Estatísticas da Wikiquote inglês

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist

Metrics have been collected from a full archive dump, which contains all revisions of every article, meta data and raw content.
See also metrics definitions


 
Monthly counts & Quarterly rankings: março 2013
 
DataWikiquotariansArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
mar 20130% +2% +1%   +12%+1%+1%+8%+1%+2%+1%+3%
fev 20130% -4% +1%   -11%+1%+1%+4%+1%+2%+1%+2%
jan 2013+1% +12% +1%   +56%+1%+1%+2%+8%+1%+1%+1%
dez 20120% -10% 0%   -17%+1%+1%+1%0%0%+1%0%
nov 20120% -13% +1%   -18%+1%+1%+1%0%0%+1%0%
out 2012+1% +5% +1%   +34%+1%+1%+1%+1%+1%+1%+1%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
mar 201334291791820 k459,1817710 k193 Mb30,2 M128 k44 k20 k54 k13 k
fev 201334121589820 k45981308,9 k190 Mb29,8 M119 k43 k20 k54 k13 k
jan 201333971793919 k558,8809710 k189 Mb29,5 M115 k43 k19 k53 k13 k
dez 201233801383819 k358,880676,4 k187 Mb29,2 M112 k40 k19 k53 k13 k
nov 201233671692919 k358,780377,7 k185 Mb29,0 M111 k40 k19 k52 k12 k
out 20123351231061119 k358,679899,3 k183 Mb28,7 M110 k40 k19 k52 k12 k
set 2012332825101719 k258,479487,0 k181 Mb28,4 M109 k39 k19 k51 k12 k
ago 20123303251011019 k358,379138,9 k180 Mb28,2 M109 k39 k19 k51 k12 k
jul 201232782793819 k358,178737,8 k178 Mb27,9 M108 k39 k19 k51 k12 k
jun 201232512389719 k357,978556,7 k177 Mb27,7 M107 k39 k20 k50 k12 k
mai 201232282499619 k357,878299,9 k176 Mb27,5 M107 k38 k20 k50 k12 k
abr 201232041895919 k357,677848,4 k174 Mb27,3 M106 k38 k20 k50 k12 k
mar 2012318622104818 k357,377748,8 k173 Mb27,1 M105 k38 k20 k50 k12 k
fev 201231642399818 k657,177149,8 k171 Mb26,8 M104 k37 k20 k49 k12 k
jan 2012314132115718 k457,1769612 k170 Mb26,5 M102 k37 k20 k49 k12 k
dez 201131092397818 k356,9760312 k166 Mb26,0 M99 k36 k19 k48 k12 k
nov 201130862591518 k256,675189,7 k164 Mb25,6 M95 k35 k19 k48 k12 k
out 201130612884818 k456,3748412 k162 Mb25,3 M93 k34 k18 k47 k12 k
set 201130333497818 k35674229,3 k160 Mb25,0 M91 k33 k18 k47 k11 k
ago 201129992187518 k255,774159,7 k159 Mb24,8 M90 k33 k18 k47 k11 k
jul 201129782898518 k255,373679,1 k157 Mb24,6 M89 k31 k18 k46 k11 k
jun 2011295025100518 k255729813 k155 Mb24,3 M87 k31 k17 k45 k11 k
mai 2011292525100818 k254,5720912 k153 Mb23,9 M82 k30 k17 k45 k11 k
abr 201129002489717 k1754,1711916 k150 Mb23,5 M79 k29 k16 k44 k11 k
mar 201128762798717 k354,7723510 k149 Mb23,2 M78 k32 k16 k45 k11 k
fev 201128492992717 k354,471898,6 k147 Mb22,9 M78 k31 k16 k44 k11 k
jan 2011282030100717 k454,2717412 k146 Mb22,7 M77 k31 k15 k44 k11 k
dez 201027903599817 k553,8713011 k144 Mb22,4 M77 k31 k15 k43 k11 k
nov 2010275531103616 k2153,6708113 k142 Mb22,1 M76 k30 k15 k43 k11 k
out 2010272431911116 k45572559,7 k139 Mb21,7 M75 k28 k14 k42 k11 k
set 20102693381141116 k554,8722511 k138 Mb21,5 M74 k28 k14 k41 k11 k
ago 201026552890816 k554,6720512 k136 Mb21,2 M74 k28 k14 k41 k11 k
jul 201026272994715 k554,4722011 k135 Mb21,0 M73 k27 k13 k41 k10 k
jun 201025982993615 k454,2721412 k133 Mb20,8 M73 k27 k13 k40 k10 k
mai 201025693291915 k353,8721211 k131 Mb20,6 M72 k26 k13 k40 k10 k
abr 2010253725104715 k453,5718312 k130 Mb20,4 M72 k26 k13 k39 k10 k
mar 20102512311101015 k453714212 k128 Mb20,1 M71 k26 k13 k39 k10 k
fev 2010248120901015 k652,7712610 k126 Mb19,9 M71 k25 k12 k39 k10 k
jan 2010246134101715 k652,6713811 k125 Mb19,7 M70 k25 k12 k38 k10,0 k
dez 20092427331111114 k352,5713911 k124 Mb19,5 M69 k25 k12 k38 k9,9 k
nov 20092394301121014 k552,1713511 k123 Mb19,3 M69 k24 k11 k38 k9,8 k
out 2009236441121914 k551,9713212 k121 Mb19,1 M68 k24 k11 k37 k9,8 k
set 20092323331141114 k551,6712112 k120 Mb18,9 M67 k23 k11 k36 k9,7 k
ago 20092290371061014 k351,371339,4 k119 Mb18,8 M67 k22 k10 k36 k9,7 k
jul 2009225349146914 k551714011 k118 Mb18,7 M66 k22 k10 k36 k9,6 k
jun 20092204301021014 k550,7717311 k118 Mb18,6 M65 k21 k9,7 k35 k9,5 k
mai 20092174391321013 k550,5721512 k117 Mb18,5 M64 k21 k9,6 k35 k9,5 k
abr 2009213543123913 k550,2722913 k116 Mb18,3 M64 k21 k9,3 k34 k9,4 k
mar 20092092391411113 k549,7722514 k114 Mb18,1 M62 k21 k8,8 k34 k9,3 k
fev 20092053351121013 k549,2722811 k113 Mb17,9 M60 k20 k8,6 k33 k9,3 k
jan 20092018441291013 k548,9727512 k112 Mb17,8 M60 k20 k8,5 k33 k9,2 k
dez 20081974361131113 k548,5730212 k111 Mb17,7 M59 k19 k8,3 k33 k9,1 k
nov 20081938501241313 k548,2733512 k110 Mb17,5 M59 k19 k8,3 k32 k9,0 k
out 2008188833119912 k447,7735612 k109 Mb17,4 M58 k19 k8,3 k32 k8,9 k
set 2008185525123712 k547,2755512 k111 Mb17,7 M57 k19 k8,3 k32 k8,8 k
ago 2008183029123612 k546,8764212 k111 Mb17,7 M56 k19 k8,3 k31 k8,7 k
jul 2008180143131612 k646,4763314 k109 Mb17,4 M56 k18 k8,2 k31 k8,5 k
jun 2008175853179812 k845,9754016 k106 Mb17,0 M54 k18 k7,6 k31 k8,3 k
mai 20081705451591312 k645,5751416 k104 Mb16,6 M53 k18 k7,4 k30 k8,2 k
abr 20081660361251011 k744,8746216 k102 Mb16,3 M51 k18 k7,2 k29 k8,1 k
mar 2008162439140911 k744,1745315 k100 Mb15,9 M49 k18 k7,0 k28 k7,9 k
