Estatísticas da Wikiquote inglês

Zoom           
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist
 
Monthly counts & Quarterly rankings
 
DataWikiquotariansArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
out 2009+2% +4% +1%   -1%+1%+1%+1%+5%+4%+2%+1%
set 2009+1% +11% +1%   +35%+1%+1%+1%+4%+5%+1%+1%
ago 2009+1% -26% +1%   -15%+1%+1%+1%+1%+1%0%+1%
jul 2009+2% +45% +1%   +3%+1%+1%+1%+1%+3%+2%+1%
jun 2009+1% -22% +1%   -9%0%0%+1%+1%+1%+1%+1%
mai 2009+2% +6% +1%   -11%+1%+1%+1%+1%+3%+1%+1%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
out 20092418391281015 k550,8696513 k124 Mb19,6 M70 k25 k11 k37 k10 k
set 20092379331231115 k550,5695713 k123 Mb19,4 M69 k24 k11 k37 k10 k
ago 2009234633111915 k350,169649,6 k122 Mb19,3 M68 k23 k10 k36 k10 k
jul 2009231348151914 k549,8696111 k121 Mb19,1 M68 k23 k10 k36 k9,9 k
jun 20092265301041014 k549,5699311 k120 Mb19,0 M67 k22 k9,7 k35 k9,9 k
mai 20092235381331014 k549,3703212 k120 Mb18,9 M66 k22 k9,6 k35 k9,8 k
abr 2009219743126914 k549,0703614 k118 Mb18,7 M65 k22 k9,3 k35 k9,7 k
mar 20092154381421114 k548,6703014 k117 Mb18,5 M64 k21 k8,9 k34 k9,7 k
fev 20092116311161014 k548,1704811 k116 Mb18,3 M63 k21 k8,6 k34 k9,6 k
jan 20092085451311014 k547,8709112 k115 Mb18,2 M62 k21 k8,6 k33 k9,5 k
dez 20082040371171113 k547,4711712 k114 Mb18,1 M61 k20 k8,4 k33 k9,4 k
nov 20082003501291413 k547,1714513 k113 Mb18,0 M61 k20 k8,3 k33 k9,3 k
out 20092418391281015 k550,8696513 k124 Mb19,6 M70 k25 k11 k37 k10 k
set 20092379331231115 k550,5695713 k123 Mb19,4 M69 k24 k11 k37 k10 k
ago 2009234633111915 k350,169649,6 k122 Mb19,3 M68 k23 k10 k36 k10 k
jul 2009231348151914 k549,8696111 k121 Mb19,1 M68 k23 k10 k36 k9,9 k
jun 20092265301041014 k549,5699311 k120 Mb19,0 M67 k22 k9,7 k35 k9,9 k
mai 20092235381331014 k549,3703212 k120 Mb18,9 M66 k22 k9,6 k35 k9,8 k
abr 2009219743126914 k549,0703614 k118 Mb18,7 M65 k22 k9,3 k35 k9,7 k
mar 20092154381421114 k548,6703014 k117 Mb18,5 M64 k21 k8,9 k34 k9,7 k
fev 20092116311161014 k548,1704811 k116 Mb18,3 M63 k21 k8,6 k34 k9,6 k
jan 20092085451311014 k547,8709112 k115 Mb18,2 M62 k21 k8,6 k33 k9,5 k
dez 20082040371171113 k547,4711712 k114 Mb18,1 M61 k20 k8,4 k33 k9,4 k
nov 20082003501291413 k547,1714513 k113 Mb18,0 M61 k20 k8,3 k33 k9,3 k
out 2008195335122913 k446,6716513 k112 Mb17,8 M60 k20 k8,3 k32 k9,2 k
set 2008191828127713 k546,1735212 k114 Mb18,1 M59 k20 k8,3 k32 k9,1 k
ago 2008189031126613 k545,7743312 k114 Mb18,1 M58 k20 k8,3 k32 k9,0 k
jul 2008185941135613 k645,3742315 k112 Mb17,8 M58 k19 k8,3 k31 k8,9 k
jun 2008181855183912 k844,8733416 k109 Mb17,4 M56 k19 k7,7 k31 k8,6 k
mai 20081763441631312 k744,4731216 k107 Mb17,0 M54 k19 k7,4 k30 k8,5 k
abr 20081719361281012 k843,8725417 k105 Mb16,6 M53 k19 k7,2 k29 k8,4 k
mar 2008168342142912 k743,2724615 k102 Mb16,3 M51 k19 k7,1 k28 k8,2 k
fev 20081641401331112 k642,7723517 k101 Mb15,9 M50 k18 k6,8 k28 k7,9 k
jan 2008160138149911 k841,9721416 k98 Mb15,6 M48 k18 k6,4 k27 k5,6 k
dez 2007156337125911 k941,4721415 k96 Mb15,3 M47 k18 k5,9 k26 k4,8 k
nov 2007152642137811 k841,1720415 k93 Mb14,9 M46 k18 k5,6 k26 k4,7 k
out 2007148430134811 k740,5716915 k91 Mb14,5 M44 k17 k5,2 k25 k4,6 k
set 2007145440140810 k739,8709914 k88 Mb14,1 M43 k16 k4,8 k25 k4,4 k
ago 20071414531481610 k839,3706715 k86 Mb13,7 M41 k14 k4,6 k24 k4,3 k
jul 20071361661721110 k1038,7702514 k83 Mb13,3 M40 k13 k4,1 k23 k4,1 k
jun 200712954816189,7 k938,5705514 k81 Mb12,9 M38 k13 k3,5 k22 k4,0 k
mai 2007124763197169,4 k838,1704320 k78 Mb12,5 M36 k13 k3,2 k21 k3,8 k
abr 2007118450149109,2 k836,9693818 k75 Mb12,0 M34 k12 k2,9 k20 k3,6 k
mar 2007113458160138,9 k1136,0686324 k72 Mb11,6 M33 k11 k2,6 k19 k3,2 k
fev 2007107658144118,6 k834,7686315 k69 Mb11,1 M30 k11 k2,4 k18 k3,0 k
jan 2007101854163128,3 k1033,8673817 k66 Mb10,6 M29 k10 k2,1 k17 k2,8 k
dez 20069645413798,0 k733,0663515 k62 Mb10,1 M27 k10 k1,8 k16 k2,7 k
nov 200691045146107,8 k832,1652015 k60 Mb9,6 M26 k9,9 k1,6 k15 k2,6 k
out 20068654214597,6 k631,2648813 k57 Mb9,3 M24 k9,7 k1,6 k15 k2,5 k
set 20068234512587,4 k630,1637113 k55 Mb8,9 M24 k9,5 k1,5 k14 k2,4 k
ago 20067785713877,2 k729,1626814 k53 Mb8,5 M23 k8,8 k1,3 k13 k2,3 k
jul 20067215614687,0 k727,9620413 k50 Mb8,2 M22 k8,5 k1,1 k13 k2,2 k
jun 200666553131116,8 k1926,9611314 k48 Mb7,8 M21 k8,2 k93312 k2,1 k
mai 20066124712966,2 k527,1624713 k44 Mb7,3 M18 k7,6 k69011 k2,0 k
abr 20065654310976,0 k525,7595611 k41 Mb6,7 M17 k7,4 k57311 k1,9 k
mar 20065223410155,9 k924,4567511 k38 Mb6,3 M16 k7,1 k4809,7 k1,7 k
fev 2006488318855,6 k723,7554210 k35 Mb5,8 M16 k6,8 k4128,9 k1,6 k
jan 20064574211175,4 k922,6536712 k33 Mb5,5 M15 k5,5 k3988,7 k1,6 k
dez 2005415368755,1 k721,6517710 k30 Mb5,0 M14 k4,8 k3698,0 k1,5 k
nov 2005379247144,9 k820,550208,5 k28 Mb4,6 M14 k4,4 k3417,5 k1,4 k
out 2005355286764,6 k1119,849109,2 k26 Mb4,3 M13 k4,2 k2796,8 k1,3 k
set 2005327105564,3 k619,147086,4 k23 Mb3,8 M12 k3,9 k2056,2 k1,2 k
ago 2005317298374,1 k918,445019,2 k21 Mb3,5 M11 k3,4 k1725,7 k1,1 k
jul 2005288247263,9 k1717,442199,7 k18 Mb3,0 M10 k2,6 k1575,3 k994
jun 2005264236463,3 k817,242327,2 k16 Mb2,6 M9,2 k1,7 k754,6 k901
mai 2005241216363,1 k616,241265,7 k15 Mb2,4 M8,6 k1,4 k644,1 k820
abr 2005220195772,9 k915,338986,8 k13 Mb2,1 M8,1 k1,3 k503,6 k744
mar 2005201144452,6 k914,338504,9 k12 Mb1,9 M7,3 k1,6 k423,4 k618
fev 2005187163532,4 k413,838843,0 k11 Mb1,7 M6,8 k1,6 k202,8 k524
jan 20051711238 2,2 k413,337952,8 k9,8 Mb1,6 M6,5 k1,5 k152,4 k496
dez 2004159205132,1 k512,637484,0 k9,1 Mb1,5 M6,2 k1,4 k112,2 k464
nov 2004139195012,0 k511,633973,3 k7,7 Mb1,3 M5,5 k1,5 k81,9 k384
out 200412093641,8 k910,732103,2 k6,8 Mb1,1 M5,1 k1,4 k61,6 k329
set 2004111163711,5 k510,632162,4 k6,1 Mb974 k4,4 k1,4 k61,3 k284
ago 200495102511,4 k410,131461,4 k5,4 Mb863 k3,7 k1,5 k61,1 k194
jul 20048592831,2 k59,932231,8 k5,0 Mb806 k3,5 k1,6 k21,1 k172
jun 20047672111,1 k49,732791,4 k4,4 Mb716 k3,3 k1,8 k3942155
mai 2004691019296339,630811,4 k3,7 Mb602 k2,8 k1,7 k2739129
abr 200459719186039,128719663,1 Mb508 k2,5 k1,4 k159094
mar 200452410177838,827988582,8 Mb453 k2,2 k1,3 k154775
fev 200448 10167228,928367562,4 Mb403 k2,1 k1,1 k146066
jan 20044839160638,627508032,1 Mb351 k1,8 k1,1 k130254
dez 20034538 51318,629164141,9 Mb319 k1,4 k958127947
nov 200342612149228,229189891,8 Mb306 k1,3 k922123445
out 200336216 42417,124705561,4 Mb230 k1,1 k767112336
set 2003341324137836,524207971,1 Mb178 k942665110434
ago 200321818229255,72298970820 kb135 k814375 4030
jul 2003131217115054,71522697276 kb42 k215101 1813
jun 20031   1 1,02247 2,4 kb414     
mai 20031   1 1,02247 2,4 kb414     
abr 20031   1 1,02247 2,4 kb414     
mar 20031   1 1,02247 2,4 kb414     
fev 20031   1 1,02247 2,4 kb414     
jan 200311  1 1,0224712,4 kb414     
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
The following table ranks this project in relation to projects in other languages with 1000+ articles
set 200911111111111311188
ago 200911111511111311188
jul 200911111111111311188
jun 200911111111111311188
mai 200911111111111311188
abr 200911111111111311188
mar 200911111211111311188
fev 200911111211111311188
jan 200911111211111311188
dez 200811111211111311188
nov 200811111211111311188
out 200811111211111311188
set 200811111211111311188
ago 200811111211111311188
jul 200811121211111311188
jun 200811111111111311188
mai 200811111111111311188
abr 200811111111111311188
mar 200811121111111311187
fev 200811111111111311187
jan 200811111111111311187
dez 200711121111111311187
nov 200711121211111311187
out 200711111111111211186
set 200711111211111211186
ago 200711111111111211186
jul 200711111111111211186
jun 200711121211111211186
mai 200711111111111211186
abr 200711111111111311186
mar 200711111111111211186
fev 200711111211111211186
jan 200711111111111211186
dez 200611111111111311186
nov 200611111111111311186
out 200611111211111311186
set 200611111211111311186
ago 200611111211111311186
jul 200611111411111211185
jun 200611111111111212183
mai 200611121511211312183
abr 200611111411111212183
mar 200611121411111213183
fev 200611111411111213183
jan 200611111611111212183
dez 200511121411111212183
nov 200511121211111212183
out 200511111211111212183
set 200511111321111212183
ago 200511111321111212182
jul 200511111121111212182
jun 200511111321111213182
mai 200511111221111213182
abr 200511111121111212181
mar 200511221111211212180
fev 200511121311211212180
jan 200511151311211213174
dez 200411111211111212169
nov 200411131311111112161
out 200411211111111111153
set 200411121111111111142
ago 200411211111111112133
jul 200412211111111114119
jun 20041111111111111113
mai 20041121111111111213
abr 20041111111111111213
mar 20041121111111111213
fev 20041211111111111213
jan 20041121111111111113
dez 20031111111111111113
nov 20031121111111111113
out 20031121111111111113
set 20031121111111111113
ago 20031121111111111113
jul 20031121111111111113
jun 20031141111111122113
mai 20031141111121122113
abr 20031141111121122113
mar 20031241111121122113
fev 20031131111121122112
jan 20031131111111122112
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100ediçõesbytes
 WikiquotariansArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

