20082053522433948 k6211,8191617 k131 Mb15,2 M30 k35 k31 k129 k15 k
jan 20082001482414446 k5711,9191218 k126 Mb14,6 M29 k32 k31 k124 k14 k
dez 20071953372083544 k4611,9192016 k121 Mb14,1 M27 k31 k30 k120 k14 k
nov 20071916402163543 k5512,0192216 k117 Mb13,6 M26 k30 k29 k116 k14 k
out 20071876542353241 k6612,1191919 k112 Mb13,1 M24 k29 k28 k112 k13 k
set 20071822482153239 k6112,3191023 k106 Mb12,4 M22 k28 k27 k107 k13 k
ago 20071774511982837 k4812,2191315 k101 Mb11,8 M20 k27 k25 k103 k12 k
jul 20071723452153136 k5112,3191416 k97 Mb11,3 M19 k26 k24 k99 k12 k
jun 20071678351922334 k5012,4191518 k93 Mb10,9 M18 k25 k23 k95 k11 k
mai 20071643642063333 k4512,4192117 k89 Mb10,4 M17 k25 k22 k91 k11 k
abr 20071579601923231 k3512,4191916 k86 Mb10,0 M15 k24 k21 k87 k10 k
mar 20071519381882930 k3512,3190815 k82 Mb9,6 M14 k24 k21 k84 k9,9 k
fev 20071481371772629 k3812,3189114 k79 Mb9,2 M14 k23 k20 k81 k9,5 k
jan 20071444552062928 k3412,2188314 k76 Mb8,8 M13 k22 k19 k78 k9,0 k
dez 20061389472072927 k3112,1187814 k73 Mb8,5 M15 k22 k19 k75 k8,6 k
nov 20061342562192926 k3812,0187619 k70 Mb8,1 M15 k21 k18 k72 k8,4 k
out 20061286542282325 k3211,9185414 k66 Mb7,7 M14 k20 k18 k69 k8,0 k
set 20061232552113024 k4311,8184214 k63 Mb7,3 M14 k19 k17 k66 k7,5 k
ago 20061177582073223 k4011,9186616 k60 Mb7,0 M13 k19 k17 k63 k7,1 k
jul 20061119552212822 k3911,8186315 k56 Mb6,6 M12 k17 k16 k59 k6,7 k
jun 20061064432392820 k4111,8186916 k53 Mb6,3 M11 k16 k15 k56 k6,3 k
mai 20061021772493019 k4211,7186615 k50 Mb5,8 M10 k14 k14 k53 k5,9 k
abr 2006944522012518 k3411,7186612 k47 Mb5,4 M9,4 k13 k13 k50 k5,5 k
mar 2006892732373717 k3811,7186814 k44 Mb5,1 M8,9 k13 k12 k47 k5,2 k
fev 2006819441982916 k3111,6186214 k41 Mb4,7 M8,2 k12 k11 k43 k4,8 k
jan 2006775582423315 k4811,4184218 k38 Mb4,4 M7,8 k12 k11 k41 k4,5 k
dez 2005717541994213 k4111,3183416 k34 Mb3,9 M7,2 k10 k10 k37 k4,1 k
nov 2005663421723512 k3011,1184112 k31 Mb3,6 M6,6 k8,9 k9,3 k34 k3,6 k
out 2005621621923111 k4711,0182816 k28 Mb3,3 M6,4 k8,3 k8,8 k32 k3,4 k
set 200555950189379,7 k4710,9183815 k25 Mb2,9 M3,6 k7,3 k8,3 k28 k3,0 k
ago 200550965213368,2 k4411,0180017 k20 Mb2,4 M3,1 k6,4 k7,6 k24 k2,6 k
jul 200544489232336,9 k4410,7182619 k17 Mb2,0 M2,7 k5,2 k7,0 k20 k2,1 k
jun 200535541141195,6 k3210,0186610 k14 Mb1,6 M2,1 k4,0 k6,5 k17 k1,5 k
mai 200531446135204,6 k339,818639,9 k11 Mb1,4 M1,6 k3,4 k6,1 k14 k1,2 k
abr 200526860158293,6 k4410,0183112 k8,7 Mb1,0 M1,2 k2,7 k5,6 k11 k973
mar 200520851109142,2 k2910,518097,6 k5,4 Mb638 k7941,5 k5,0 k7,4 k667
fev 200515750109121,3 k2011,817524,8 k3,2 Mb367 k6145934,2 k4,6 k399
jan 2005107287197691114,217643,9 k1,8 Mb210 k4152357483,0 k251
dez 2004796310774261216,318515,7 k1,0 Mb120 k30423831,9 k114
nov 2004161626373216,818021,2 k177 kb21 k11981829935
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
 WikinoticiaristasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikinoticiaristas (usuários registrados)
A = Wikinoticiaristas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikinoticiaristas que editaram pelo menos dez vezes desde que chegaram
C = Wikinoticiaristas que contribuíram cinco vezes ou mais este mês
D = Wikinoticiaristas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users

Articles = namespace 0 only.