fev 20081585381291011 k643,6744317 k98 Mb15,6 M48 k18 k6,8 k28 k7,7 k
jan 2008154738144811 k842,8742116 k96 Mb15,3 M47 k17 k6,4 k27 k5,3 k
dez 2007150938124911 k942,3742614 k93 Mb14,9 M45 k17 k5,9 k26 k4,6 k
nov 2007147139130810 k741,9742115 k91 Mb14,5 M44 k17 k5,6 k25 k4,5 k
out 2007143230132810 k641,4738915 k88 Mb14,2 M42 k17 k5,2 k25 k4,4 k
set 200714023813589,9 k740,7732014 k86 Mb13,8 M41 k16 k4,8 k24 k4,2 k
ago 2007136453145159,7 k740,1728514 k83 Mb13,4 M39 k13 k4,5 k24 k4,1 k
jul 2007131163166119,5 k1039,5723514 k81 Mb13,0 M38 k13 k4,1 k23 k4,0 k
jun 200712484815879,2 k839,3726814 k78 Mb12,6 M36 k12 k3,5 k22 k3,8 k
mai 2007120062192168,9 k838,9725720 k76 Mb12,2 M35 k12 k3,2 k21 k3,7 k
abr 2007113849145108,7 k837,6714818 k72 Mb11,7 M33 k11 k2,8 k20 k3,5 k
mar 2007108952152128,5 k1136,6706923 k70 Mb11,3 M31 k10 k2,6 k19 k3,1 k
fev 2007103756142118,1 k835,3706815 k67 Mb10,8 M28 k10,0 k2,4 k18 k2,9 k
jan 200798156156117,9 k934,3693116 k64 Mb10,4 M27 k9,8 k2,0 k17 k2,7 k
dez 20069255113297,6 k733,5681214 k60 Mb9,8 M26 k9,4 k1,7 k16 k2,6 k
nov 20068744313897,4 k832,5669915 k57 Mb9,4 M25 k9,3 k1,6 k15 k2,5 k
out 20068314114277,2 k631,6666213 k55 Mb9,1 M23 k9,1 k1,5 k15 k2,4 k
set 20067904111977,0 k630,5653812 k53 Mb8,7 M22 k8,8 k1,5 k14 k2,3 k
ago 20067495613576,8 k629,5643514 k51 Mb8,3 M22 k8,3 k1,3 k13 k2,2 k
jul 20066935514586,6 k728,2636813 k48 Mb8,0 M21 k8,0 k1,1 k13 k2,1 k
jun 200663851127116,4 k2027,2626814 k46 Mb7,6 M20 k7,7 k89712 k2,0 k
mai 20065874312465,8 k527,6640512 k42 Mb7,0 M17 k7,3 k69011 k1,9 k
abr 20065443810075,6 k326,2608911 k39 Mb6,5 M16 k7,1 k57410 k1,8 k
mar 2006506329155,5 k824,7582810 k37 Mb6,1 M15 k6,8 k4819,6 k1,6 k
fev 2006474328455,3 k623,9566210 k34 Mb5,6 M15 k6,5 k4148,8 k1,5 k
jan 20064424410775,1 k922,8547211 k32 Mb5,3 M14 k5,3 k4008,6 k1,5 k
dez 2005398328244,8 k621,752649,6 k29 Mb4,8 M14 k4,6 k3708,0 k1,4 k
nov 2005366246944,6 k720,651018,1 k27 Mb4,4 M13 k4,3 k3427,4 k1,3 k
out 2005342286364,4 k1019,849638,9 k25 Mb4,1 M12 k4,0 k2806,7 k1,2 k
set 2005314105264,1 k619,147586,2 k22 Mb3,7 M11 k3,8 k2066,1 k1,1 k
ago 2005304277973,9 k818,445348,9 k20 Mb3,3 M11 k3,3 k1735,7 k1,1 k
jul 2005277247063,7 k1617,342409,3 k17 Mb2,9 M9,6 k2,5 k1585,2 k946
jun 2005253236263,2 k81742236,9 k15 Mb2,5 M8,6 k1,6 k754,6 k858
mai 2005230206263,0 k61641095,4 k14 Mb2,3 M8,0 k1,4 k644,1 k785
abr 2005210195462,8 k915,138676,6 k12 Mb2,0 M7,5 k1,2 k503,6 k713
mar 2005191163952,5 k81437994,6 k11 Mb1,8 M6,7 k1,5 k423,3 k594
fev 2005175153632,3 k413,538122,9 k9,9 Mb1,6 M6,3 k1,5 k182,8 k506
jan 20051601234 2,1 k31337372,7 k9,2 Mb1,5 M6,0 k1,4 k132,4 k478
dez 2004148184832,0 k512,336883,7 k8,5 Mb1,4 M5,7 k1,4 k102,2 k446
nov 2004130174711,9 k511,433783,1 k7,3 Mb1,2 M5,0 k1,5 k71,9 k368
out 200411393541,7 k810,531893,0 k6,5 Mb1,1 M4,7 k1,4 k51,5 k314
set 2004104143711,5 k510,331672,2 k5,7 Mb928 k4,0 k1,4 k51,3 k271
ago 200490102311,3 k49,830841,4 k5,1 Mb823 k3,5 k1,5 k51,1 k186
jul 20048092831,2 k59,631561,7 k4,7 Mb768 k3,3 k1,6 k11,1 k168
jun 20047172111,1 k49,531991,3 k4,1 Mb679 k3,0 k1,8 k2936151
mai 200464918292439,329871,3 k3,5 Mb566 k2,6 k1,7 k1733126
abr 200455618182238,927649132,9 Mb474 k2,3 k1,4 k 58592
mar 200449410174138,627028212,6 Mb422 k2,0 k1,3 k 54373
fev 200445 10163528,727287102,2 Mb373 k1,9 k1,1 k 45664
jan 20044539157038,526217441,9 Mb321 k1,6 k1,0 k 29852
dez 20034237 48718,427763731,7 Mb294 k1,2 k949 27545
nov 20033951114672827709461,7 Mb282 k1,1 k914 23043
out 200334215 40116,922804751,2 Mb208 k920760 11934
set 2003321322135836,423657361016 kb166 k763659 10032
ago 200319717227945,62258887772 kb128 k710372 3828
jul 2003121117114854,61507674270 kb41 k21598 1711
jun 20031   1 12247 2,4 kb414     
mai 20031   1 12247 2,4 kb414     
abr 20031   1 12247 2,4 kb414     
mar 20031   1 12247 2,4 kb414     
fev 20031   1 12247 2,4 kb414     
jan 200311  1 1224712,4 kb414     
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
The following table ranks this project in relation to projects in other languages with 1000+ articles
jan 201311112311111411149
out 201211112511111411149
jul 201211111411111311149
abr 201211111311111311149
jan 201211121411111311149
out 201111111311111311149
jul 201111121511111311149
abr 201111111311111311149
jan 201111111211111311148
out 201011111311111311148
jul 201011111411111311148
abr 201011111411111311148
jan 201011111211111311148
out 200911111111111311148
jul 200911111111111311148
abr 200911111111111311148
jan 200911111211111311148
out 200811111211111311148
jul 200811121211111311148
abr 200811111111111311148
jan 200811111111111311148
out 200711111111111211148
jul 200711111111111211148
abr 200711111111111311148
jan 200711111111111311148
out 200611111211111311148
jul 200611111411111311148
abr 200611111811111212148
jan 200611111511111212148
out 200511111321111212148
jul 200511111121111212148
abr 200511111121111212148
jan 200511151411211213146