Wikiquotarians (usuários registrados)
A = Wikiquotarians que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikiquotarians que editaram pelo menos dez vezes desde que chegaram
C = Wikiquotarians que contribuíram cinco vezes ou mais este mês
D = Wikiquotarians que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Namespaces: Articles = 0   Talk = 1,3,5,7,9,..   Other = 2,4,6,8,..

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 5  10  25  100  250  1000  5  10  100  1000  5  10  25  100  250  1000  5  10  100  1000  5  10  25  100  250  1000  5  10  100  1000 
out 200912876391021331127161121     251332      
set 20091237335115 222 201292      201372  1   
ago 2009111562391 321 161072      231063  11  
jul 2009151824293 22  181052      3719621 1   
jun 20091045829104 33  191071      25171021     
mai 20091337436104 311 211293      2715101      
abr 20091267433951321 181064      3318102  111 
mar 20091429035117121  221484      34211251     
fev 20091166228105 21  231373      3420143  111 
jan 20091316227105 33  151184      3017102      
dez 20081175827116 431 201171      22121072     
nov 20081297633147 33  201283  111 3320126  111 
out 200912876391021331127161121     251332      
set 20091237335115 222 201292      201372  1   
ago 2009111562391 321 161072      231063  11  
jul 2009151824293 22  181052      3719621 1   
jun 20091045829104 33  191071      25171021     
mai 20091337436104 311 211293      2715101      
abr 20091267433951321 181064      3318102  111 
mar 20091429035117121  221484      34211251     
fev 20091166228105 21  231373      3420143  111 
jan 20091316227105 33  151184      3017102      
dez 20081175827116 431 201171      22121072     
nov 20081297633147 33  201283  111 3320126  111 
out 2008122643294 43  271871  111 3522145  221 
set 2008127662673 55  161162  11114526941 222 
ago 2008126673161 321 181161  111 311781  221 
jul 2008135712863111  219511 111 2817821 221 
jun 2008183994296 11  20114       301451      
mai 20081638933134 321 3418102  111 392081  111 
abr 20081288035106122  231692  111135241321 111 
mar 2008142763293 22  211591      3220132      
fev 20081337927114 21  1913102  111 3119821 111 
jan 2008149833092 111 21151031 111 3020822 111 
dez 2007125613393 331 221682  111 3524152  11  
nov 2007137783584 221 191372  111 3521134  11  
out 2007134743182 222 211372  111 251894  11  
set 2007140722582 3311241182  111 3419124  11  
ago 20071488840161 331 281561  11113625183  111 
jul 20071729542115 211 271962  11114327184  111 
jun 2007161924383 222 2620101  1111361992  111 
mai 200719799421681221 36191321 222150271541 221 
abr 20071497935106 111 2718962     3322133  1111
mar 20071608540135 33213723863     3525166  11  
fev 20071448636112111  3317962     34191061     
jan 20071638641126     2013642     341995      
dez 2006137703096     2112741     2814125      
nov 20061466627106     269832     3516115      
out 2006145542193     1310622     261686      
set 2006125642583 111 1612522     35179611    
ago 2006138722973     158622     2316841     
jul 2006146763483 11  1611632     2414841     
jun 20061317124116     2113831     22131041     
mai 2006129622763     197621     3118631 11  
abr 2006109622772 11  157521     281243      
mar 2006101582552     15113111    199411     
fev 200688502551 111 13941      17731      
jan 2006111582671 111 201041      1913641 11  
dez 200587491954 111 199321     17831      
nov 200571421642111  128521     2510642 11  
out 200567331761 111 1310311     17863      
set 200555281161 111 12541      13952      
ago 2005834919751111 169521     1512831     
jul 2005724521631111 1711742     2511742     
jun 200564432062     168641     2716951 11  
mai 200563361662     13752      181272      
abr 200557281173     118722     2211831     
mar 20054422952     662       1274       
fev 2005352073      611       1041       
jan 200538187       421       742       
dez 200451271132     542       10432  11  
nov 20045024911     863       9321      
out 20043617842     633       6331      
set 2004372291      431       642       
ago 2004251381      43        411       
jul 2004281563      831       5311      
jun 20042112511     332       221   11  
mai 20041914421     222       8321  11  
abr 2004191251      21        211       
mar 200410841      11        531       
fev 200410311      11        211       
jan 20049421      3         41        
dez 2003842       21        32    1   
nov 2003127311     1         211       
out 20031693       2         2         
set 2003242061      221       611       
ago 2003181272      421       9321      
jul 2003171261      621       721       
jun 2003                              
mai 2003                              
abr 2003                              
mar 2003                              
fev 2003                              
jan 2003                              

 

Distribuição de edições de artigos por wikiquotarians
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikiquotariansEdições total
115638100.0%305159100.0%
3539334.5%28954994.9%
10245115.7%27282489.4%
328815.6%24661280.8%
1003222.1%21614070.8%
3161000.6%17822858.4%
1000270.2%13897445.5%
3162100.1%10931135.8%
1000040.0%7154823.4%

 

50 wikiquotarians recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesPrimeira edição
ArtigosOutros
 posiçãoúltimos
30 dias
totaltotalúltimos
30 dias
datadias
atrás
agoraΔ
Kalki1 010392653816114572ago 11, 20032272
BD24122+1538161115477206set 01, 20051520
UDScott3-113915862667270jul 20, 20051563
InvisibleSun4 012713037692345set 21, 20051500
Zarbon6 0147825687 fev 27, 2007976
Ningauble9 0115178354640jul 27, 2008460
RogDel11 01743061153mar 18, 2009226
Cirt20 07415391733257nov 21, 2008343
Sketchmoose21 015915052576out 16, 2008379
Wise_Raven22 0541363313out 21, 2008374
CommonsDelinker25 0101065933fev 12, 2007991
Iddo99926 0410313751jan 03, 20051761
Sceptre28 0359934011abr 25, 20061284
Pipedreamergrey35 0778380 dez 23, 20051407
Eaglestorm37+572768779dez 16, 20061049
SamuraiMaster38-1376019 abr 09, 2007935
RyanCross39-1273277712ago 12, 2008444
StarryEyedAngel45 0564743 nov 08, 20061087
EVula46+226641118559mar 21, 20061319
JustPhil50 025919 set 01, 20041885
Zeta_Stryker51+5385874 jul 16, 2007837
Jusjih53 055755033fev 01, 20071002
Kittysmith12355-195631 ago 23, 2007799
Jzummak56+1205625 ago 01, 2007821
Nickrj62 0155213 jun 17, 2007866
Jc-S0CO66+522471792nov 26, 2007704
Mhym67+530470353nov 23, 20061072
Ichthys5876+114234 ago 12, 20061175
Drgyen81+28396  abr 03, 2009210
Arjen_Dijksman83+633392441set 02, 2007789
Macedonian90+1235737 dez 13, 20061052
WikiLubber91+839357101abr 28, 2009185
Wanjuscha93-15355  dez 16, 20051414
Chaojoker95+3213481526out 18, 20051473
Alana1079100+9313278 out 18, 2008377
Tyrenius104-113113541jan 19, 20071015
Cubs_Fan2008105-113085 fev 20, 2008618
TyrannoRanger111 022852 dez 21, 20051409
Pjau26113+482811 fev 15, 2009257
Peace_and_Passion133+272392685ago 01, 200990
Antster1983135+6172384 ago 01, 2008455
Archimedes137+2471472307941mai 08, 2009175
The_C_of_E139-1322675 jun 03, 2008514
Kpalion143+3436221192out 25, 2008370
Ericster08144+71221910 jul 04, 2008483
דולב146-1321553 dez 30, 2007670
Link_486154+112057 nov 28, 2007702
Micione171+16141921 dez 05, 2008329
Oracleofottawa172+6958192114set 13, 200947
Surfeit_of_palfreys180+605118632ago 28, 200963

 

20 wikiquotarians recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesPrimeira ediçãoúltima edição
 posiçãototaldatadias
atrás
datadias
atrás
Jeffq57951abr 19, 20042020ago 05, 200986
MosheZadka76762abr 11, 20051663set 29, 2007762
LrdChaos85949fev 22, 20061346jun 01, 2009151
Antiquary104098set 17, 20061139set 24, 200936
Aphaia122674nov 21, 20041804fev 15, 2009257
Inesculent132496mar 05, 2007970abr 26, 2008552
RPickman142330jan 01, 20051763nov 08, 2008356
121a0012152289mai 12, 20051632ago 30, 200961
Quillercouch161905fev 11, 2007992set 07, 2008418
Gandalf171897out 03, 20032219jan 02, 2008667
Cato181627fev 13, 2007990set 04, 2008421
McNoddy191551jan 18, 20071016set 23, 2008402
Rmhermen231242ago 02, 20041915mar 02, 2009242
Cbrown1023241069ago 07, 20061180set 14, 2008411
Jaxl271019dez 22, 20051408jul 12, 2007841
LGagnon29947dez 14, 20032147mai 21, 2007893
Demoman8730945ago 15, 2007807jun 24, 2009128
Fys31935fev 15, 20061353nov 19, 2008345
Achilles32862jan 04, 20032491set 04, 200956
Ed_Fitzgerald33859mai 24, 20061255jun 12, 2009140

 

usuários anônimos, ordenados por número de contribuições
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
81.101.138.1081443
72.229.48.1781404
81.107.39.41301
72.140.100.1371262
68.186.29.129872
98.192.44.39856
24.7.79.138834
74.64.124.160740
69.112.203.191730
67.171.163.212658

No total 434.099 edições foram feitas por usuários anônimos, de um total de 756.816 edições ( 57e %)
  


