Estatísticas da Wikinotícias todas as línguas

Zoom           
 

Type of dump from which metrics were extracted is unknown.
See also metrics definitions


For active and very active editors (columns C and D) each editor is counted only once, even if they contributed to several languages.
For a more complete breakdown and some trends see second table Edit activity levels of registered users
DataWikinoticiaristasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
set 20140% -1% 0%   +10%0%0%+1%-2%0%0%0%
ago 20140% -1% 0%   -3%0%0%+1%-7%0%0%+1%
jul 20140% +2% 0%   -18%0%0%+3%0%0%0%+1%
jun 20140% -5% 0%+29%  +44%+1%+1%+3%0%0%0%+2%
mai 20140% +3% 0%   -20%+1%0%+2%0%0%0%+1%
abr 20140% -17% 0%   -5%+1%+1%+3%+1%0%0%+1%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
set 20143952159816194 k3211,321608,3 k656 Mb62,9 M152 k100 k675 k444 k65 k
ago 20143937139912193 k1811,321607,5 k653 Mb62,6 M151 k103 k674 k442 k64 k
jul 201439241610011193 k1911,321597,7 k651 Mb62,4 M149 k110 k674 k440 k64 k
jun 20143908159814192 k2711,321579,4 k648 Mb62,1 M145 k110 k673 k439 k63 k
mai 20143893181037191 k2111,321566,5 k645 Mb61,8 M141 k109 k672 k437 k62 k
abr 20143875181008191 k1711,321538,1 k641 Mb61,5 M138 k109 k671 k435 k61 k
mar 201438571612110190 k2811,321488,5 k637 Mb61,2 M134 k108 k670 k433 k61 k
fev 201438411811110189 k2311,321466,5 k634 Mb60,9 M132 k107 k669 k431 k60 k
jan 201438231210312188 k2211,321446,9 k630 Mb60,6 M128 k107 k668 k429 k59 k
dez 20133811191069188 k2111,321416,5 k627 Mb60,3 M125 k106 k667 k426 k59 k
nov 20133792149615187 k2111,321385,5 k623 Mb60,0 M124 k106 k666 k425 k59 k
out 201337781710810187 k2011,321377,3 k621 Mb59,7 M123 k105 k666 k423 k58 k
set 201337612310910186 k1711,321377,5 k618 Mb59,5 M122 k105 k665 k422 k58 k
ago 201337382312415185 k2511,3213513 k615 Mb59,3 M122 k104 k664 k420 k57 k
jul 201337151413019185 k2711,321359,9 k613 Mb59,0 M120 k103 k664 k418 k57 k
jun 201337012212017184 k2911,321357,2 k610 Mb58,8 M118 k102 k663 k416 k56 k
mai 201336791612418183 k3311,321368,6 k607 Mb58,5 M117 k101 k663 k414 k56 k
abr 201336632614123182 k3811,3213520 k603 Mb58,2 M114 k100 k662 k411 k55 k
mar 201336372113319181 k4011,2213411 k598 Mb57,7 M111 k98 k661 k408 k47 k
fev 201336162415324179 k3711,3213212 k593 Mb57,3 M108 k96 k660 k405 k46 k
jan 201335921912418178 k3511,321329,9 k588 Mb57,0 M106 k95 k659 k402 k46 k
dez 201235732012019177 k3911,3213111 k584 Mb56,6 M103 k94 k658 k399 k45 k
nov 201235531811715176 k4011,3212810 k579 Mb56,1 M100 k93 k657 k397 k44 k
out 201235352111914175 k3511,321298,7 k575 Mb55,7 M99 k92 k657 k393 k44 k