Notes on count methodology:
Before user activity is counted, edits per user per month are totalled for all languages. So each user is counted only once.
Before July 2012 WMF used a rough approximation for establishing total editor counts:
Users who contributed to several wikis could be counted twice or more (only for wikis where their monthy activity reached any given threshold)

In each column all editors with at least x edits are included.
For example, an editor with 12 edits in some month would be counted in columns 1,2,5,10.

 
YoY = Year over Year change

MoM/PoM: Unofficial quasi-normalized metrics, meant for quick and rough monthly trend assesment:
* = As a rough 'normalization' currently only first 28 days per month are taken into account
MoM = Month over Month change
PoM = Percentage of Maximum, (= highest value ever in that column)
PoM = Note how a short month can have PoM 100% even when the absolute editor count is less than the all-time maximum for that column

  Users  Trends
Edits ≥ 1  3  5  10  25  100  250  1000  2500  5 YoY100 YoY 5 MoM100 MoM 5 PoM100 PoM
out 201424213210575351261  -2.8%20.0% 2.1%-20.0% 40.3%29.3%
set 2014199121977140167   -11.0%60.0% 2.2%36.4% 39.5%36.6%
ago 2014207128996637124   -20.2%-20.0% -5.2%0.0% 38.7%26.8%
jul 201422713710066431151  -23.1%-42.1% 4.3%-21.4% 40.8%26.8%
jun 20142301399870431491  -18.3%-17.6% -6.1%133.3% 39.1%34.1%
mai 20142551461037134761  -16.9%- 3.1%- 41.6%14.6%
abr 20142671511006635852  -29.1%- -17.9%- 40.3%19.5%
mar 201426815412182431063  -9.0%-47.4% 5.4%- 49.2%22.0%
fev 201425615311179431041  -27.5%-58.3% 13.3%0.0% 46.6%24.4%
jan 201422712310376451251  -16.9%-33.3% 3.2%25.0% 41.2%24.4%
dez 20132251351067038921  -11.7%- 4.4%- 39.9%19.5%
nov 2013227128966438153   -17.9%0.0% -9.9%66.7% 38.2%36.6%
out 20132601441087341103   -9.2%-28.6% -3.8%- 42.4%22.0%
set 201323714710974341041  -18.7%-52.4% -11.8%- 44.1%22.0%
ago 201324914612483441561  4.2%-40.0% -2.5%-11.8% 50.0%36.6%
jul 20132891581308958198   -2.3%-24.0% 2.5%0.0% 51.3%41.5%
jun 20132791561208450177   -0.8%-5.6% 0.8%0.0% 50.0%41.5%
mai 201329615512488481861  0.0%-10.0% -13.2%-26.1% 49.6%41.5%
abr 20133271791411026323101  1.4%9.5% 7.1%35.3% 57.1%56.1%
mar 201330917813390601972  -10.7%-29.6% -17.0%-29.2% 53.4%41.5%
fev 20132991901531036924112  15.0%-11.1% 40.4%71.4% 64.3%58.5%
jan 201327516412488501882  -22.5%-37.9% 0.0%-12.5% 45.8%34.1%
dez 201224714712084441992  -14.3%-38.7% -4.4%6.7% 45.8%39.0%
nov 201224314411783541582  -7.9%-25.0% 1.8%7.1% 47.9%36.6%
out 201224015411990511471  -25.6%-46.2% -13.2%-33.3% 47.1%34.1%
set 2012283172134895421111  2.3%23.5% 16.2%10.5% 54.2%51.2%
ago 201224914811992542591  -20.7%19.0% -12.6%-13.6% 46.6%46.3%
jul 201225716213310058258   -1.5%4.2% 10.4%37.5% 53.4%53.7%
jun 201225515812184561881  -15.4%-33.3% -4.2%-20.0% 48.3%39.0%
mai 20122561591249356207   -24.4%-28.6% -12.4%11.1% 50.4%48.8%