11 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesPrimeira ediçãoúltima edição
 posiçãototaldatadias
atrás
datadias
atrás
BrownBot15162mar 23, 2007952mar 24, 2007951
ChtitBot23924fev 24, 2007979ago 26, 200965
LeonardoRob0t32178jul 25, 20051558ago 28, 2007794
RimBot42006ago 26, 2007796out 11, 2008384
AnankeBot51971abr 05, 2008573out 30, 2009 
Dinybot6673mar 24, 2007951dez 17, 2007683
VolkovBot7627jul 10, 2007843out 02, 200928
LaaknorBot8283jul 18, 2008469out 30, 2009 
Lucia_Bot9238ago 03, 2008453dez 04, 2008330
MalafayaBot10134mai 15, 2008533nov 16, 2008348
ChenzwBot11120ago 17, 2008439mar 03, 2009241

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110JpgPng
out 200927 k5,7 k3,7 k5948451031,3 k      96%14
set 200927 k5,6 k3,7 k5938371031,3 k      96%14
ago 200927 k5,6 k3,6 k5938311031,3 k      96%14
jul 200927 k5,5 k3,6 k4938231031,2 k      96%13
jun 200926 k5,3 k3,5 k4898221031,2 k      96%13
mai 200926 k5,2 k3,5 k4898221031,2 k      96%13
out 200927 k5,7 k3,7 k5948451031,3 k      96%14
set 200927 k5,6 k3,7 k5938371031,3 k      96%14
ago 200927 k5,6 k3,6 k5938311031,3 k      96%14
jul 200927 k5,5 k3,6 k4938231031,2 k      96%13
jun 200926 k5,3 k3,5 k4898221031,2 k      96%13
mai 200926 k5,2 k3,5 k4898221031,2 k      96%13
abr 200926 k5,1 k3,4 k4878201031,2 k      96%13
mar 200926 k5,1 k3,4 k4878071031,2 k      96%13
fev 200926 k5,0 k3,3 k4867601031,2 k      95%13
jan 200925 k4,9 k3,3 k4867561031,2 k      95%13
dez 200825 k4,8 k3,2 k4827391031,1 k      96%13
nov 200825 k4,8 k3,1 k4687291031,1 k      96%13
out 200825 k4,7 k3,0 k4577201021,1 k      95%13
set 200824 k4,6 k2,9 k4567081021,1 k      95%13
ago 200824 k4,5 k2,8 k4557011021,1 k      95%13
jul 200824 k4,4 k2,7 k4546951021,1 k      95%13
jun 200823 k4,3 k2,6 k4546861021,0 k      95%13
mai 200823 k4,1 k2,6 k4546811021,0 k      95%13
abr 200823 k4,0 k2,5 k4546751021,0 k      95%13
mar 200822 k3,9 k2,5 k4546671021,0 k      95%13
fev 200822 k3,8 k2,4 k453657102999      95%13
jan 200819 k3,7 k2,4 k452649102991      95%13
dez 200718 k3,6 k2,3 k452638102974      95%13
nov 200718 k3,5 k2,3 k350590102954      95% 3
out 200718 k3,4 k2,2 k350571102936      95% 3
set 200717 k3,3 k2,1 k350563102926      96% 3
ago 200717 k3,2 k2,1 k349560102914      96% 3
jul 200717 k3,1 k1,9 k349550102874      96% 3
jun 200716 k3,0 k1,8 k344525102843      95% 3
mai 200716 k2,9 k1,8 k344514102808      96% 3
abr 200713 k2,7 k1,7 k343497102780      95% 3
mar 200713 k2,6 k1,6 k338483102759      95% 3
fev 200712 k2,5 k1,5 k337465102698      96% 3
jan 200711 k2,4 k1,4 k333433102651      96% 3
dez 200611 k2,3 k1,3 k333420102630      96% 3
nov 200611 k2,2 k1,3 k333409102591      96% 3
out 200610 k2,1 k1,2 k333395102573      94% 3
set 200610 k2,0 k1,1 k333383102560      93% 3
ago 20069,8 k1,9 k926333352102547      94% 3
jul 20069,5 k1,7 k855333330102514      94% 3
jun 20069,1 k1,6 k783333325102506      95% 3
mai 20068,4 k1,5 k745333311102427      95% 3
abr 20068,1 k1,3 k694332303102419      96% 3
mar 20067,7 k1,2 k657331261102405      95% 3
fev 20067,3 k1,2 k613330229102391      97% 3
jan 20067,1 k1,1 k579328215102381      98% 3
dez 20056,6 k999504328184102365      98% 3
nov 20056,3 k925481328177102354      98% 3
out 20056,0 k8692213271619338      99% 3
set 20055,5 k8231343271449332      99% 3
ago 20055,3 k7631263271399325      99% 3
jul 20054,9 k6991073271267309      98% 3
jun 20054,5 k6151013271167234      78% 3
mai 20054,2 k569963241097180      77% 3
abr 20053,9 k519893241007172      75% 3
mar 20053,6 k46372324736129      64% 3
fev 20053,3 k4236932468699      54% 3
jan 20053,1 k3846832467699      54% 3
dez 20042,9 k3586532437697      55% 3
nov 20042,6 k3165632120458      44% 3
out 20042,4 k2665532119450      43% 3
set 20042,1 k2405332118428      25% 3
ago 20041,9 k2035122110126      25% 2
jul 20041,7 k174512217121      20% 2
jun 20041,5 k147482216116      14% 2
mai 20041,3 k129462216115      15% 2
abr 20041,1 k107432331         2
mar 20041,0 k99422331         2
fev 200488987422331         2
jan 200479376402331         2
dez 200368770382331         2
nov 200364262362  1         2
out 200355957362  1         2
set 200348151352  1         2
ago 20033514034   1          
jul 20031731812              
jun 20031                
mai 20031                
abr 20031                
mar 20031                
fev 20031                
jan 20031                

 

50 most edited articles (> 25 edits)  More..
 

EdiçõesUnique usersArtigosArchived
TotalReg.Reg.Unreg.
988096%300257Wikiquote:Votes for deletion391.0 Mb  
61197%29171Barney & Friends503.7 Mb  
492592%426274Wikiquote:Village pump521.3 Mb  
447237%2821601List of films195.9 Mb  
414032%1331318Futurama405.1 Mb  
410331%70725Mystery Science Theater 30001331.8 Mb  
368619%851869Mitch Hedberg166.4 Mb  
366323%107937Tenth Doctor721.0 Mb  
366125%99973Family Guy823.4 Mb  
323723%1851351Anonymous102.7 Mb  
314771%401589List of people by name184.4 Mb  
309513%60981Red vs. Blue510.1 Mb  
302523%79906Scrubs (TV series)387.4 Mb  
296612%27225Carmen Sandiego437.4 Mb  
285317%62874Grey's Anatomy865.6 Mb  
272115%1491224English proverbs128.4 Mb  
261613%68727SpongeBob SquarePants385.9 Mb  
259922%128926House (TV series)610.7 Mb  
256320%67870Top Gear340.4 Mb  
24539%54739Sonic the Hedgehog153.5 Mb  
24397%49769Avatar: The Last Airbender272.3 Mb  
23767%38453Ed, Edd, 'n Eddy280.3 Mb  
226322%147912The Simpsons167.8 Mb  
225899%1814Wikiquote:Quotes of the Year127.6 Mb  
218443%200819List of television shows44.7 Mb  
214926%144970Last words125.4 Mb  
212636%55286M*A*S*H (TV series)426.8 Mb  
197615%62676Aqua Teen Hunger Force212.9 Mb  
193920%50440MythBusters107.5 Mb  
192618%80746Naruto73.5 Mb  
188122%44508Whose Line Is It Anyway?301.2 Mb  
185138%153595George W. Bush153.6 Mb  
177024%35450Invader Zim104.6 Mb  
176325%73569The Office (US)268.3 Mb  
173243%3478The Sopranos317.1 Mb  
171928%14227The Nostalgia Critic526.5 Mb  
171668%42108Dragon Ball Z454.4 Mb  
169144%176613Love82.6 Mb  
168227%56441Friends (TV series)177.9 Mb  
162823%35488Metalocalypse179.5 Mb  
1562100%4 Wikiquote:Quote of the day/Complete list484.0 Mb  
156122%62550Seinfeld132.5 Mb  
155729%90632Star Wars56.0 Mb  
147493%23974User talk:Jeffq80.5 Mb  
147023%44378The Suite Life of Zack & Cody251.1 Mb  
14668%30452Warhammer 40,000: Dawn of War126.0 Mb  
145320%60396Hannah Montana88.5 Mb  
142748%42267Angel (TV series)229.6 Mb  
137225%50352The West Wing357.0 Mb  
135125%46421How I Met Your Mother150.8 Mb  

 

ZeitGeist

For each month articles with most contributors in that month are shown.
Sometimes an article has been renamed repeatedly. For this reason the English Wikipedia article 'October 2003' features as article with most editors for many months.

x y z    ⇐    x = rank, y = contributors in that month, z = article title

jan 2003: 1 1 Russell Crowe

jul 2003: 1 22 Main Page , 2 13 List of people by name , 3 7 Winston Churchill , 4 6 Anonymous , 5 5 Albert Einstein , 6 4 Last words , 7 4 List of literary works , 8 4 Animal Farm , 9 4 Ambrose Bierce , 10 3 Animals , 11 3 Arianna Huffington , 12 3 List of misquotations , 13 3 Science , 14 3 Les Misérables , 15 3 George Carlin , 16 3 John N. Mitchell , 17 3 Stanisław Lem , 18 3 Omar Bradley , 19 3 Will Rogers , 20 3 The Devil's Dictionary , 21 3 Bill Gates , 22 3 Dwight D. Eisenhower , 23 3 Aristotle , 24 3 Douglas Adams , 25 3 Henry Ford

ago 2003: 1 16 Main Page , 2 10 List of people by name , 3 7 Last words , 4 6 William Shakespeare , 5 5 Romanian proverbs , 6 5 George W. Bush , 7 5 Mark Twain , 8 5 Anonymous , 9 5 Albert Einstein , 10 4 Finnish proverbs , 11 4 List of misquotations , 12 4 Les Misérables , 13 4 List of proverbs , 14 4 Julius Caesar , 15 4 Zen proverbs , 16 3 Dr. Seuss , 17 3 George Orwell , 18 3 Victor Hugo , 19 3 Italian proverbs , 20 3 Alfred Tennyson , 21 3 Terry Pratchett , 22 3 Linus Torvalds , 23 3 French proverbs , 24 3 W. H. Auden , 25 3 Art

set 2003: 1 13 List of people by name , 2 10 Main Page , 3 5 Larry Wall , 4 4 Linus Torvalds , 5 4 Computers , 6 4 Life , 7 4 Last words , 8 4 List of misquotations , 9 4 Anonymous , 10 3 Death , 11 3 Steven Wright , 12 3 Soichiro Honda , 13 3 Miguel de Unamuno , 14 3 Miguel de Cervantes , 15 3 Henry Wadsworth Longfellow , 16 3 John F. Kennedy , 17 3 Horace , 18 3 Dorothy Parker , 19 3 Douglas Hofstadter , 20 3 Art , 21 3 Pablo Picasso , 22 3 Religion , 23 3 Mark Twain , 24 3 List of proverbs , 25 3 List of literary works

out 2003: 1 10 List of people by name , 2 6 Main Page , 3 4 List of films , 4 3 Thomas Alva Edison , 5 3 Religion , 6 2 Love , 7 2 Inferno (Dante) , 8 2 The Matrix Reloaded , 9 2 Second Manifesto of Surrealism , 10 2 Groucho Marx , 11 2 Silence , 12 2 Life of Brian , 13 2 Bob Dylan , 14 2 The Return of the King , 15 2 The Two Towers , 16 2 The Fellowship of the Ring , 17 2 The Lord of the Rings