out 200411111111111111139
jul 200411111111111114117
abr 20041111111111111213
jan 20041111111111111213
out 20031111111111111113
jul 20031111111111111113
abr 20031111111121122113
jan 20031111111111122112
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100ediçõesbytes
 WikiquotariansArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikiquotarians (usuários registrados)
A = Wikiquotarians que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikiquotarians que editaram pelo menos dez vezes desde que chegaram
C = Wikiquotarians que contribuíram cinco vezes ou mais este mês
D = Wikiquotarians que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  2500  5  10  100  1000  1  3  5  10  25  100  250  1000  5  10  100  1000  1  3  5  10  25  100  250  1000  5  10  100  1000 
mar 2013377142914922851 33  622215853      10432201293  21  
fev 2013366139894925851 33  7826191352      8530191272  11  
jan 201337314093542194  552174211395       9235221362  321 
dez 201234213883422282  22  6718863       7732191051  1   
nov 201236014292572493  21  7524151071      852816141011 1   
out 201237314810662311141 32  831712862      94231311811 11  
set 2012350144101632772  321 92311874       85261912711 22  
ago 20123521571015626102  331 8227171361      95352310521 21  
jul 201237913993542583  22  711712115       822419107   1   
jun 201234913189462471  22  822615962      952818106   1   
mai 2012378146995626621 21  732213861  1   93302111711     
abr 201234713895542793  331 6526141151      8830231361  21  
mar 2012402149104572784  44  8828151063      10936211172  11  
fev 201237715499602884  331 96292015731     111312614832 311 
jan 20123991651157034751 44  9330201262      93362210731 11  
dez 2011380139976429851144  792012863      97251510721     
nov 2011378156914622521 44  7921138621     105292011521     
out 2011367145845726831 3311862311642      9428165531 211 
set 201138114297602483  332 871912641      1142312942  321 
ago 2011364129874822541 331 7015863       91229641  11  
jul 2011367158985825521 331 8730161031      9325201131  2   
jun 201139214310051205321331 791713842      9626159521 11  
mai 20113941491005524832132  8221127421     9318116422 11  
abr 20113831528953257521331 9032178421     105332113642 21  
mar 2011404141985024731 552 872617732      972917641  21  
fev 201137814292512273  551 6520151032      752516951      
jan 20114021571005420752 431 902315932  1   9727157411 31  
jan 201337314093542194  552174211395       9235221362  321 
out 201237314810662311141 32  831712862      94231311811 11  
jul 201237913993542583  22  711712115       822419107   1   
abr 201234713895542793  331 6526141151      8830231361  21  
jan 20123991651157034751 44  9330201262      93362210731 11  
out 2011367145845726831 3311862311642      9428165531 211 
jul 2011367158985825521 331 8730161031      9325201131  2   
abr 20113831528953257521331 9032178421     105332113642 21  
jan 20114021571005420752 431 902315932  1   9727157411 31  
out 2010412141915730112  43  812613952      103342214821111  
jul 201039815194502072  22  8728171161      9829191351      
abr 20104481631045222741 332 8131181242      8024167421 1   
jan 2010443164101603272  541 9735201152      1143121126   21  
out 20094611701217237921 44111044127161121     13548251331      
jul 2009525224146804193  33  12035181052      16753371852  1   
abr 20094791861237230951 431 10235181064      153513218102  211 
jan 20095572081296126105  44  8625151184      124433116102      
out 2008485176119623194  54  11640271871  111 170523422145  221 
jul 20085062111317027631 32  12541219511 111 192472817821 221 
abr 200849421612578331061 43  11339231692  11111325035241221 211 
jan 2008536242144822782  321 1124120151031 111 152483020822 111 
out 2007524224132702982  332 10830211272  111 14346251894  11  
jul 20075372451669142115  321 12142271962  1111168584227184  111 
abr 20075732171457835106  111 135412718962     142443221133  1111
jan 20075562381568242116  11  127362013642     17257331995  1   
out 2006514216142531973      113271310622     17140261686      
jul 2006502212145763583  11  116251611632     162492313841     
abr 2006413149100572472  11  10224147521     13642291363      
jan 2006346153107542571  111 9134201041      110331913641 11  
out 200526710763321761  111 66181310311     813217863      
jul 2005288110704321621 111 81281711742     116402511742     
abr 20052107454281063      5617118722     88322111831     
jan 20051695734167       249421       5013742       
out 2004114563516842      2912633       40106331      
jul 20047935281563       1910831       3765311      
abr 20045927181251       14431        186211       
jan 200431159421       843         16741        
out 200330201593       1542         1752         
jul 20033323171161       1811621       2210721       
abr 2003                                   
jan 20031                                  