abr 201227616813910763216   -16.3%-27.6% -5.5%-28.0% 57.6%43.9%
mar 20122971721491026427101  -30.7%-30.8% 12.4%-3.8% 60.9%61.0%
fev 201230417513310265279   -23.1%-6.9% -19.4%-7.1% 54.2%63.4%
jan 20123692041601167429121  -6.4%0.0% 19.4%3.7% 67.2%68.3%
dez 20112881691401096831111  -14.6%-3.1% 8.1%42.1% 56.3%65.9%
nov 201126615612793582011   -22.1%-23.1% -19.5%-20.8% 52.1%46.3%
out 2011357200160105682611   -0.6%23.8% 20.3%41.2% 64.7%58.5%
set 201127617013185561772  -15.5%-5.6% -11.7%-15.0% 53.8%41.5%
ago 2011350201150114702172  -17.6%10.5% 9.8%-13.0% 60.9%48.8%
jul 20112901671351006324112  -13.5%-11.1% -5.7%-11.5% 55.5%56.1%
jun 2011315186143997027111  -21.9%-10.0% -10.8%4.0% 58.8%63.4%
mai 20114092191641046928101  -13.2%-6.7% -1.3%-13.8% 66.0%61.0%
abr 20113612051661247229132  -3.5%0.0% -23.6%-19.4% 66.8%70.7%
mar 201144326221515110039151  28.0%69.6% 20.2%24.1% 87.4%87.8%
fev 20113302071731248229132  4.8%26.1% 8.8%20.8% 72.7%70.7%
jan 2011365211171126772982  -5.0%-12.1% 0.0%-22.6% 66.8%58.5%
dez 2010327209164125803291  -1.2%23.1% 0.0%29.2% 66.8%75.6%
nov 2010354208163117702691  -5.8%-10.3% 1.3%33.3% 66.8%58.5%
out 20103442161611207121121  -10.1%-40.0% 6.1%0.0% 66.0%43.9%
set 2010353191155115701871  -13.9%-33.3% -15.9%5.9% 62.2%43.9%
ago 20103612281821348819711 0.6%-36.7% 17.3%-26.1% 73.9%41.5%
jul 20103722031561167927111  -8.2%3.8% -16.2%-14.8% 63.0%56.1%
jun 201036221918313483307   -7.1%25.0% 2.3%-6.9% 75.2%65.9%
mai 201041724418912880301311 18.9%30.4% 8.7%11.5% 73.5%70.7%
abr 20104352321721297429112  0.6%26.1% 3.9%13.0% 67.6%63.4%
mar 20103532081681116823911 2.4%-4.2% -6.1%0.0% 65.1%56.1%
fev 2010368206165126782310   -4.6%35.3% -4.6%-23.3% 69.3%56.1%
jan 201041522718013085331421 0.0%32.0% 11.6%30.4% 72.7%73.2%
dez 20093582031661176626101  -17.4%-3.7% -7.2%-17.9% 65.1%56.1%
nov 20093762231731227429101  -13.1%0.0% -1.8%-6.7% 70.2%68.3%
out 200940522817913374351531 -15.6%0.0% -1.7%11.1% 71.4%73.2%
set 2009378222180128742710   -17.1%-22.9% 1.2%0.0% 72.7%65.9%
ago 20093722241811297630131  -26.4%-6.2% 5.6%12.5% 71.8%65.9%
jul 200940322617011772261111 -20.2%-13.3% -11.5%0.0% 68.1%58.5%
jun 2009471257197128712411   -14.0%-27.3% 24.5%9.1% 76.9%58.5%
mai 2009387216159110662381  -24.3%-8.0% -8.7%4.8% 61.8%53.7%
abr 2009432222171117592382  -12.3%-17.9% 6.6%-4.5% 67.6%51.2%
mar 200942822816411062241121 -21.2%-22.6% -12.7%29.4% 63.4%53.7%
fev 2009407218173108581751  -28.8%-56.4% 0.0%-19.0% 72.7%41.5%
jan 2009470244180120692510   -25.3%-43.2% -9.9%-19.2% 72.7%51.2%
dez 2008547294201130752781  -3.4%-22.9% 0.5%-7.1% 80.7%63.4%
nov 2008431246199137842911   -7.9%-17.1% -5.0%-12.5% 80.3%68.3%
out 20084512652121579135111  -9.8%9.4% -4.7%-8.6% 84.5%78.0%
set 2008479277217149863512   0.9%9.4% -10.6%9.4% 88.7%85.4%
ago 20085243192461751003210   24.2%14.3% 19.2%28.0% 99.2%78.0%
jul 2008459274213141723010   -0.9%-3.2% -11.6%-24.2% 83.2%61.0%
jun 2008500304229159943316   19.3%43.5% 17.3%50.0% 94.1%80.5%