set 201235141813421174 k2811,321319,2 k571 Mb55,4 M99 k90 k656 k391 k44 k
ago 201234961411925173 k3311,3213110 k568 Mb55,1 M98 k88 k656 k388 k44 k
jul 201234821613325172 k4011,321339,3 k565 Mb54,8 M97 k88 k655 k386 k43 k
jun 20123466612118170 k2811,421369,4 k561 Mb54,4 M96 k87 k655 k383 k43 k
mai 201234601612420170 k3011,421378,6 k559 Mb54,2 M96 k87 k654 k381 k43 k
abr 201234442913921169 k3311,421378,6 k556 Mb53,9 M95 k86 k654 k379 k43 k
mar 201234152014927168 k3411,421369,9 k552 Mb53,5 M94 k85 k653 k377 k43 k
fev 201233952013327167 k4011,5213511 k548 Mb53,1 M92 k84 k653 k374 k42 k
jan 201233752716029165 k4911,5213416 k544 Mb52,7 M90 k83 k652 k371 k42 k
dez 201133482214031164 k4111,5213751 k539 Mb52,3 M89 k83 k652 k368 k42 k
nov 201133261812720163 k3411,2213617 k534 Mb51,8 M87 k81 k651 k365 k30 k
out 201133083216026162 k4211,2213611 k530 Mb51,5 M86 k81 k651 k363 k29 k
set 201132761313117160 k6811,2213813 k526 Mb51,1 M85 k79 k650 k359 k29 k
ago 201132633615021158 k6111,3214612 k521 Mb50,6 M85 k78 k650 k354 k29 k
jul 201132271413524156 k6611,4215213 k516 Mb50,2 M84 k78 k649 k350 k29 k
jun 201132131314327154 k6511,4215613 k511 Mb49,6 M83 k77 k648 k346 k28 k
mai 201132002216428152 k6911,5215915 k505 Mb49,0 M82 k76 k648 k341 k28 k
abr 201131782316629150 k7211,6216216 k498 Mb48,3 M83 k75 k646 k336 k28 k
mar 201131553321539148 k8111,6216120 k491 Mb47,5 M80 k74 k643 k329 k27 k
fev 201131222417329145 k7411,7216217 k483 Mb46,6 M78 k72 k639 k322 k27 k
jan 201130982717129143 k7511,7216422 k477 Mb46,0 M77 k71 k635 k316 k26 k
dez 201030712616432141 k13711,8216248 k468 Mb45,2 M74 k70 k624 k310 k26 k
nov 201030452216326137 k8711,8215328 k451 Mb43,7 M73 k69 k588 k301 k26 k
out 201030232416121134 k13411,8215055 k440 Mb42,9 M72 k68 k569 k296 k25 k
set 201029993015518130 k11711,8214246 k423 Mb41,5 M70 k66 k534 k288 k25 k
ago 201029694518219126 k11011,7213247 k408 Mb40,3 M69 k66 k501 k282 k25 k
jul 201029243215627123 k12211,7212047 k394 Mb39,1 M68 k65 k468 k276 k23 k
jun 201028923718330119 k12811,6211146 k378 Mb37,9 M67 k64 k435 k270 k23 k
mai 201028552918930115 k12111,7209950 k363 Mb36,6 M66 k63 k402 k263 k23 k
abr 201028263217229112 k12511,6208646 k347 Mb35,3 M65 k62 k369 k256 k22 k
mar 201027942116823108 k12611,6207349 k331 Mb34,0 M64 k61 k336 k249 k22 k
fev 201027732616523104 k12411,5206239 k316 Mb32,8 M63 k60 k303 k242 k22 k
jan 201027473018033100 k12511,5205358 k303 Mb31,7 M62 k59 k277 k235 k22 k
dez 20092717251662697 k12811,4203749 k287 Mb30,3 M61 k58 k243 k228 k22 k
nov 20092692261732993 k12711,4202346 k271 Mb29,1 M60 k57 k210 k220 k21 k