nov 2003: 1 10 List of people by name , 2 5 Main Page , 3 3 Stranger in a Strange Land , 4 3 The Silmarillion , 5 3 The Matrix , 6 3 List of films , 7 3 Nineteen Eighty-Four , 8 3 List of literary works , 9 2 Frank Herbert , 10 2 Dune , 11 2 Harvey , 12 2 O. Henry , 13 2 Mel Lastman , 14 2 Spider Robinson , 15 2 They Might Be Giants , 16 1 Love

dez 2003: 1 5 Main Page , 2 3 List of films , 3 2 Thomas Jefferson , 4 2 Fight Club (film) , 5 2 Ludwig Wittgenstein , 6 2 John F. Kennedy

jan 2004: 1 7 List of people by name , 2 6 Main Page , 3 5 List of literary works , 4 3 List of films , 5 2 Thomas Jefferson , 6 2 Madonna , 7 2 William Thomson , 8 2 Transwiki:Richard Feynman Quotes , 9 2 Responsibility , 10 2 Friendship , 11 2 Mohandas Karamchand Gandhi , 12 2 Ronald Reagan , 13 2 Linus Torvalds , 14 2 Arthur C. Clarke , 15 2 Computers , 16 2 Religion

fev 2004: 1 9 List of people by name , 2 8 Famous tongue twisters , 3 3 The Matrix , 4 3 Computers , 5 3 Main Page , 6 2 Love , 7 2 Stupidity , 8 2 Muhammad Saeed al-Sahhaf , 9 2 Alexander Mackenzie , 10 2 George Santayana , 11 2 Bill Watterson , 12 2 Abraham Lincoln , 13 2 Anonymous

mar 2004: 1 13 List of people by name , 2 4 Main Page , 3 3 Casablanca (film) , 4 2 God , 5 2 Willa Cather , 6 2 Caroline Dhavernas , 7 2 Wonderfalls , 8 2 Generation X: Tales For An Accelerated Culture , 9 2 Rainer Maria Rilke , 10 2 Ayn Rand , 11 2 Georg Wilhelm Friedrich Hegel , 12 2 Aldous Huxley , 13 2 The Lord of the Rings (movies) , 14 2 List of films , 15 2 Mohandas Karamchand Gandhi , 16 2 Thomas Paine , 17 2 George W. Bush , 18 1 Otto von Bismarck

abr 2004: 1 15 List of people by name , 2 9 Main Page , 3 5 Last words , 4 4 The Simpsons , 5 4 List of films , 6 4 Friedrich Nietzsche , 7 3 Wonderfalls , 8 3 Babylon 5 , 9 3 List of television shows , 10 3 Religion , 11 3 Adolf Hitler , 12 2 Franz Schubert , 13 2 Indian proverbs , 14 2 Bette Davis , 15 2 Theodore Dreiser , 16 2 Richard Brautigan , 17 2 Anne Frank , 18 2 Swedish proverbs , 19 2 William James , 20 2 Famous tongue twisters , 21 2 Futurama , 22 1 Thomas Jefferson

mai 2004: 1 12 List of people by name , 2 5 The Simpsons , 3 4 List of films , 4 4 Adolf Hitler , 5 4 Anonymous , 6 3 Monty Python and the Holy Grail , 7 3 Walt Kelly , 8 3 Family Guy , 9 3 Paul Simon , 10 3 Ali , 11 3 Chanakya , 12 3 Indian proverbs , 13 3 Ayn Rand , 14 3 List of television shows , 15 3 Terry Pratchett , 16 3 Linus Torvalds , 17 3 Politics , 18 3 Salvador Dalí , 19 3 Main Page , 20 2 Love , 21 2 Piet Hein , 22 2 Blackadder , 23 2 John Forbes Nash , 24 2 Firefly (TV series) , 25 2 Mikhail Bakunin

jun 2004: 1 14 List of people by name , 2 5 List of literary works , 3 5 Main Page , 4 4 Michael Moore , 5 4 War , 6 4 Ronald Reagan , 7 3 Cult , 8 3 List of television shows , 9 3 Mark Twain , 10 3 Dwight D. Eisenhower , 11 2 Love , 12 2 David Deutsch , 13 2 Charles Spurgeon , 14 2 Les Tontons flingueurs , 15 2 James Joyce , 16 2 Ray Charles , 17 2 Tuck Everlasting , 18 2 Firefly (TV series) , 19 2 The Simpsons , 20 2 Fight Club (film) , 21 2 Carl Sagan , 22 2 List of films , 23 2 Neil Armstrong , 24 2 G. K. Chesterton , 25 2 Linus Torvalds

jul 2004: 1 9 List of people by name , 2 9 Main Page , 3 6 Religion , 4 5 Robert A. Heinlein , 5 4 Carl Sagan , 6 4 Bertrand Russell , 7 3 Michael Moore , 8 3 Steve Jobs , 9 3 Kurt Vonnegut , 10 3 Monty Python's Flying Circus , 11 3 William S. Burroughs , 12 3 Music , 13 3 Richard Feynman , 14 3 Carl Jung , 15 3 John F. Kennedy , 16 3 Linus Torvalds , 17 3 Emo Philips , 18 3 Bill Gates , 19 2 Thomas Jefferson , 20 2 Chauncey Depew , 21 2 Norman Ralph Augustine , 22 2 Kurt Donald Cobain , 23 2 Leoš Janáček , 24 2 Robert Anton Wilson , 25 2 Office Space

ago 2004: 1 13 List of people by name , 2 6 List of literary works , 3 5 Main Page , 4 4 Plato , 5 4 Futurama , 6 4 The Simpsons , 7 4 Franklin D. Roosevelt , 8 4 Anonymous , 9 4 Oscar Wilde , 10 3 South Park , 11 3 Buffy the Vampire Slayer , 12 3 Metallica , 13 3 Groucho Marx , 14 3 Friedrich Nietzsche , 15 3 Adolf Hitler , 16 3 Voltaire , 17 2 Aneurin Bevan , 18 2 Marshall McLuhan , 19 2 Transwiki:Winston Churchill , 20 2 Julia Child , 21 2 Washington Irving , 22 2 Shimon Peres , 23 2 Tony Benn , 24 2 Tenzin Gyatso, 14th Dalai Lama , 25 2 Lily Tomlin

set 2004: 1 20 List of people by name , 2 11 Main Page , 3 9 George W. Bush , 4 6 List of television shows , 5 5 The Simpsons , 6 5 List of films , 7 5 Anonymous , 8 4 Star Wars , 9 4 Religion , 10 4 Mark Twain , 11 4 Douglas Adams , 12 3 Thomas Jefferson , 13 3 Louis Mountbatten, 1st Earl Mountbatten of Burma , 14 3 George Marshall , 15 3 Magnolia (film) , 16 3 SpongeBob SquarePants , 17 3 Prem Rawat , 18 3 Ferris Bueller's Day Off , 19 3 War , 20 3 H. G. Wells , 21 3 Italian proverbs , 22 3 Will Rogers , 23 3 List of literary works , 24 2 Love , 25 2 Charles Dickens

out 2004: 1 12 Main Page , 2 11 List of people by name , 3 8 List of films , 4 8 List of literary works , 5 6 Blackadder , 6 5 Prem Rawat , 7 5 Computers , 8 5 Douglas Adams , 9 4 Love , 10 4 Beauty , 11 4 List of television shows , 12 4 Futurama , 13 4 The Simpsons , 14 4 Oscar Wilde , 15 3 Techniques of Knowledge , 16 3 Atlas Shrugged , 17 3 Duke Nukem , 18 3 Marie Curie , 19 3 Galician proverbs , 20 3 Alexander (film) , 21 3 Kinsey (film) , 22 3 Firefly (TV series) , 23 3 Korean proverbs , 24 3 Dick Cheney , 25 3 Sherlock Holmes

nov 2004: 1 11 List of people by name , 2 10 List of films , 3 8 George W. Bush , 4 8 Main Page , 5 6 The Simpsons , 6 6 Albert Einstein , 7 5 Politics , 8 4 Indiana Jones , 9 4 Van Helsing , 10 4 List of proverbs , 11 3 Love , 12 3 The Twilight Zone (1959 TV series) , 13 3 The Incredibles , 14 3 Michael Badnarik , 15 3 Apocalypse Now , 16 3 American History X , 17 3 Gracie Allen , 18 3 Prem Rawat , 19 3 George Burns , 20 3 Erwin Rommel , 21 3 Babylon 5 , 22 3 Arthur Conan Doyle , 23 3 Doctor Who , 24 3 War , 25 3 Star Trek

dez 2004: 1 17 List of people by name , 2 9 List of films , 3 8 Futurama , 4 7 List of television shows , 5 7 Main Page , 6 5 The Simpsons , 7 5 George W. Bush , 8 5 Last words , 9 5 Adolf Hitler , 10 5 Latin proverbs , 11 4 Lewis Black , 12 4 Final Fantasy , 13 4 Aqua Teen Hunger Force , 14 4 Family Guy , 15 4 John Kerry , 16 4 Donald Rumsfeld , 17 4 War , 18 4 Dune , 19 4 Life of Brian , 20 4 Advertising slogans , 21 4 Mohandas Karamchand Gandhi , 22 4 Chinese proverbs , 23 4 List of literary works , 24 3 Thomas Jefferson , 25 3 The Fog of War

jan 2005: 1 9 List of people by name , 2 6 List of films , 3 5 Main Page , 4 4 Thomas Jefferson , 5 4 List of films/requested , 6 4 George W. Bush , 7 4 Douglas Adams , 8 3 The Simpsons , 9 3 Noam Chomsky , 10 3 Advertising slogans , 11 3 English proverbs , 12 3 Archimedes , 13 3 Latin proverbs , 14 2 Love , 15 2 Enrico Fermi , 16 2 Creationism and evolution , 17 2 Gloria Estefan , 18 2 Paracelsus , 19 2 John Dewey , 20 2 Dead Poets Society , 21 2 Batman , 22 2 The 13th Warrior , 23 2 The A Team , 24 2 Robert E. Lee , 25 2 Grosse Pointe Blank (1997)

fev 2005: 1 12 List of people by name , 2 7 Main Page , 3 6 Monty Python and the Holy Grail , 4 5 The Tick , 5 5 List of television shows , 6 5 Dwight D. Eisenhower , 7 4 Final Fantasy , 8 4 Ludwig van Beethoven , 9 4 List of films , 10 4 H. G. Wells , 11 4 James A. Michener , 12 4 Anonymous , 13 3 Arthur Miller , 14 3 Lawrence Kudlow , 15 3 Aldo Leopold , 16 3 Mighty Morphin Power Rangers , 17 3 Stargate SG-1 , 18 3 Grosse Pointe Blank (1997) , 19 3 Buffy the Vampire Slayer , 20 3 The Simpsons , 21 3 Truth , 22 3 Groucho Marx , 23 3 Margaret Cho , 24 3 Mohandas Karamchand Gandhi , 25 3 English proverbs

mar 2005: 1 14 List of people by name , 2 6 List of television shows , 3 6 Albert Einstein , 4 5 Star Wars , 5 5 List of films , 6 5 Latin proverbs , 7 4 Angel (TV series) , 8 4 Russell Crowe , 9 4 Black Hawk Down , 10 4 Atheism , 11 4 Douglas Adams , 12 3 Mary Wollstonecraft , 13 3 Sappho , 14 3 Bradley Nowell , 15 3 Keith Richards , 16 3 Saint Patrick , 17 3 Tim Moore (writer) , 18 3 David Baddiel , 19 3 Kiefer Sutherland , 20 3 Anthony Robbins , 21 3 Radical Dreamers , 22 3 The Magic School Bus , 23 3 Azerbaijani proverbs , 24 3 The Incredibles , 25 3 Arabic proverbs