 

Distribuição de edições de artigos por wikiquotarians
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikiquotariansEdições total
122,446100.0%508,690100.0%
37,46333.2%486,13695.6%
103,47215.5%463,54791.1%
321,2455.5%426,31583.8%
1004432.0%382,45575.2%
3161480.7%331,77465.2%
1000450.2%277,24954.5%
3162150.1%224,12144.1%
1000050.0%169,31133.3%
3162320.0%112,33422.1%

 

50 wikiquotarians recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions
agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
BD2412UC1 057,5624611,174239set 01, 200527671,3272--
KalkiUC2 054,7721,60328,671403ago 11, 2003351970513--
UDScottUC3 024,69528410,723111jul 20, 2005281078511--
NingaubleUC4 018,72021711,847142jul 27, 20081707521--
SpannerjamUC9 06,3813572,495129dez 02, 201148483---
RogDelUC12 04,2711017-mar 18, 20091473----
WikiLubberUC14 03,4711212483abr 28, 20091432----
MddUC15+73,2621,005510216set 07, 2007203110328--
EaglestormUC18-13,020343722dez 16, 200622969---
CirtUC19-12,858205,13924nov 21, 20081590741--
NickrjUC26+11,841797-jun 17, 20072113191--
DanielTomUC28+211,822941483223set 07, 2012204229--
JzummakUC32-11,51735-ago 01, 200720683---
EVulaUC33-11,51351,61216mar 21, 200625663---
Robin LionheartUC35 01,424271502set 02, 2010940161--
Demoman87UC45-11,010419-ago 15, 20072054----
MariomassoneUC47 0933154-set 27, 20091280271--
Peter1cUC51+386453242ago 28, 20091310883--
USN1977UC53 0851322-abr 27, 200721646---
ViperSnake151UC58 0747131-jul 16, 200817181---
DReifGalaxyM31UC65+1677142-out 12, 2010900----
OmnipaedistaUC66-167046-jul 13, 200913562---
MhymUC69+26371246-nov 23, 2006231939---
HypnosiflUC70-16351384-ago 31, 20081672----
YKWSGUC76+5604292-fev 20, 200914993---
Ichthys58UC78+2587822-ago 12, 20062422166---
PeterklevyUC83+65653313-jun 20, 20062475161--
CrouchbkUC92 05273--jan 08, 200915423---
11614soupUC95+1494211-jul 31, 20109735---
StarWarsFanBoyUC97 04904775-out 02, 200912751---
Markjoseph125UC99+447214432mar 30, 2007219241---
ChicoUC102-146516-nov 29, 200430431---
Philip J.1987qazwsxUC103-1463427-mai 25, 2011675----
AdamDeanHallUC104+6459231-set 16, 2008165621---
P3Y229UC105 045822-abr 25, 20123391---
KpalionUC122 0389334-out 25, 2008161710---
Wiki WisdomUC123+9384212-jul 07, 20081727283--
MacspaundayUC125+4379121174dez 27, 20062285----
Antster1983UC137+135114-ago 01, 20081702----
Nan17franciscoUC147 03315--jun 23, 2012280----
Buildings and FoodUC148 032016-abr 04, 200625523---
Illegitimate BarristerUC161+2429538211jun 25, 20122782---
The C of EUC162-1292192-set 18, 200816545---
RadicaladzUC164-1288112-abr 16, 200625404---
Beebee89UC172+72771341mai 12, 20072149----
דולבUC184 0260255-dez 30, 20071917----
CmmmmUC194+4247613-mar 26, 20101100----
SnapSnapUC203+223464-dez 06, 20114805---
Lew2000UC222+1120264-jun 04, 20101030----
Finister2UC235+11195722012jun 27, 20122762---

 

20 wikiquotarians recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
InvisibleSunUC513,562set 21, 20052747abr 11, 20101084
ZarbonUC68,166fev 27, 20072223dez 16, 2012104
JeffqUC77,878abr 19, 20043267jan 28, 201361
MosheZadkaUC86,441abr 11, 20052910jun 11, 20101023
LrdChaosUC105,789fev 22, 20062593jun 01, 20091398
OracleofottawaUC115,077set 13, 20091294jan 20, 201369
AntiquaryUC134,074set 17, 20062386set 24, 20091283
CollingwoodUC163,072nov 02, 2011514fev 01, 201357
SketchmooseUC173,051out 16, 20081626out 26, 2012155
AphaiaUC202,556nov 21, 20043051abr 30, 2012334
InesculentUC212,455mar 05, 20072217abr 26, 20081799
RPickmanUC222,330jan 01, 20053010nov 08, 20081603
Ole.HolmUC232,197out 22, 20091255mar 21, 20101105
121a0012UC242,174mai 12, 20052879jun 27, 2012276
GandalfUC251,897out 03, 20033466jan 02, 20081914
QuillercouchUC271,827fev 11, 20072239set 07, 20081665
CatoUC291,588fev 13, 20072237set 04, 20081668
Wise RavenUC301,522out 21, 20081621fev 05, 201353
Raisin56UC311,520mar 06, 20101120nov 25, 2012125
McNoddyUC341,454jan 18, 20072263set 23, 20081649

 

usuários anônimos, ordenados por número de contribuições
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
98.30.67.1633076
24.210.185.2142039
76.27.235.391507
81.101.138.1081443
72.184.129.2521427
72.229.48.1781403
81.107.32.1421349
81.107.39.41301
72.140.100.1371262
82.13.10.251184

No total 619.148 edições foram feitas por usuários anônimos, de um total de 1159.964 edições ( 53e %)
  