out 20092666301793589 k14311,3201055 k257 Mb27,8 M59 k56 k178 k214 k21 k
set 20092636291802784 k13811,3200245 k240 Mb26,5 M58 k54 k147 k205 k20 k
ago 20092607341813080 k13211,3199153 k225 Mb25,2 M57 k54 k116 k198 k20 k
jul 20092573291702676 k11211,2197253 k209 Mb23,9 M56 k53 k82 k191 k19 k
jun 20092544441972472 k9011,1194842 k195 Mb22,7 M55 k52 k52 k184 k19 k
mai 20092500291592370 k5110,9195212 k187 Mb21,9 M54 k51 k43 k178 k19 k
abr 20092471341712368 k3411,0194712 k183 Mb21,3 M53 k48 k42 k174 k19 k
mar 20092437271642467 k4211,0193914 k179 Mb20,9 M53 k48 k42 k171 k18 k
fev 20092410191731766 k3411,0193611 k175 Mb20,4 M52 k47 k41 k168 k18 k
jan 20092391351802565 k3811,0193111 k172 Mb20,1 M51 k45 k41 k165 k18 k
dez 20082356272012763 k3911,0192710 k169 Mb19,7 M50 k45 k40 k162 k17 k
nov 20082329321992962 k5111,0192812 k166 Mb19,3 M49 k44 k40 k159 k17 k
out 20082297382123561 k5611,1193015 k162 Mb18,9 M48 k43 k39 k155 k17 k
set 20082259322173559 k6911,2192714 k157 Mb18,4 M46 k42 k38 k151 k17 k
ago 20082227432463257 k4511,4193513 k152 Mb17,8 M44 k41 k37 k146 k16 k
jul 20082184472133056 k4511,4193612 k149 Mb17,4 M43 k40 k36 k143 k16 k
jun 20082137482293354 k5311,5193814 k145 Mb16,9 M41 k40 k36 k139 k16 k
mai 20082089282102553 k4311,6194013 k141 Mb16,5 M40 k38 k35 k136 k15 k
abr 20082061271952851 k4611,6193714 k137 Mb16,1 M39 k37 k34 k132 k15 k
mar 20082034352083150 k5011,7193717 k134 Mb15,6 M37 k36 k33 k128 k15 k
fev 20081999512433948 k6011,7193017 k129 Mb15,0 M36 k34 k33 k124 k15 k
jan 20081948522414446 k5911,8192518 k124 Mb14,5 M34 k32 k32 k119 k14 k
dez 20071896342083545 k4311,9193415 k119 Mb13,9 M31 k31 k31 k115 k14 k
nov 20071862402163543 k5111,9193516 k116 Mb13,5 M30 k30 k30 k111 k14 k
out 20071822542353242 k6211,9192918 k111 Mb13,0 M28 k29 k29 k108 k13 k
set 20071768472153240 k5612,1191823 k106 Mb12,3 M26 k28 k28 k104 k13 k
ago 20071721481982838 k4412,0191615 k101 Mb11,8 M24 k27 k26 k100 k12 k
jul 20071673432153137 k4712,1191516 k98 Mb11,4 M23 k26 k25 k97 k12 k
jun 20071630331922335 k4612,1191318 k94 Mb10,9 M22 k25 k24 k93 k11 k
mai 20071597582063334 k4312,1191716 k90 Mb10,6 M21 k25 k24 k90 k11 k
abr 20071539611923233 k3312,1191216 k87 Mb10,1 M20 k24 k23 k86 k10 k
mar 20071478391882932 k3211,9190115 k84 Mb9,8 M19 k24 k22 k83 k10,0 k
fev 20071439371772631 k3711,8188114 k80 Mb9,4 M19 k23 k22 k81 k9,5 k
jan 20071402532062930 k3111,7187214 k77 Mb9,0 M18 k23 k21 k78 k9,1 k
dez 20061349422072929 k2911,6186414 k75 Mb8,7 M20 k22 k21 k75 k8,7 k
nov 20061307552192928 k3611,5185818 k72 Mb8,4 M19 k21 k20 k73 k8,4 k
out 20061252502282327 k2911,3183313 k68 Mb7,9 M19 k20 k19 k70 k8,0 k