abr 2005: 1 21 List of people by name , 2 12 Mitch Hedberg , 3 9 Pope John Paul II , 4 8 The Simpsons , 5 7 List of television shows , 6 7 List of films , 7 6 Anonymous , 8 6 Main Page , 9 5 Sin City , 10 5 Veronica Mars , 11 5 English proverbs , 12 5 List of literary works , 13 5 Douglas Adams , 14 5 Winston Churchill , 15 4 Dogma (film) , 16 4 Family Guy , 17 4 The Wizard of Oz , 18 4 Star Wars , 19 4 Advertising slogans , 20 4 René Descartes , 21 4 Karl Marx , 22 4 Woody Allen , 23 4 Bertrand Russell , 24 4 Albert Einstein , 25 3 Otto von Bismarck

mai 2005: 1 13 Star Wars , 2 11 List of people by name , 3 6 Palpatine , 4 6 Mitch Hedberg , 5 6 List of television shows , 6 6 List of films , 7 6 Computers , 8 5 Darth Vader , 9 5 Margaret Thatcher , 10 5 The Simpsons , 11 5 Last words , 12 5 Bill Watterson , 13 4 Angel (TV series) , 14 4 Star Trek , 15 4 Jesus , 16 4 Epitaphs , 17 4 Bill Gates , 18 3 School of Rock , 19 3 NewsRadio , 20 3 Guinevere Jones , 21 3 Georgia O'Keeffe , 22 3 David Letterman , 23 3 Crusade (TV series) , 24 3 George Galloway , 25 3 Tony Robbins

jun 2005: 1 14 List of films , 2 12 List of people by name , 3 11 List of television shows , 4 8 Star Wars , 5 8 Winston Churchill , 6 7 Batman Begins , 7 7 Mitch Hedberg , 8 7 Socrates , 9 7 Anonymous , 10 6 Darth Vader , 11 6 Plato , 12 6 Ambrose Bierce , 13 5 John Ziman , 14 5 Pyotr Ilyich Tchaikovsky , 15 5 W. Mark Felt , 16 5 Doctor Who , 17 5 Last words , 18 5 Religion , 19 5 Mark Twain , 20 5 Bertrand Russell , 21 4 The Order of the Stick , 22 4 Toy Story , 23 4 The Fifth Element , 24 4 John Derbyshire , 25 4 24

jul 2005: 1 9 List of people by name , 2 8 George W. Bush , 3 7 Harry Potter (series) , 4 7 The Simpsons , 5 7 Star Wars , 6 7 List of films , 7 6 Mitch Hedberg , 8 6 Monty Python's Flying Circus , 9 6 Carl Sagan , 10 6 Mark Twain , 11 5 Love , 12 5 London , 13 5 Firefly (TV series) , 14 5 Mystery Science Theater 3000 , 15 5 Abortion , 16 5 Star Trek , 17 5 English proverbs , 18 5 French proverbs , 19 5 Douglas Adams , 20 4 Wedding Crashers , 21 4 The Good, the Bad and the Ugly , 22 4 Jacques-Yves Cousteau , 23 4 Kate Clinton , 24 4 Million Dollar Baby , 25 4 Charlie and the Chocolate Factory (film)

ago 2005: 1 17 List of people by name , 2 8 Family Guy , 3 8 List of films , 4 6 Creationism and evolution , 5 6 Abortion , 6 6 George Bernard Shaw , 7 5 American Psycho (film) , 8 5 The Hitchhiker's Guide to the Galaxy , 9 5 Buffy the Vampire Slayer , 10 5 God , 11 5 List of television shows , 12 5 The Simpsons , 13 5 Star Trek , 14 5 Anonymous , 15 5 Winston Churchill , 16 4 Love , 17 4 Jacques Chirac , 18 4 Anti-Polonism , 19 4 Fakhri al-Qaisi , 20 4 Swingers (1996 film) , 21 4 Democracy , 22 4 Fear and Loathing in Las Vegas (film) , 23 4 The Andromeda Strain , 24 4 Ogden Nash , 25 4 Vegetarianism

set 2005: 1 11 List of films , 2 10 List of people by name , 3 6 Family Guy , 4 6 George W. Bush , 5 4 The Royal Tenenbaums , 6 4 Pure Pwnage , 7 4 James Hudson Taylor , 8 4 Showgirls , 9 4 Angel (TV series) , 10 4 Advertising slogans , 11 3 Andrew S. Tanenbaum , 12 3 Edward Heath , 13 3 The Railway Series , 14 3 Henry VIII of England , 15 3 Max Weber , 16 3 Earth , 17 3 Chief Seattle , 18 3 Adam and Eve , 19 3 The Golden Rule , 20 3 Diogenes Small , 21 3 The Godfather: Part III , 22 3 Troy (film) , 23 3 The Andy Milonakis Show , 24 3 Father Ted , 25 3 Kill Bill

out 2005: 1 12 List of people by name , 2 7 Star Wars , 3 7 List of films , 4 7 Albert Einstein , 5 6 Family Guy , 6 5 Buffy the Vampire Slayer , 7 5 List of television shows , 8 5 English proverbs , 9 5 George W. Bush , 10 4 Love , 11 4 Octavio Paz , 12 4 Danish proverbs , 13 4 Lost (TV series) , 14 4 Steve Jobs , 15 4 God , 16 4 Che Guevara , 17 4 Politics , 18 4 Benjamin Franklin , 19 4 Mark Twain , 20 3 Blade II , 21 3 Dave Matthews , 22 3 IPod , 23 3 Rachel Whiteread , 24 3 Edward Teller , 25 3 Philippine-American War

nov 2005: 1 8 List of films , 2 8 List of misquotations , 3 7 The Simpsons , 4 7 Last words , 5 7 List of people by name , 6 6 George W. Bush , 7 5 Firefly (TV series) , 8 5 List of television shows , 9 5 English proverbs , 10 4 Colin Wilson , 11 4 Extras (TV series) , 12 4 The Office (US) , 13 4 Veronica Mars , 14 4 Final Fantasy , 15 4 Buffy the Vampire Slayer , 16 4 Abortion , 17 4 Advertising slogans , 18 4 Mohandas Karamchand Gandhi , 19 4 Kate Bush , 20 4 Adolf Hitler , 21 4 Douglas Adams , 22 4 Anonymous , 23 4 Latin proverbs , 24 3 Star Fox: Assault , 25 3 Aleksis Kivi

dez 2005: 1 8 Anarchism , 2 8 Star Wars , 3 8 List of films , 4 8 Mark Twain , 5 8 List of people by name , 6 7 The Simpsons , 7 7 Abortion , 8 6 List of television shows , 9 6 George W. Bush , 10 5 True Romance , 11 5 The 40-Year-Old Virgin , 12 5 Billie Joe Armstrong , 13 5 Mitch Hedberg , 14 5 Buffy the Vampire Slayer , 15 5 Advertising slogans , 16 4 Enya , 17 4 Dane Cook , 18 4 Ursula K. Le Guin , 19 4 Warcraft , 20 4 Robert Oppenheimer , 21 4 Family Guy , 22 4 Jesus , 23 4 The Lord of the Rings , 24 4 Last words , 25 4 George Carlin

jan 2006: 1 16 List of people by name , 2 8 List of television shows , 3 7 The Simpsons , 4 6 The Hitchhiker's Guide to the Galaxy , 5 6 Star Wars , 6 6 Mark Twain , 7 5 Nelson Mandela , 8 5 Mystery Science Theater 3000 , 9 5 Star Trek , 10 5 Advertising slogans , 11 5 Adolf Hitler , 12 5 Napoleon I of France , 13 4 Calvin Coolidge , 14 4 The Incredibles , 15 4 Stargate SG-1 , 16 4 Jimmy Wales , 17 4 Red vs. Blue , 18 4 South Park , 19 4 Steve Jobs , 20 4 Family Guy , 21 4 Muhammad , 22 4 List of films , 23 4 Joseph Addison , 24 4 Richard Dawkins , 25 4 Friedrich Nietzsche

fev 2006: 1 7 List of people by name , 2 6 Jack Thompson (attorney) , 3 6 Buffy the Vampire Slayer , 4 6 Abortion , 5 6 List of films , 6 5 Red vs. Blue , 7 5 List of television shows , 8 4 Guilt , 9 4 Anarchism , 10 4 Mitch Hedberg , 11 4 Mystery Science Theater 3000 , 12 4 Indian proverbs , 13 4 George W. Bush , 14 4 Last words , 15 4 Anonymous , 16 4 Winston Churchill , 17 3 Robert Graves , 18 3 Winter , 19 3 Spring , 20 3 The Aviator , 21 3 Harold Wilson , 22 3 Charles Haughey , 23 3 Organized crime , 24 3 Weakness , 25 3 Anton Chekhov

mar 2006: 1 10 List of people by name , 2 8 George W. Bush , 3 6 Love , 4 6 The Grim Adventures of Billy & Mandy , 5 6 Star Wars , 6 6 List of films , 7 6 Last words , 8 5 V for Vendetta (film) , 9 5 Jack Thompson (attorney) , 10 5 Mystery Science Theater 3000 , 11 5 Buffy the Vampire Slayer , 12 5 List of television shows , 13 5 Abortion , 14 5 Bill Gates , 15 4 Transwiki:American History Primary Sources The Farmers Revolt and Populism , 16 4 Transwiki:American History Primary Sources Material Progress in Post-Civil War America , 17 4 Ward Cunningham , 18 4 Sitting Bull , 19 4 Michael Jackson , 20 4 Sonic the Hedgehog , 21 4 Gilmore Girls , 22 4 Firefly (TV series) , 23 4 Family Guy , 24 4 Mohandas Karamchand Gandhi , 25 3 Monty Python and the Holy Grail

abr 2006: 1 17 List of people by name , 2 10 V for Vendetta (film) , 3 8 Anonymous , 4 7 Jimmy Wales , 5 7 Star Wars , 6 6 South Park , 7 6 Doctor Who , 8 6 Last words , 9 6 Albert Einstein , 10 5 Thomas Jefferson , 11 5 Tony Almeida , 12 5 Whose Line Is It Anyway? , 13 5 Veronica Mars , 14 5 Stargate SG-1 , 15 5 Buffy the Vampire Slayer , 16 5 List of films , 17 5 George W. Bush , 18 5 Douglas Adams , 19 4 Transwiki:American History Primary Sources Economic Changes in the Young US , 20 4 Mick Jagger , 21 4 Crash (2004 film) , 22 4 Sonic the Hedgehog , 23 4 Atheism , 24 4 Pulp Fiction , 25 4 List of television shows

mai 2006: 1 11 List of people by name , 2 8 Grey's Anatomy , 3 8 George W. Bush , 4 7 The Simpsons , 5 7 Doctor Who , 6 7 List of films , 7 6 Red vs. Blue , 8 6 List of television shows , 9 6 Futurama , 10 6 Johann Wolfgang von Goethe , 11 6 Bill Gates , 12 6 Douglas Adams , 13 6 Anonymous , 14 6 Winston Churchill , 15 5 V for Vendetta (film) , 16 5 House (TV series) , 17 5 Mystery Science Theater 3000 , 18 5 The Princess Bride (film) , 19 5 Last words , 20 5 List of literary works , 21 5 Oscar Wilde , 22 5 Martin Luther King, Jr. , 23 4 Kamp Krusty , 24 4 W. E. B. Du Bois , 25 4 Patsy Kensit