39 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
AnankeBotUC18,546abr 05, 20081820jan 30, 201359--
BrownBotUC24,923mar 23, 20072199mar 24, 20072198--
ChtitBotUC33,837fev 24, 20072226fev 06, 2011783--
VolkovBotUC42,859jul 10, 20072090mar 15, 201315--
CommonsDelinkerUC52,148fev 12, 20072238mar 31, 2013---
LeonardoRob0tUC62,104jul 25, 20052805ago 28, 20072041--
RimBotUC72,025ago 26, 20072043fev 24, 20101130--
LaaknorBotUC81,303jul 18, 20081716mar 04, 201326--
BaseBotUC91,273jan 09, 201380jan 10, 201379--
DinybotUC10651mar 24, 20072198dez 17, 20071930--
Idioma-botUC11400ago 06, 20072063jan 19, 2012436--
AvicBotUC12346ago 11, 2011597set 07, 2011570--
Lucia BotUC13236ago 03, 20081700dez 04, 20081577--
MjbmrbotUC14232fev 08, 2011781mar 28, 2011733--
MalafayaBotUC15173mai 15, 20081780dez 06, 2011480--
EleferenBotUC16170fev 12, 20101142mar 14, 20101112--
ChenzwBotUC17110ago 17, 20081686mar 03, 20091488--
KamikazeBotUC1875dez 17, 2010834dez 17, 2010834--
Ripchip BotUC1958nov 22, 20091224nov 25, 20091221--
MerlLinkBotUC2036out 16, 20091261dez 03, 20091213--
JagbotUC2124abr 23, 20062533jun 10, 20081754--
CarsracBotUC2217jan 17, 2012438jan 19, 2012436--
Kandy TalbotUC2316jan 15, 20072266mar 21, 20117401-
AlbamhandaebotUC2411jun 19, 20081745fev 27, 20091492--
KgsbotUC2510dez 13, 2010838out 03, 2011544--
TanhabotUC268abr 27, 20081798abr 27, 20081798--
FiriBotUC277jan 09, 2011811jan 09, 2011811--
WillyOnWheelsBotUC286jan 10, 20081906jan 10, 20081906--
Unstoppable RobotUC296jun 26, 20091373jun 26, 20091373--
GameOnBotUC306mai 30, 2011670mai 30, 2011670--
DrewisarobotUC313fev 21, 20062594fev 21, 200625941-
AibotUC323mar 18, 20101108mar 18, 20101108--
WillybotUC332ago 25, 20052774ago 25, 20052774--
BladebotUC341mar 20, 20062567mar 20, 20062567--
Autobot SandwichUC351ago 08, 20062426ago 08, 20062426--
Wikiquote vandalbotUC361jan 17, 20072264jan 17, 20072264--
DoubleBOTUC371nov 19, 20071958nov 19, 20071958--
RezabotUC381out 18, 2011529out 18, 2011529--
RossbotUC391fev 03, 2012421fev 03, 2012421--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110Png
mar 201334 k8,0 k5,9 k11001,0 k1041,8 k      64011
fev 201334 k7,8 k5,8 k1991,0 k1041,8 k      54841
jan 201334 k7,8 k5,8 k1991,0 k1041,8 k      45371
dez 201233 k7,8 k5,8 k1999981041,7 k      33631
nov 201233 k7,7 k5,7 k1999981041,7 k      43761
out 201233 k7,7 k5,7 k1999981041,7 k      53961
set 201233 k7,7 k5,6 k1999971041,7 k      36781
ago 201233 k7,6 k5,6 k1999931041,7 k      42361
jul 201233 k7,6 k5,6 k1999931041,6 k      39581
jun 201233 k7,6 k5,5 k1999911041,6 k      32521
mai 201232 k7,5 k5,5 k1999701041,6 k      56281
abr 201232 k7,4 k5,4 k1999681041,6 k      37991
mar 201232 k7,4 k5,4 k1999661041,6 k      44211
fev 201232 k7,3 k5,3 k1999611031,6 k      52821
jan 201232 k7,3 k5,3 k1989581031,6 k      64991
dez 201132 k7,2 k5,2 k1989551031,5 k      79211
nov 201131 k7,1 k5,2 k1989441031,5 k      50371
out 201131 k7,1 k5,1 k1989391031,5 k      58901
set 201131 k7,0 k5,1 k1989381031,5 k      43221
ago 201131 k7,0 k5,1 k1989381031,5 k      49981
jul 201131 k6,9 k5,0 k1989371031,5 k      47041
jun 201131 k6,9 k5,0 k1989321031,5 k      83961
mai 201130 k6,8 k4,9 k1989241031,4 k      72681
abr 201130 k6,8 k4,9 k1989211031,4 k      107061
mar 201130 k6,7 k4,8 k1989201031,4 k      45541
fev 201129 k6,7 k4,8 k1989171031,4 k      37431
jan 201129 k6,6 k4,8 k1989171031,4 k      66371
dez 201029 k6,6 k4,7 k1989141031,4 k      55581
nov 201029 k6,5 k4,7 k1989141031,4 k      57911
out 201029 k6,5 k4,6 k1988981031,4 k      42121
set 201028 k6,3 k4,2 k1968891031,4 k      50571
ago 201028 k6,3 k4,1 k1968851031,3 k      44541
jul 201028 k6,2 k4,1 k1968791031,3 k      40241
jun 201028 k6,2 k4,1 k1968781031,3 k      55651