set 20061202522113026 k4211,2181614 k65 Mb7,6 M18 k20 k19 k67 k7,6 k
ago 20061150562073224 k3911,3183516 k62 Mb7,3 M17 k19 k18 k64 k7,2 k
jul 20061094532212823 k3911,2182915 k59 Mb6,9 M17 k18 k18 k61 k6,7 k
jun 20061041422392822 k3911,1183215 k56 Mb6,5 M16 k16 k17 k57 k6,3 k
mai 2006999722493021 k3911,0182414 k53 Mb6,2 M15 k15 k15 k55 k6,0 k
abr 2006927452012520 k3210,9181611 k50 Mb5,8 M14 k14 k15 k52 k5,7 k
mar 2006882542373719 k5310,8180816 k47 Mb5,5 M13 k13 k14 k49 k5,4 k
fev 2006828461982917 k4410,9181115 k43 Mb5,0 M9,8 k12 k12 k46 k5,0 k
jan 2006782592423316 k5910,8179819 k40 Mb4,6 M8,8 k12 k12 k43 k4,7 k
dez 2005723531994214 k5510,9179718 k35 Mb4,1 M7,9 k11 k10 k39 k4,3 k
nov 2005670411723512 k3210,9181712 k31 Mb3,6 M7,0 k9,1 k9,4 k35 k3,7 k
out 2005629621923111 k4710,8180616 k29 Mb3,3 M6,7 k8,5 k8,9 k33 k3,4 k
set 2005567501893710,0 k4710,7181215 k25 Mb2,9 M3,9 k7,5 k8,4 k29 k3,0 k
ago 200551765213368,5 k4410,8177217 k21 Mb2,4 M3,4 k6,6 k7,8 k25 k2,6 k
jul 200545290232337,2 k4410,4179119 k17 Mb2,1 M3,0 k5,5 k7,1 k21 k2,1 k
jun 200536241141195,9 k329,6182210 k14 Mb1,7 M2,4 k4,2 k6,7 k17 k1,5 k
mai 200532146135204,9 k339,418119,9 k12 Mb1,4 M1,9 k3,6 k6,3 k15 k1,2 k
abr 200527560158293,9 k449,4176912 k9,1 Mb1,1 M1,5 k2,8 k5,7 k12 k1,0 k
mar 200521554109142,5 k319,617227,8 k5,9 Mb685 k1,1 k1,7 k5,1 k8,0 k705
fev 200516151109121,6 k2610,616485,4 k3,5 Mb402 k8777094,3 k4,9 k416
jan 2005110317198111213,617194,1 k1,8 Mb216 k5492577633,1 k255
dez 2004796310774261216,318515,7 k1,0 Mb120 k30423831,9 k114
nov 2004161626373216,818021,2 k177 kb21 k11981829935
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
 WikinoticiaristasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikinoticiaristas (usuários registrados)
A = Wikinoticiaristas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikinoticiaristas que editaram pelo menos dez vezes desde que chegaram
C = Wikinoticiaristas que contribuíram cinco vezes ou mais este mês
D = Wikinoticiaristas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users

Articles = namespace 0 only.

Notes on count methodology:
Before user activity is counted, edits per user per month are totalled for all languages. So each user is counted only once.
Before July 2012 WMF used a rough approximation for establishing total editor counts:
Users who contributed to several wikis could be counted twice or more (only for wikis where their monthy activity reached any given threshold)

In each column all editors with at least x edits are included.
For example, an editor with 12 edits in some month would be counted in columns 1,2,5,10.