jun 2006: 1 11 List of people by name , 2 8 Futurama , 3 8 List of films , 4 8 George W. Bush , 5 7 House (TV series) , 6 7 The Simpsons , 7 7 Doctor Who , 8 6 Stargate Atlantis , 9 6 Mystery Science Theater 3000 , 10 6 Muhammad , 11 6 Anonymous , 12 5 Star Trek VI: The Undiscovered Country , 13 5 MythBusters , 14 5 A Clockwork Orange , 15 5 The Mighty Boosh , 16 5 Robert A. Heinlein , 17 5 Buffy the Vampire Slayer , 18 5 The Matrix , 19 4 Star Wars Episode III: Revenge of the Sith , 20 4 Katherine Harris , 21 4 The Last Temptation of Christ , 22 4 Suikoden II , 23 4 Star Trek: The Original Series , 24 4 Simplicity , 25 4 Top Gear

jul 2006: 1 18 List of films , 2 8 List of people by name , 3 7 Fictional last words , 4 7 Jimmy Wales , 5 6 Tenth Doctor , 6 6 List of television shows , 7 6 George W. Bush , 8 5 Superman Returns , 9 5 C. S. Lewis , 10 5 Bertrand Russell , 11 4 Love , 12 4 College football , 13 4 The Adventures of Chico and Guapo , 14 4 Thierry Henry , 15 4 Stargate Atlantis , 16 4 MythBusters , 17 4 Jesse Ventura , 18 4 Frida Kahlo , 19 4 Naruto , 20 4 Mitch Hedberg , 21 4 Pirates of the Caribbean: The Curse of the Black Pearl , 22 4 The Simpsons , 23 4 Titanic (1997 film) , 24 4 The Princess Bride (film) , 25 4 The Matrix Reloaded

ago 2006: 1 10 List of television shows , 2 10 List of films , 3 10 List of people by name , 4 9 Stargate SG-1 , 5 8 Talladega Nights: The Ballad of Ricky Bobby , 6 8 The Simpsons , 7 7 Mel Gibson , 8 7 Top Gear , 9 6 Fictional last words , 10 6 House (TV series) , 11 6 Mitch Hedberg , 12 6 Buffy the Vampire Slayer , 13 5 Snakes on a Plane , 14 5 Hannah Montana , 15 5 Gilmore Girls , 16 5 Mystery Science Theater 3000 , 17 5 Babylon 5 , 18 5 Futurama , 19 5 The Bible , 20 5 English proverbs , 21 5 Benjamin Franklin , 22 5 Douglas Adams , 23 5 Anonymous , 24 4 Mersing Nguyen , 25 4 The 4400

set 2006: 1 12 Steve Irwin , 2 8 Love , 3 8 Anonymous , 4 7 Stargate SG-1 , 5 7 List of television shows , 6 7 George W. Bush , 7 7 List of people by name , 8 6 List of films , 9 6 English proverbs , 10 6 Last words , 11 6 Adolf Hitler , 12 6 Mark Twain , 13 5 Betty Edwards , 14 5 Fictional last words , 15 5 Star Wars Episode IV: A New Hope , 16 5 Anarchism , 17 5 Grey's Anatomy , 18 5 House (TV series) , 19 5 Ann Richards , 20 5 Mystery Science Theater 3000 , 21 5 Buffy the Vampire Slayer , 22 5 Sex , 23 4 Sidney Lanier , 24 4 Barbara Ehrenreich , 25 4 The Simpsons/Season 1

out 2006: 1 11 George W. Bush , 2 7 List of films , 3 7 List of people by name , 4 7 Anonymous , 5 6 Fictional last words , 6 6 South Park , 7 6 List of television shows , 8 6 The Simpsons , 9 6 Albert Einstein , 10 5 Fire Emblem , 11 5 Futurama , 12 5 Benjamin Franklin , 13 5 Last words , 14 5 Bertrand Russell , 15 4 Metal Gear , 16 4 Thomas Jefferson , 17 4 John Pomfret , 18 4 Numb3rs , 19 4 Larry Bird , 20 4 John McKay , 21 4 The Thomas Crown Affair , 22 4 Bleach (manga) , 23 4 G. Edward Griffin , 24 4 Warhammer 40,000: Dawn of War , 25 4 Solitude

nov 2006: 1 17 List of people by name , 2 11 List of films , 3 9 House (TV series) , 4 9 Futurama , 5 9 Anonymous , 6 8 Metalocalypse , 7 8 South Park , 8 8 George W. Bush , 9 7 Love , 10 7 Buffy the Vampire Slayer , 11 7 Fyodor Dostoevsky , 12 7 English proverbs , 13 6 South Park/Season 10 , 14 6 MythBusters , 15 6 Atheism , 16 6 Friends (TV series) , 17 6 Advertising slogans , 18 6 Last words , 19 5 Michael Richards , 20 5 Borat: Cultural Learnings of America for Make Benefit Glorious Nation of Kazakhstan , 21 5 The Simpsons/Season 18 , 22 5 Lawrence Eagleburger , 23 5 Dane Cook , 24 5 Battlestar Galactica (2003) , 25 5 Fahrenheit 451

dez 2006: 1 12 George W. Bush , 2 9 List of films , 3 8 Love , 4 8 List of television shows , 5 7 House (TV series) , 6 7 List of people by name , 7 6 Happy Feet , 8 6 The Office (US) , 9 6 Last words , 10 5 Buffy the Vampire Slayer/Season 4 , 11 5 Fictional last words , 12 5 One Tree Hill , 13 5 Kim Possible , 14 5 Jimmy Wales , 15 5 John Adams , 16 5 Family Guy , 17 5 The Simpsons , 18 5 Advertising slogans , 19 5 English proverbs , 20 5 List of misquotations , 21 5 List of literary works , 22 5 Winston Churchill , 23 5 Albert Einstein , 24 4 Noir , 25 4 Depeche Mode

jan 2007: 1 15 List of people by name , 2 11 List of films , 3 10 Love , 4 9 Last words , 5 8 Futurama , 6 8 George W. Bush , 7 7 Hannah Montana , 8 7 Sex , 9 7 English proverbs , 10 7 Anonymous , 11 7 Winston Churchill , 12 6 Urban decay , 13 6 Jose Rizal , 14 6 Metalocalypse , 15 6 Tenth Doctor , 16 6 Jack Thompson (attorney) , 17 6 Warcraft , 18 6 The Hitchhiker's Guide to the Galaxy , 19 6 Family Guy , 20 6 List of television shows , 21 6 Friendship , 22 6 Saddam Hussein , 23 5 Elias Aslaksen , 24 5 Mike Huckabee , 25 5 Tales of the Abyss

fev 2007: 1 11 House (TV series) , 2 10 List of films , 3 9 Grey's Anatomy , 4 9 Jesus , 5 8 Christianity , 6 8 Last words , 7 6 Fictional last words , 8 6 The Office (US) , 9 6 Muhammad Ali , 10 6 List of television shows , 11 6 Sex , 12 6 George Washington , 13 6 Mohandas Karamchand Gandhi , 14 6 George W. Bush , 15 6 List of people by name , 16 5 Thomas Jefferson , 17 5 The Simpsons/Season 9 , 18 5 Star Wars Episode V: The Empire Strikes Back , 19 5 MythBusters , 20 5 Scrubs (TV series) , 21 5 SpongeBob SquarePants , 22 5 Gilmore Girls , 23 5 Family Guy , 24 5 Futurama , 25 5 War

mar 2007: 1 11 List of films , 2 9 300 (film) , 3 9 George W. Bush , 4 8 Love , 5 8 Futurama , 6 8 Muhammad , 7 8 Jesus , 8 8 Last words , 9 7 Islam , 10 7 Scrubs (TV series) , 11 7 Aqua Teen Hunger Force , 12 7 Mark Twain , 13 7 List of people by name , 14 6 Thomas Jefferson , 15 6 Sex , 16 6 Richard Nixon , 17 5 Borat: Cultural Learnings of America for Make Benefit Glorious Nation of Kazakhstan , 18 5 Life on Mars (TV series) , 19 5 Grey's Anatomy , 20 5 Mitch Hedberg , 21 5 God , 22 5 Seinfeld , 23 5 C. S. Lewis , 24 5 Robert Frost , 25 5 T. S. Eliot

abr 2007: 1 20 List of people by name , 2 13 Tenth Doctor , 3 13 List of films , 4 10 List of television shows , 5 9 Naruto , 6 8 Kurt Vonnegut , 7 8 Last words , 8 8 Anonymous , 9 7 Blades of Glory (film) , 10 7 English proverbs , 11 7 Winston Churchill , 12 6 Scrubs (TV series) , 13 6 Futurama , 14 6 List of literary works , 15 6 Albert Einstein , 16 5 Edward Whittemore , 17 5 Patrick Pearse , 18 5 The Daleks , 19 5 The Office (US) , 20 5 House (TV series) , 21 5 SpongeBob SquarePants , 22 5 John Adams , 23 5 Firefly (TV series) , 24 5 Mystery Science Theater 3000 , 25 5 George W. Bush

mai 2007: 1 15 List of people by name , 2 14 List of films , 3 13 House (TV series) , 4 13 List of literary works , 5 11 Grey's Anatomy , 6 11 Anonymous , 7 10 Scrubs (TV series) , 8 10 Jimmy Wales , 9 10 Star Wars , 10 9 Tenth Doctor , 11 9 List of television shows , 12 9 George W. Bush , 13 9 Adolf Hitler , 14 8 Naruto , 15 7 Dragon Ball Z , 16 7 Heroes (TV series) , 17 7 Bleach (manga) , 18 7 Last words , 19 6 Pirates of the Caribbean: At World's End , 20 6 Futurama , 21 6 Advertising slogans , 22 5 Charlotte Wilson , 23 5 Crash Tag Team Racing , 24 5 300 (film) , 25 5 Superman: The Animated Series

jun 2007: 1 13 Love , 2 12 Tenth Doctor , 3 11 Dragon Ball Z , 4 10 List of films , 5 10 List of people by name , 6 9 Naruto , 7 8 Son Goku (Dragon Ball) , 8 7 Bleach (manga) , 9 7 Anakin Skywalker , 10 6 Robot Chicken , 11 6 Mitch Hedberg , 12 6 Pokémon , 13 6 Jurassic Park (film) , 14 6 Buffy the Vampire Slayer , 15 6 English proverbs , 16 6 Albert Einstein , 17 5 Dragon Ball Z: Bio-Broly , 18 5 Dragon Ball Z: Wrath of the Dragon , 19 5 Fantastic Four: Rise of the Silver Surfer , 20 5 Knocked Up , 21 5 Dragon Ball GT , 22 5 The Simpsons/Season 7 , 23 5 Dragon Ball , 24 5 Hannah Montana , 25 5 Islam

jul 2007: 1 11 List of people by name , 2 10 Harry Potter and the Deathly Hallows , 3 9 The Simpsons Movie , 4 9 List of films , 5 8 Islam , 6 8 Scrubs (TV series) , 7 8 Qur'an , 8 8 List of television shows , 9 7 Love , 10 7 Dragon Ball , 11 7 Harry Potter and the Order of the Phoenix , 12 7 Tenth Doctor , 13 6 The Pursuit of Happyness , 14 6 Transformers (film) , 15 6 300 (film) , 16 6 Harry Potter and the Philosopher's Stone , 17 6 Harry Potter and the Half-Blood Prince , 18 6 House (TV series) , 19 6 Barack Obama , 20 6 The Sopranos , 21 6 Futurama , 22 5 Harry Potter and the Order of the Phoenix (film) , 23 5 The Simpsons/Season 8 , 24 5 Bleach (manga) , 25 5 Ron Paul