mai 201028 k6,1 k4,0 k1948751031,3 k      45351
abr 201027 k6,0 k4,0 k1948731031,3 k      53701
mar 201027 k6,0 k3,9 k1948731031,3 k      50601
fev 201027 k5,9 k3,9 k1948661031,3 k      40691
jan 201027 k5,8 k3,8 k1948511031,3 k      42361
dez 200927 k5,8 k3,8 k1948491031,3 k      48361
nov 200926 k5,7 k3,8 k1948371031,3 k      50421
out 200926 k5,6 k3,7 k1948311031,2 k      52191
set 200926 k5,6 k3,7 k1938231031,2 k      59101
ago 200926 k5,5 k3,6 k1938171031,2 k      37391
jul 200926 k5,4 k3,6 k1938091031,2 k      53761
jun 200925 k5,3 k3,5 k1898081031,2 k      52281
mai 200925 k5,2 k3,5 k1898081031,2 k      54061
abr 200925 k5,1 k3,4 k1878061031,2 k      62611
mar 200925 k5,0 k3,4 k1877931031,2 k      73911
fev 200925 k4,9 k3,3 k1867461031,1 k      46931
jan 200924 k4,8 k3,3 k1867421031,1 k      50711
dez 200824 k4,8 k3,2 k1827251031,1 k      52701
nov 200824 k4,7 k3,1 k1687151031,1 k      55691
out 200824 k4,6 k3,0 k1577061021,1 k      49111
set 200823 k4,5 k2,9 k1566971021,1 k      40911
ago 200823 k4,4 k2,8 k1556901021,1 k      40701
jul 200823 k4,3 k2,7 k1546841021,0 k      54921
jun 200823 k4,2 k2,7 k1546751021,0 k      64241
mai 200822 k4,1 k2,6 k1546701021,0 k      58441
abr 200822 k3,9 k2,6 k1546641021,0 k      69091
mar 200821 k3,8 k2,5 k154656102989      52261
fev 200821 k3,7 k2,5 k153647102980      75081
jan 200819 k3,7 k2,4 k152639102972      61501
dez 200718 k3,6 k2,4 k152628102955      48241
nov 200717 k3,5 k2,3 k150580102936      56311
out 200717 k3,4 k2,2 k150562102918      52441
set 200716 k3,3 k2,2 k150554102909      42851
ago 200716 k3,2 k2,1 k149551102897      59121
jul 200716 k3,1 k2,0 k149541102857      64571
jun 200715 k3,0 k1,9 k144516102826      54901
mai 200715 k2,8 k1,8 k144505102792      102211
abr 200713 k2,7 k1,7 k143489102765      66881
mar 200712 k2,6 k1,6 k138475102744      68341
fev 200711 k2,5 k1,6 k137457102683      64031
jan 200711 k2,4 k1,4 k133426102638      66351
dez 200610 k2,3 k1,4 k133413102617      48441
nov 200610 k2,2 k1,3 k133402102578      54051
out 20069,8 k2,1 k1,2 k133388102560      42531
set 20069,6 k1,9 k1,1 k133376102547      42171
ago 20069,2 k1,8 k964133345102534      48301
jul 20069,0 k1,7 k893133324102501      47941
jun 20068,6 k1,6 k821133319102495      60151
mai 20067,9 k1,5 k780133305102416      40761
abr 20067,6 k1,3 k729132297102408      38761
mar 20067,3 k1,2 k692131255102394      34491
fev 20066,9 k1,1 k617130224102381      27931
jan 20066,7 k1,1 k583128210102372      34981
dez 20056,3 k997507128179102356      32741
nov 20056,0 k923484128172102345      31011
out 20055,7 k8672241271569330      32421
set 20055,3 k8211371271399324      22551
ago 20055,0 k7611291271349318      42981
jul 20054,7 k6981091271217302      41591
jun 20054,3 k6141021271117230      29831
mai 20054,0 k569971241057176      24691
abr 20053,7 k51990124967169      32271
mar 20053,4 k46373124696128      23621
fev 20053,1 k4237012466699      11421
jan 20052,9 k3846912465699      8961
dez 20042,8 k3586612435697      19171
nov 20042,5 k3165712119458      13321
out 20042,3 k2665512118450      16201
set 20042,0 k2405312117428      10691
ago 20041,8 k20351 219126      663 
jul 20041,6 k17451 217121      962 
jun 20041,4 k14748 216116      775 
mai 20041,2 k12946 216115      873 
abr 20041,1 k10743 331         
mar 20049719942 331         
fev 20048468742 331         
jan 20047517640 331         
dez 20036517038 331         
nov 20036086236   1         
out 20035285736   1         
set 20034555135   1         
ago 20033344034   1         
jul 20031671812             
jun 20031               
mai 20031               
abr 20031               
mar 20031               
fev 20031               
jan 20031               