mai 20084072562101417625102  1.9%-24.2% 0.0%-8.3% 80.3%53.7%
abr 2008414259195131762882  1.6%-12.5% -4.5%-20.0% 80.3%58.5%
mar 20084122572081518931141  10.6%6.9% -16.0%-23.1% 84.0%73.2%
fev 20085233052431811203914   37.3%50.0% 4.8%0.0% 100.0%95.1%
jan 20084773022411771164412   17.0%51.7% 13.5%14.7% 95.4%95.1%
dez 2007427254208155793511   0.5%20.7% -0.5%0.0% 84.0%82.9%
nov 2007428265216158923515   -1.4%20.7% -5.6%9.7% 84.5%82.9%
out 20074582892351619232152  3.1%39.1% 5.4%6.9% 89.5%75.6%
set 20074162622151408432122  1.9%6.7% 12.8%16.0% 84.9%70.7%
ago 20074382521981408228101  -4.3%-12.5% -13.5%-16.7% 75.2%61.0%
jul 200745226021515310131111  -2.7%10.7% 22.5%36.4% 87.0%73.2%
jun 20074152501921378323621 -19.7%-17.9% -15.1%-33.3% 71.0%53.7%
mai 20074402702061498033142  -17.3%10.0% 7.0%13.8% 83.6%80.5%
abr 2007453258192134773214   -4.5%28.0% 3.3%3.6% 78.2%70.7%
mar 2007413238188134722917   -20.7%-21.6% 1.7%7.7% 75.6%68.3%
fev 20074332311771176926111  -10.6%-10.3% -8.8%-3.7% 74.4%63.4%
jan 200746027420613279299   -14.9%-12.1% 7.8%22.7% 81.5%65.9%
dez 2006484271207130792981  4.0%-31.0% -15.9%-18.5% 75.6%53.7%
nov 2006442277219147872991  27.3%-17.1% -1.8%35.0% 89.9%65.9%
out 20065063042281559223101  18.8%-25.8% 7.9%-28.6% 91.6%48.8%
set 2006493282211141833011   11.6%-18.9% 5.8%-3.4% 84.9%68.3%
ago 20064982832071358632161  -2.8%-11.1% -10.3%16.0% 80.3%70.7%
jul 20064882922211447328141  -4.7%-15.2% -5.3%0.0% 89.5%61.0%
jun 20065173072391568428111  69.5%47.4% -5.1%-13.8% 94.5%61.0%
mai 2006511313249169923011   84.4%50.0% 24.1%31.8% 99.6%70.7%
abr 200642425920114278259   27.2%-13.8% -13.2%-31.2% 80.3%53.7%
mar 200648030523716684371611 117.4%164.3% 11.1%10.3% 92.4%78.0%
fev 2006459264198140872971  81.7%141.7% -12.0%-6.5% 83.2%70.7%
jan 20065373102421621023315   240.8%266.7% 22.3%-24.4% 94.5%75.6%
dez 20054362611991468942122  86.0%500.0% 12.9%28.1% 77.3%100.0%
nov 200537121617211772354   561.5%1066.7% -11.4%14.3% 68.5%78.0%
out 2005392248192138803116   -- -0.5%-24.3% 77.3%68.3%
set 2005434253189129783713   -- -6.6%15.6% 77.7%90.2%
ago 20054532732131458236131  -- -10.4%3.2% 83.2%78.0%
jul 20055183142321589533151  -- 67.4%72.2% 92.9%75.6%
jun 200530219214199611961  -- 3.1%0.0% 55.5%43.9%
mai 200529417913510062209   -- -17.4%-28.0% 53.8%43.9%
abr 20053202091581057129111  -- 46.2%108.3% 65.1%61.0%
mar 200523814310987551441  -- -2.8%0.0% 44.5%29.3%
fev 20052361411097238123   -- 91.2%50.0% 45.8%29.3%
jan 200518110071463191   -- -39.4%- 23.9%19.5%
dez 2004285157107693371   -- 327.3%- 39.5%14.6%
nov 200459342617931   -- -- 9.2%4.9%

No data on this page have been normalized to 30 day months (as WMF does on certain traffic reports).
Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Segunda-feira, 1 de dezembro 2014 04:30 a partir de cópias do banco de dados SQL de Sexta-feira, 31 de outubro 2014

Versão do script:2.6
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.