ago 2007: 1 12 List of films , 2 11 Albert Einstein , 3 10 List of people by name , 4 9 List of television shows , 5 9 George W. Bush , 6 8 Ron Paul , 7 7 The Simpsons Movie , 8 6 Riaz Ahmed Gohar Shahi , 9 6 Firefly (TV series) , 10 6 Futurama , 11 5 Macy Gray , 12 5 What Women Want , 13 5 Saudi Arabia , 14 5 The Simpsons/Season 4 , 15 5 Tenth Doctor , 16 5 Dracula (1992) , 17 5 Gilmore Girls , 18 5 John F. Kennedy , 19 5 Last words , 20 5 Anonymous , 21 4 Love , 22 4 BioShock , 23 4 Superbad , 24 4 Stardust (2007 film) , 25 4 The Fly II

set 2007: 1 10 List of films , 2 10 George W. Bush , 3 9 BioShock , 4 9 List of people by name , 5 7 House (TV series) , 6 6 Warhammer 40,000: Dawn of War , 7 6 Scrubs (TV series) , 8 5 Zionism , 9 5 James Spader , 10 5 Naruto the Movie: Ninja Clash in the Land of Snow , 11 5 Thomas and Friends , 12 5 Anonymous , 13 4 Love , 14 4 Family Guy/Season 6 , 15 4 Edgar Rice Burroughs , 16 4 Fictional last words in films , 17 4 Syracuse, Sicily , 18 4 Hannah Montana , 19 4 Stuart Merrill , 20 4 Kim Possible , 21 4 Jimmy Wales , 22 4 Ovadia Yosef , 23 4 SpongeBob SquarePants , 24 4 God , 25 4 List of television shows

out 2007: 1 13 List of people by name , 2 11 Portal (game) , 3 8 Scrubs (TV series) , 4 7 Christianity , 5 6 Palindromes , 6 6 Rush Hour 3 , 7 6 The Office (US) , 8 6 Grey's Anatomy , 9 6 House (TV series) , 10 5 Muhammad , 11 4 Alice Bailey , 12 4 Rabbit-Proof Fence (film) , 13 4 The Big Bang Theory , 14 4 Material Girls , 15 4 Barney & Friends , 16 4 Metalocalypse , 17 4 Hannah Montana , 18 4 Benjamin N. Cardozo , 19 4 The Colbert Report , 20 4 Doris Lessing , 21 4 Hillary Rodham Clinton , 22 4 M*A*S*H (TV series) , 23 4 Jon Stewart , 24 4 The Matrix Reloaded , 25 4 List of films

nov 2007: 1 15 List of people by name , 2 9 Albert Einstein , 3 8 List of films , 4 8 Anonymous , 5 7 Adam Mickiewicz , 6 7 Futurama , 7 6 Mistakes , 8 6 The Office (US) , 9 5 Synagogue , 10 5 Never , 11 5 Fictional last words in films , 12 5 Brett Favre , 13 5 Top Gear , 14 5 Scrubs (TV series) , 15 5 Hillary Rodham Clinton , 16 5 God , 17 5 David Ben-Gurion , 18 5 The Simpsons , 19 5 Martin Luther King, Jr. , 20 4 Jagadguru Kripalu Ji Maharaj , 21 4 Rodney King , 22 4 Pushing Daisies , 23 4 Iran , 24 4 Barney & Friends , 25 4 Heroes (TV series)

dez 2007: 1 9 List of people by name , 2 8 House (TV series) , 3 8 Futurama , 4 8 List of films , 5 7 Ron Paul , 6 6 Barney & Friends , 7 6 Naruto , 8 6 List of television shows , 9 6 Jesus , 10 6 C. S. Lewis , 11 5 Love , 12 5 Howard Safir , 13 5 Reinhard Heydrich , 14 5 Scrubs (TV series) , 15 5 Metal Gear Solid 3: Snake Eater , 16 5 Adolf Hitler , 17 4 Alan Alda , 18 4 I Am Legend (film) , 19 4 Pakistan , 20 4 Turkey , 21 4 Benazir Bhutto , 22 4 Family Guy/Season 5 , 23 4 Metal Gear Solid 2: Sons of Liberty , 24 4 Barack Obama , 25 4 Stephen Jay Gould

jan 2008: 1 11 George W. Bush , 2 9 Chip Berlet , 3 8 List of films , 4 8 English proverbs , 5 7 Heath Ledger , 6 7 List of people by name , 7 6 Juno (film) , 8 6 Fictional last words in films , 9 6 Torchwood , 10 6 Rush Limbaugh , 11 6 Anonymous , 12 5 Edna St. Vincent Millay , 13 5 Barney & Friends , 14 5 Portal (game) , 15 5 The Simpsons/Season 13 , 16 5 The Suite Life of Zack & Cody , 17 5 Avatar: The Last Airbender , 18 5 Edmund Hillary , 19 5 Futurama , 20 5 Richard Feynman , 21 5 Advertising slogans , 22 4 Black Kettle , 23 4 Lawrence Ferlinghetti , 24 4 List of people by name, N-R , 25 4 List of people by name, D-H

fev 2008: 1 8 George W. Bush , 2 7 List of people by name, A-C , 3 7 John McCain , 4 7 Rush Limbaugh , 5 7 Hillary Rodham Clinton , 6 7 Martin Luther King, Jr. , 7 6 List of people by name, N-R , 8 6 List of people by name, D-H , 9 6 Barack Obama , 10 6 George H. W. Bush , 11 6 Anonymous , 12 6 William Shakespeare , 13 6 Albert Einstein , 14 5 Love , 15 5 Elephants , 16 5 Family Guy/Season 6 , 17 5 Christianity , 18 5 Fullmetal Alchemist , 19 5 Naruto , 20 5 The Bible , 21 5 List of films , 22 5 Isaac Newton , 23 5 Benjamin Franklin , 24 5 Oscar Wilde , 25 4 Robert J. Marks II

mar 2008: 1 9 List of people by name, S-Z , 2 9 List of people by name, N-R , 3 9 George W. Bush , 4 8 List of television shows , 5 6 List of people by name, D-H , 6 6 Torchwood , 7 6 George H. W. Bush , 8 6 List of films , 9 5 Love , 10 5 Terminator: The Sarah Connor Chronicles , 11 5 List of people by name, A-C , 12 5 Dragon Ball Z , 13 5 Flavor Flav , 14 5 Rush Limbaugh , 15 5 Anatole France , 16 5 Internet , 17 4 Cloverfield , 18 4 Rick Astley , 19 4 Juno (film) , 20 4 Nero Wolfe , 21 4 Thomas Jefferson , 22 4 Barney & Friends , 23 4 The Simpsons/Season 18 , 24 4 Cristiano Ronaldo , 25 4 Bleach (manga)

abr 2008: 1 13 Tenth Doctor , 2 9 List of television shows , 3 8 House (TV series) , 4 7 Barack Obama , 5 7 George W. Bush , 6 6 Love , 7 6 List of people by name, S-Z , 8 6 List of people by name, N-R , 9 6 List of people by name, A-C , 10 6 Barney & Friends , 11 6 Fullmetal Alchemist , 12 6 Noam Chomsky , 13 6 English proverbs , 14 6 Anonymous , 15 6 William Shakespeare , 16 6 Albert Einstein , 17 5 Matt Sanchez , 18 5 The Simpsons/Season 19 , 19 5 The Mist (film) , 20 5 The Simpsons/Season 18 , 21 5 Warhammer 40,000: Dawn of War , 22 5 Sonic the Hedgehog , 23 5 Angel (TV series) , 24 5 Rush Limbaugh , 25 5 Firefly (TV series)

mai 2008: 1 12 Tenth Doctor , 2 10 List of films , 3 8 List of people by name, N-R , 4 8 House (TV series) , 5 7 William the Silent , 6 7 Iron Man (film) , 7 7 List of people by name, A-C , 8 7 Dane Cook , 9 7 Martin Luther King, Jr. , 10 6 Matt Sanchez , 11 6 Indiana Jones and the Kingdom of the Crystal Skull , 12 6 Portal (game) , 13 6 John F. Kennedy , 14 6 George W. Bush , 15 6 Abraham Lincoln , 16 5 Short Circuit , 17 5 Joseph Gordon-Levitt , 18 5 David Allen (author) , 19 5 List of people by name, S-Z , 20 5 Fictional last words in films , 21 5 American Dad! , 22 5 God , 23 5 Winston Churchill , 24 5 Albert Einstein , 25 4 The Big Bang Theory

jun 2008: 1 14 Tenth Doctor , 2 8 List of people by name, A-C , 3 8 John McCain , 4 8 George Carlin , 5 7 Love , 6 7 Kung Fu Panda , 7 7 List of people by name, D-H , 8 7 Barney & Friends , 9 7 George Washington , 10 6 List of people by name, S-Z , 11 6 List of people by name, N-R , 12 6 List of films , 13 6 Mark Twain , 14 5 Dragon Ball Z: Season 4 , 15 5 Grand Theft Auto IV , 16 5 Dragon Ball Z: Cooler's Revenge , 17 5 Thomas Jefferson , 18 5 Dragon Ball Z , 19 5 Hannah Montana , 20 5 The Venture Bros. , 21 5 Arthur Wellesley, 1st Duke of Wellington , 22 5 Futurama , 23 5 War , 24 5 Life , 25 5 Martin Luther King, Jr.

jul 2008: 1 18 Tenth Doctor , 2 14 The Dark Knight , 3 8 Dr. Horrible's Sing-Along Blog , 4 8 Hancock (film) , 5 8 Futurama , 6 7 Matt Sanchez , 7 7 List of people by name, S-Z , 8 7 John McCain , 9 6 List of films , 10 6 Adolf Hitler , 11 6 List of literary works , 12 5 Wanted (film) , 13 5 List of people by name, N-R , 14 5 July 18 , 15 5 Pokémon , 16 5 Thomas Henry Huxley , 17 5 Anonymous , 18 4 Randy Pausch , 19 4 Christopher McCandless , 20 4 National Socialism , 21 4 Circles , 22 4 Æon Flux (film) , 23 4 Hans Frank , 24 4 Fictional last words in films , 25 4 Charlotte Brontë

ago 2008: 1 8 The Dark Knight , 2 8 John McCain , 3 7 Portal (game) , 4 7 List of films , 5 6 List of people by name, N-R , 6 6 Whose Line Is It Anyway? , 7 6 Barack Obama , 8 6 Bill O'Reilly (commentator) , 9 6 Last words , 10 5 Michael Phelps , 11 5 Michael Gambon , 12 5 Hank Aaron , 13 5 List of people by name, S-Z , 14 5 List of people by name, D-H , 15 5 List of people by name, A-C , 16 5 English proverbs , 17 4 Alex Mero , 18 4 I'm No Angel , 19 4 Mice , 20 4 Gilbert du Motier, marquis de La Fayette , 21 4 Fictional last words in films , 22 4 Jeff Dunham , 23 4 Stargate Atlantis , 24 4 Pat Robertson , 25 4 Scrubs (TV series)