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
Sometimes an article has been renamed repeatedly. For this reason the English Wikipedia article 'October 2003' features as article with most editors for many months.

x y z    ⇐    x = rank, y = contributors in that month, z = article title

jan 2003: 1 1 Russell Crowe

jul 2003: 1 22 Main Page , 2 13 List of people by name , 3 7 Winston Churchill , 4 6 Anonymous , 5 5 Albert Einstein , 6 4 Last words , 7 4 List of literary works , 8 4 Animal Farm , 9 4 Ambrose Bierce , 10 3 Science , 11 3 William Shakespeare , 12 3 Animals , 13 3 Arianna Huffington , 14 3 List of misquotations , 15 3 Les Misérables , 16 3 George Carlin , 17 3 John N. Mitchell , 18 3 Stanisław Lem , 19 3 Omar Bradley , 20 3 Will Rogers , 21 3 The Devil's Dictionary , 22 3 Bill Gates , 23 3 Dwight D. Eisenhower , 24 3 Aristotle , 25 3 Douglas Adams

ago 2003: 1 16 Main Page , 2 10 List of people by name , 3 7 Last words , 4 6 William Shakespeare , 5 5 George W. Bush , 6 5 Mark Twain , 7 5 Anonymous , 8 5 Albert Einstein , 9 4 List of misquotations , 10 4 Les Misérables , 11 4 List of proverbs , 12 4 Julius Caesar , 13 4 Zen proverbs , 14 3 Abraham Lincoln , 15 3 Art , 16 3 Dr. Seuss , 17 3 George Orwell , 18 3 Victor Hugo , 19 3 Alfred, Lord Tennyson , 20 3 Terry Pratchett , 21 3 Linus Torvalds , 22 3 W. H. Auden , 23 3 Pablo Picasso , 24 3 Benjamin Franklin , 25 3 Nineteen-Eighty Four

set 2003: 1 13 List of people by name , 2 10 Main Page , 3 5 Larry Wall , 4 4 Life , 5 4 Linus Torvalds , 6 4 Computers , 7 4 Last words , 8 4 List of misquotations , 9 4 Anonymous , 10 3 Religion , 11 3 Death , 12 3 Art , 13 3 Steven Wright , 14 3 Soichiro Honda , 15 3 Miguel de Unamuno , 16 3 Miguel de Cervantes , 17 3 Henry Wadsworth Longfellow , 18 3 John F. Kennedy , 19 3 Horace , 20 3 Dorothy Parker , 21 3 Douglas Hofstadter , 22 3 Pablo Picasso , 23 3 Mark Twain , 24 3 List of proverbs , 25 3 List of literary works