 
YoY = Year over Year change

MoM/PoM: Unofficial quasi-normalized metrics, meant for quick and rough monthly trend assesment:
* = As a rough 'normalization' currently only first 28 days per month are taken into account
MoM = Month over Month change
PoM = Percentage of Maximum, (= highest value ever in that column)
PoM = Note how a short month can have PoM 100% even when the absolute editor count is less than the all-time maximum for that column

  Users  Trends
Edits ≥ 1  3  5  10  25  100  250  1000  2500  5 YoY100 YoY 5 MoM100 MoM 5 PoM100 PoM
set 2014201121987240167   -10.1%60.0% 3.3%36.4% 39.9%36.6%
ago 2014207128996637124   -20.2%-20.0% -5.2%0.0% 38.7%26.8%
jul 201422813710066431151  -23.1%-42.1% 4.3%-21.4% 40.8%26.8%
jun 20142301399870441491  -18.3%-17.6% -6.1%133.3% 39.1%34.1%
mai 20142561471037134761  -16.9%- 3.1%- 41.6%14.6%
abr 20142681521006735852  -29.1%- -17.9%- 40.3%19.5%
mar 201427015512182431063  -9.0%-47.4% 5.4%- 49.2%22.0%
fev 201425715311179431041  -27.5%-58.3% 13.3%0.0% 46.6%24.4%
jan 201422812410376451251  -16.9%-33.3% 3.2%25.0% 41.2%24.4%
dez 20132261351067038921  -11.7%- 4.4%- 39.9%19.5%
nov 2013229128966438153   -17.9%0.0% -9.9%66.7% 38.2%36.6%
out 20132611441087442103   -9.2%-28.6% -3.8%- 42.4%22.0%
set 201323714710974341041  -18.7%-52.4% -11.8%- 44.1%22.0%
ago 201324914612483441561  4.2%-40.0% -2.5%-11.8% 50.0%36.6%
jul 20132891581308958198   -2.3%-24.0% 2.5%0.0% 51.3%41.5%
jun 20132791561208450177   -0.8%-5.6% 0.8%0.0% 50.0%41.5%
mai 201329615512488481861  0.0%-10.0% -13.2%-26.1% 49.6%41.5%
abr 20133281801411026323101  1.4%9.5% 7.1%35.3% 57.1%56.1%
mar 201330917813390601972  -10.7%-29.6% -17.0%-29.2% 53.4%41.5%
fev 20132991901531036924112  15.0%-11.1% 40.4%71.4% 64.3%58.5%
jan 201327516512488501882  -22.5%-37.9% 0.0%-12.5% 45.8%34.1%
dez 201224714712084441992  -14.3%-38.7% -4.4%6.7% 45.8%39.0%
nov 201224314411783541582  -7.9%-25.0% 1.8%7.1% 47.9%36.6%
out 201224215511990511471  -25.6%-46.2% -13.2%-33.3% 47.1%34.1%
set 2012283172134895421111  2.3%23.5% 16.2%10.5% 54.2%51.2%
ago 201224914811992542591  -20.7%19.0% -12.6%-13.6% 46.6%46.3%
jul 201225716213310058258   -1.5%4.2% 10.4%37.5% 53.4%53.7%
jun 201225515812184561881  -15.4%-33.3% -4.2%-20.0% 48.3%39.0%
mai 20122561591249356207   -24.4%-28.6% -12.4%11.1% 50.4%48.8%
abr 201227616813910763216   -16.3%-27.6% -5.5%-28.0% 57.6%43.9%
mar 20122971721491026427101  -30.7%-30.8% 12.4%-3.8% 60.9%61.0%
fev 201230517613310265279   -23.1%-6.9% -19.4%-7.1% 54.2%63.4%
jan 20123692041601167429121  -6.4%0.0% 19.4%3.7% 67.2%68.3%
dez 20112881691401096831111  -14.6%-3.1% 8.1%42.1% 56.3%65.9%
nov 201126615612793582011   -22.1%-23.1% -19.5%-20.8% 52.1%46.3%
out 2011357200160105682611   -0.6%23.8% 20.3%41.2% 64.7%58.5%