set 2008: 1 11 Sarah Palin , 2 9 Anonymous , 3 6 Ron Bennington , 4 6 Barack Obama , 5 5 List of people by name, N-R , 6 5 Tenth Doctor , 7 5 September 22 , 8 5 John McCain , 9 5 Jimmy Wales , 10 5 Carmen Sandiego , 11 5 Mystery Science Theater 3000 , 12 5 Isaac Newton , 13 5 Benjamin Franklin , 14 5 Last words , 15 4 Love , 16 4 Eugen Drewermann , 17 4 List of people by name, A-C , 18 4 October 1 , 19 4 The Suite Life of Zack & Cody , 20 4 Half-Life , 21 4 House (TV series) , 22 4 Angel (TV series) , 23 4 Richard Feynman , 24 3 Frank Deford , 25 3 The Chronicles of Narnia

out 2008: 1 9 List of literary works , 2 8 List of films , 3 7 October 31 , 4 7 October 16 , 5 6 Sarah Palin , 6 6 October 30 , 7 6 October 29 , 8 6 October 28 , 9 6 October 2 , 10 5 Kenan Evren , 11 5 Pirates of the Caribbean: At World's End , 12 5 October 27 , 13 5 October 18 , 14 5 October 17 , 15 5 October 15 , 16 5 October 8 , 17 5 November 1 , 18 5 The Office (US) , 19 5 House (TV series) , 20 5 John McCain , 21 5 Barack Obama , 22 5 Abraham Lincoln , 23 5 Mark Twain , 24 5 Albert Einstein , 25 4 Love

nov 2008: 1 14 Barack Obama , 2 9 November 30 , 3 8 It's Always Sunny in Philadelphia , 4 7 Love , 5 7 Sarah Palin , 6 7 30 Rock , 7 7 November 26 , 8 7 November 24 , 9 7 November 20 , 10 7 November 11 , 11 6 The Big Bang Theory , 12 6 November 28 , 13 6 November 22 , 14 6 November 18 , 15 6 November 16 , 16 6 November 15 , 17 6 November 14 , 18 6 November 13 , 19 6 November 4 , 20 6 December 1 , 21 6 Bambi , 22 6 The Office , 23 6 Scrubs (TV series) , 24 6 James Bond (film series) , 25 6 List of literary works

dez 2008: 1 8 Love , 2 8 List of films , 3 7 December 5 , 4 6 Sarah Palin , 5 6 List of people by name, A-C , 6 6 Tenth Doctor , 7 6 December 9 , 8 6 Top Gear , 9 6 Benjamin Franklin , 10 5 30 Rock , 11 5 December 20 , 12 5 December 13 , 13 5 December 11 , 14 5 December 8 , 15 5 December 7 , 16 5 The Office (US) , 17 5 National Lampoon's Christmas Vacation , 18 5 House (TV series) , 19 5 Friends (TV series) , 20 5 Ayn Rand , 21 5 John F. Kennedy , 22 5 George W. Bush , 23 5 Last words , 24 4 Matthew Perry (actor) , 25 4 Twilight (2008 film)

jan 2009: 1 48 John Dewey , 2 8 Barack Obama , 3 8 List of films , 4 7 Jimmy Wales , 5 6 Muhammad , 6 6 English proverbs , 7 6 Last words , 8 6 John Lennon , 9 5 Jalal Talabani , 10 5 Psych (TV series) , 11 5 Macedonia (region) , 12 5 30 Rock , 13 5 Futurama , 14 5 Truth , 15 5 George W. Bush , 16 5 Hamlet , 17 4 Love , 18 4 Matthew Barney , 19 4 James Rosenquist , 20 4 Arthur Rubinstein , 21 4 The Simpsons Hit & Run , 22 4 The Outline of History , 23 4 The Nostalgia Critic , 24 4 List of people by name, I-M , 25 4 Kung Fu Panda

fev 2009: 1 21 John Dewey , 2 8 List of people by name , 3 7 Barack Obama , 4 7 List of television shows , 5 7 List of literary works , 6 6 Catherine of Aragon , 7 6 List of films , 8 5 Love , 9 5 List of people by name, A-C , 10 5 Thomas Jefferson , 11 5 30 Rock , 12 5 Harry Potter and the Prisoner of Azkaban , 13 5 Hannah Montana , 14 5 John Adams , 15 5 Margaret Thatcher , 16 5 Advertising slogans , 17 5 George W. Bush , 18 5 Albert Einstein , 19 4 The Formation of Vegetable Mould through the Action of Worms , 20 4 Floyd Dell , 21 4 The Sword in the Stone (film) , 22 4 For a Few Dollars More , 23 4 Total Drama Island , 24 4 The Nostalgia Critic , 25 4 List of people by name, I-M

mar 2009: 1 11 Rachel Maddow , 2 9 List of television shows , 3 8 List of literary works , 4 7 List of people by name, D-H , 5 7 30 Rock , 6 7 List of films , 7 7 Albert Einstein , 8 6 The Sword in the Stone (film) , 9 6 Wikipedia , 10 6 Yes, Minister , 11 6 The Hitchhiker's Guide to the Galaxy , 12 6 Gautama Buddha , 13 6 William Shakespeare , 14 5 Love , 15 5 Watchmen (film) , 16 5 Eastbound & Down , 17 5 Tristan Corbière , 18 5 Star Wars: The Clone Wars (film) , 19 5 Quantum of Solace , 20 5 Transformers Animated , 21 5 List of people by name, A-C , 22 5 Genius , 23 5 Harry Potter and the Prisoner of Azkaban , 24 5 March 17 , 25 5 March 14

abr 2009: 1 10 Patrick Henry , 2 8 Thomas Babington Macaulay, 1st Baron Macaulay , 3 8 Isaac Newton , 4 7 List of television shows , 5 6 Star Wars Episode IV: A New Hope , 6 6 Truth , 7 5 Love , 8 5 30 Rock , 9 5 Tenth Doctor , 10 5 April 11 , 11 5 April 10 , 12 5 Camille Paglia , 13 5 Vladimir Lenin , 14 5 List of films , 15 5 Benjamin Franklin , 16 5 Edsger W. Dijkstra , 17 5 Abraham Lincoln , 18 5 List of literary works , 19 5 Albert Einstein , 20 4 Louis Riel , 21 4 Dionysius Lardner , 22 4 Star Wars: The Clone Wars (film) , 23 4 Transformers Animated , 24 4 List of people by name, A-C , 25 4 Primeval (TV series)

mai 2009: 1 8 Benjamin Franklin , 2 7 30 Rock , 3 7 Last words , 4 6 Star Trek (2009 film) , 5 6 List of people by name, I-M , 6 6 List of people by name, D-H , 7 6 Peace , 8 6 List of television shows , 9 6 List of films , 10 6 George W. Bush , 11 5 Sonia Sotomayor , 12 5 Patrick Henry , 13 5 Robert A. Heinlein , 14 5 Quotations , 15 5 The Shawshank Redemption , 16 5 George Bernard Shaw , 17 5 Bertrand Russell , 18 4 Love , 19 4 Maid , 20 4 Imre Kertész , 21 4 True Blood (TV series) , 22 4 The Nostalgia Critic , 23 4 Team Fortress 2 , 24 4 List of people by name, S-Z , 25 4 List of people by name, A-C

jun 2009: 1 9 Michael Jackson , 2 5 Jaggi Vasudev , 3 5 Bryce Crawford , 4 5 Metal Gear , 5 5 Phineas and Ferb , 6 5 Top Gear , 7 5 Patrick Henry , 8 5 List of films , 9 5 Helen Keller , 10 5 Voltaire , 11 4 Sky , 12 4 Dragon Ball Z: Bardock - The Father of Goku , 13 4 List of people by name, A-C , 14 4 Zero Punctuation , 15 4 Cole Porter , 16 4 300 (film) , 17 4 The Simpsons/Season 1 , 18 4 June 22 , 19 4 Scientology , 20 4 Camille Paglia , 21 4 Whose Line Is It Anyway? , 22 4 NCIS (TV series) , 23 4 Sun , 24 4 Roger Ebert , 25 4 The Shawshank Redemption

jul 2009: 1 25 Charles Darwin , 2 21 Mohandas Karamchand Gandhi , 3 20 Martin Luther King, Jr. , 4 19 Thomas Samuel Kuhn , 5 19 William Shakespeare , 6 17 Albert Einstein , 7 15 John F. Kennedy , 8 15 Voltaire , 9 14 Muhammad , 10 14 Helen Keller , 11 14 Aristotle , 12 13 Leo Tolstoy , 13 13 Confucius , 14 11 Michael Jackson , 15 11 Patrick Henry , 16 10 Timothy Leary , 17 10 Richard Feynman , 18 10 Science , 19 9 William Saroyan , 20 9 T. S. Eliot , 21 9 Religion , 22 8 The Cabinet of Dr. Caligari , 23 8 Gautama Buddha , 24 8 Emily Brontë , 25 8 Thomas Paine

ago 2009: 1 11 Patrick Henry , 2 9 StarCraft , 3 8 Love , 4 8 List of films , 5 7 Ted Kennedy , 6 5 Transformers: Revenge of the Fallen , 7 5 NCIS (TV series) , 8 5 Quotations , 9 4 Wentworth Miller , 10 4 Bethany K. Scanlon , 11 4 Axl Rose , 12 4 Matt Sanchez , 13 4 Castle (TV series) , 14 4 True Blood (TV series) , 15 4 List of people by name, I-M , 16 4 Command & Conquer 3: Tiberium Wars , 17 4 Phineas and Ferb , 18 4 Psych (TV series) , 19 4 Boxing , 20 4 Michael Jackson , 21 4 Rudolf Hess , 22 4 Dead Poets Society , 23 4 The Matrix , 24 4 English proverbs , 25 3 Cyrus the Great

set 2009: 1 15 Paulo Freire , 2 9 Benjamin Franklin , 3 7 Transformers: Generation 1 , 4 6 List of films , 5 6 Mao Zedong , 6 6 Ralph Waldo Emerson , 7 5 Trust , 8 5 Manly Palmer Hall , 9 5 John Maynard Keynes , 10 5 Atlas Shrugged , 11 5 Martin Luther , 12 5 G. K. Chesterton , 13 4 Love , 14 4 Anthony Ashley Cooper, 1st Earl of Shaftesbury , 15 4 Angels & Demons (film) , 16 4 Bill McKibben , 17 4 Slobodan Milošević , 18 4 Leighton W. Smith, Jr. , 19 4 Telford Taylor , 20 4 Franco Frattini , 21 4 Ralph Barton Perry , 22 4 Michael Franti , 23 4 Transformers: Revenge of the Fallen , 24 4 Pan Tadeusz , 25 4 Snow White and the Seven Dwarfs (1937 film)

out 2009: 1 9 Rush Limbaugh , 2 7 Glee (TV series) , 3 7 Benjamin Franklin , 4 6 Patrick Henry , 5 5 Ivor Grattan-Guinness , 6 5 Anita Dunn , 7 5 List of people by name, N-R , 8 5 List of films , 9 4 Samuel Gompers , 10 4 Mary Harris Jones , 11 4 Henry J. Kaiser , 12 4 James Joseph Sylvester , 13 4 Polygamy , 14 4 Caroline Myss , 15 4 Mark Oliphant , 16 4 Barbara De Angelis , 17 4 Family Guy/Season 8 , 18 4 Miley Cyrus , 19 4 The Big Bang Theory , 20 4 Jo Grimond , 21 4 The Office (US) , 22 4 Who Framed Roger Rabbit , 23 4 John Maynard Keynes , 24 4 That '70s Show , 25 4 Arthur Koestler

Estatísticas geradas em Terça-feira, 24 de novembro 2009 a partir de cópias do banco de dados SQL de Sábado, 31 de outubro 2009
Versão do script:2.5
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
For documentation see meta
Scripts: scripts.zip

All data and images on this page are in the public domain.