set 201127617013185561772  -15.5%-5.6% -11.7%-15.0% 53.8%41.5%
ago 2011350201150114702172  -17.6%10.5% 9.8%-13.0% 60.9%48.8%
jul 20112901671351006324112  -13.5%-11.1% -5.7%-11.5% 55.5%56.1%
jun 2011315186143997027111  -21.9%-10.0% -10.8%4.0% 58.8%63.4%
mai 20114092191641046928101  -13.2%-6.7% -1.3%-13.8% 66.0%61.0%
abr 20113612051661247229132  -3.5%0.0% -23.6%-19.4% 66.8%70.7%
mar 201144326221515110039151  28.0%69.6% 20.2%24.1% 87.4%87.8%
fev 20113302071731248229132  4.8%26.1% 8.8%20.8% 72.7%70.7%
jan 2011365211171126772982  -5.0%-12.1% 0.0%-22.6% 66.8%58.5%
dez 2010327209164125803291  -1.2%23.1% 0.0%29.2% 66.8%75.6%
nov 2010354208163117702691  -5.8%-10.3% 1.3%33.3% 66.8%58.5%
out 20103442161611207121121  -10.1%-40.0% 6.1%0.0% 66.0%43.9%
set 2010353191155115701871  -13.9%-33.3% -15.9%5.9% 62.2%43.9%
ago 20103612281821348819711 0.6%-36.7% 17.3%-26.1% 73.9%41.5%
jul 20103722031561167927111  -8.2%3.8% -16.2%-14.8% 63.0%56.1%
jun 201036221918313483307   -7.1%25.0% 2.3%-6.9% 75.2%65.9%
mai 201041724418912880301311 18.9%30.4% 8.7%11.5% 73.5%70.7%
abr 20104352321721297429112  0.6%26.1% 3.9%13.0% 67.6%63.4%
mar 20103532081681116823911 2.4%-4.2% -6.1%0.0% 65.1%56.1%
fev 2010368206165126782310   -4.6%35.3% -4.6%-23.3% 69.3%56.1%
jan 201041522718013085331421 0.0%32.0% 11.6%30.4% 72.7%73.2%
dez 20093582031661176626101  -17.4%-3.7% -7.2%-17.9% 65.1%56.1%
nov 20093762231731227429101  -13.1%0.0% -1.8%-6.7% 70.2%68.3%
out 200940522817913374351531 -15.6%0.0% -1.7%11.1% 71.4%73.2%
set 2009378222180128742710   -17.1%-22.9% 1.2%0.0% 72.7%65.9%
ago 20093722241811297630131  -26.4%-6.2% 5.6%12.5% 71.8%65.9%
jul 200940322617011772261111 -20.2%-13.3% -11.5%0.0% 68.1%58.5%
jun 2009471257197128712411   -14.0%-27.3% 24.5%9.1% 76.9%58.5%
mai 2009387216159110662381  -24.3%-8.0% -8.7%4.8% 61.8%53.7%
abr 2009432222171117592382  -12.3%-17.9% 6.6%-4.5% 67.6%51.2%
mar 200942822816411062241121 -21.2%-22.6% -12.7%29.4% 63.4%53.7%
fev 2009407218173108581751  -28.8%-56.4% 0.0%-19.0% 72.7%41.5%
jan 2009470244180120692510   -25.3%-43.2% -9.9%-19.2% 72.7%51.2%
dez 2008547294201130752781  -3.4%-22.9% 0.5%-7.1% 80.7%63.4%
nov 2008431246199137842911   -7.9%-17.1% -5.0%-12.5% 80.3%68.3%
out 20084512652121579135111  -9.8%9.4% -4.7%-8.6% 84.5%78.0%
set 2008479277217149863512   0.9%9.4% -10.6%9.4% 88.7%85.4%
ago 20085243192461751003210   24.2%14.3% 19.2%28.0% 99.2%78.0%
jul 2008459274213141723010   -0.9%-3.2% -11.6%-24.2% 83.2%61.0%
jun 2008500304229159943316   19.3%43.5% 17.3%50.0% 94.1%80.5%
mai 20084072562101417625102  1.9%-24.2% 0.0%-8.3% 80.3%53.7%
abr 2008414259195131762882  1.6%-12.5% -4.5%-20.0% 80.3%58.5%
mar 20084122572081518931141  10.6%6.9% -16.0%-23.1% 84.0%73.2%
fev 20085233052431811203914   37.3%50.0% 4.8%0.0% 100.0%95.1%
jan 20084773022411771164412   17.0%51.7% 13.5%14.7% 95.4%95.1%
dez 2007427254208155793511   0.5%20.7% -0.5%0.0% 84.0%82.9%
nov 2007428265216158923515   -1.4%20.7% -5.6%9.7% 84.5%82.9%
out 20074582892351619232152  3.1%39.1% 5.4%6.9% 89.5%75.6%
set 20074162622151408432122  1.9%6.7% 12.8%16.0% 84.9%70.7%
ago 20074382521981408228101  -4.3%-12.5% -13.5%-16.7% 75.2%61.0%
jul 200745226021515310131111  -2.7%10.7% 22.5%36.4% 87.0%73.2%
jun 20074152501921378323621 -19.7%-17.9% -15.1%-33.3% 71.0%53.7%
mai 20074402702061498033142  -17.3%10.0% 7.0%13.8% 83.6%80.5%
abr 2007453258192134773214   -4.5%28.0% 3.3%3.6% 78.2%70.7%
mar 2007413238188134722917   -20.7%-21.6% 1.7%7.7% 75.6%68.3%
fev 20074332311771176926111  -10.6%-10.3% -8.8%-3.7% 74.4%63.4%
jan 200746027420613279299   -14.9%-12.1% 7.8%22.7% 81.5%65.9%
dez 2006484271207130792981  4.0%-31.0% -15.9%-18.5% 75.6%53.7%
nov 2006442277219147872991  27.3%-17.1% -1.8%35.0% 89.9%65.9%
out 20065063042281559223101  18.8%-25.8% 7.9%-28.6% 91.6%48.8%
set 2006493282211141833011   11.6%-18.9% 5.8%-3.4% 84.9%68.3%
ago 20064982832071358632161  -2.8%-11.1% -10.3%16.0% 80.3%70.7%
jul 20064882922211447328141  -4.7%-15.2% -5.3%0.0% 89.5%61.0%
jun 20065173072391568428111  69.5%47.4% -5.1%-13.8% 94.5%61.0%
mai 2006511313249169923011   84.4%50.0% 24.1%31.8% 99.6%70.7%
abr 200642425920114278259   27.2%-13.8% -13.2%-31.2% 80.3%53.7%
mar 200648030523716684371611 117.4%164.3% 11.1%10.3% 92.4%78.0%
fev 2006459264198140872971  81.7%141.7% -12.0%-6.5% 83.2%70.7%
jan 20065373102421621023315   240.8%266.7% 22.3%-24.4% 94.5%75.6%
dez 20054362611991468942122  86.0%500.0% 12.9%28.1% 77.3%100.0%
nov 200537121617211772354   561.5%1066.7% -11.4%14.3% 68.5%78.0%
out 2005392248192138803116   -- -0.5%-24.3% 77.3%68.3%
set 2005434253189129783713   -- -6.6%15.6% 77.7%90.2%
ago 20054532732131458236131  -- -10.4%3.2% 83.2%78.0%
jul 20055183142321589533151  -- 67.4%72.2% 92.9%75.6%
jun 200530219214199611961  -- 3.1%0.0% 55.5%43.9%
mai 200529417913510062209   -- -17.4%-28.0% 53.8%43.9%
abr 20053202091581057129111  -- 46.2%108.3% 65.1%61.0%
mar 200523814310987551441  -- -2.8%0.0% 44.5%29.3%
fev 20052361411097238123   -- 91.2%50.0% 45.8%29.3%
jan 200518110071463191   -- -39.4%- 23.9%19.5%
dez 2004285157107693371   -- 327.3%- 39.5%14.6%
nov 200459342617931   -- -- 9.2%4.9%

No data on this page have been normalized to 30 day months (as WMF does on certain traffic reports).
Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Terça-feira, 4 de novembro 2014 22:22 a partir de cópias do banco de dados SQL de Terça-feira, 30 de setembro 2014

Versão do script:2.6
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.