out 2003: 1 10 List of people by name , 2 6 Main Page , 3 4 List of films , 4 3 Religion , 5 3 Thomas Alva Edison , 6 2 Silence , 7 2 Love , 8 2 Inferno (Dante) , 9 2 The Matrix Reloaded , 10 2 André Breton , 11 2 Groucho Marx , 12 2 Life of Brian , 13 2 Bob Dylan , 14 2 The Return of the King , 15 1 Erma Bombeck

nov 2003: 1 10 List of people by name , 2 5 Main Page , 3 3 Stranger in a Strange Land , 4 3 The Silmarillion , 5 3 The Matrix , 6 3 List of films , 7 3 Nineteen Eighty-Four , 8 3 List of literary works , 9 2 Epitaphs , 10 2 Frank Herbert , 11 2 Dune , 12 2 Harvey , 13 2 O. Henry , 14 2 Spider Robinson , 15 2 They Might Be Giants , 16 1 Love

dez 2003: 1 5 Main Page , 2 3 List of films , 3 2 Thomas Jefferson , 4 2 Fight Club (film) , 5 2 Ludwig Wittgenstein , 6 2 John F. Kennedy , 7 1 William Shakespeare

jan 2004: 1 7 List of people by name , 2 6 Main Page , 3 5 List of literary works , 4 3 List of films , 5 2 Religion , 6 2 Friendship , 7 2 Thomas Jefferson , 8 2 Madonna , 9 2 William Thomson , 10 2 Responsibility , 11 2 Mohandas Karamchand Gandhi , 12 2 Ronald Reagan , 13 2 Linus Torvalds , 14 2 Arthur C. Clarke , 15 2 Computers

fev 2004: 1 9 List of people by name , 2 3 The Matrix , 3 3 Computers , 4 3 Main Page , 5 2 Stupidity , 6 2 Love , 7 2 Abraham Lincoln , 8 2 Muhammad Saeed al-Sahhaf , 9 2 Alexander Mackenzie , 10 2 George Santayana , 11 2 Bill Watterson , 12 1 Religion

mar 2004: 1 13 List of people by name , 2 4 Main Page , 3 3 Casablanca (film) , 4 2 God , 5 2 Willa Cather , 6 2 Caroline Dhavernas , 7 2 Wonderfalls , 8 2 Generation X: Tales For An Accelerated Culture , 9 2 Rainer Maria Rilke , 10 2 Ayn Rand , 11 2 Georg Wilhelm Friedrich Hegel , 12 2 Aldous Huxley , 13 2 The Lord of the Rings (movies) , 14 2 List of films , 15 2 Mohandas Karamchand Gandhi , 16 2 Thomas Paine , 17 2 George W. Bush , 18 1 Religion

abr 2004: 1 15 List of people by name , 2 9 Main Page , 3 5 Last words , 4 4 The Simpsons , 5 4 List of films , 6 4 Friedrich Nietzsche , 7 3 Religion , 8 3 Wonderfalls , 9 3 Babylon 5 , 10 3 List of television shows , 11 3 Adolf Hitler , 12 2 Education , 13 2 Franz Schubert , 14 2 Indian proverbs , 15 2 Bette Davis , 16 2 Theodore Dreiser , 17 2 Richard Brautigan , 18 2 Anne Frank , 19 2 Swedish proverbs , 20 2 William James , 21 2 Futurama

mai 2004: 1 12 List of people by name , 2 5 The Simpsons , 3 4 List of films , 4 4 Adolf Hitler , 5 4 Anonymous , 6 3 Politics , 7 3 Monty Python and the Holy Grail , 8 3 Walt Kelly , 9 3 Family Guy , 10 3 Paul Simon , 11 3 Ali , 12 3 Chanakya , 13 3 Indian proverbs , 14 3 Ayn Rand , 15 3 List of television shows , 16 3 Terry Pratchett , 17 3 Linus Torvalds , 18 3 Salvador Dalí , 19 3 Main Page , 20 2 War , 21 2 Love , 22 2 Piet Hein , 23 2 Blackadder , 24 2 John Forbes Nash , 25 2 Firefly (TV series)

jun 2004: 1 14 List of people by name , 2 5 List of literary works , 3 5 Main Page , 4 4 War , 5 4 Michael Moore , 6 4 Ronald Reagan , 7 3 Cult , 8 3 List of television shows , 9 3 Mark Twain , 10 3 Dwight D. Eisenhower , 11 2 Religion , 12 2 Love , 13 2 Epitaphs , 14 2 David Deutsch , 15 2 Charles Spurgeon , 16 2 Les Tontons flingueurs , 17 2 James Joyce , 18 2 Ray Charles , 19 2 Tuck Everlasting (2002 film) , 20 2 Firefly (TV series) , 21 2 The Simpsons , 22 2 Fight Club (film) , 23 2 Carl Sagan , 24 2 List of films , 25 2 Neil Armstrong

jul 2004: 1 9 List of people by name , 2 9 Main Page , 3 6 Religion , 4 5 Robert A. Heinlein , 5 4 Carl Sagan , 6 4 Bertrand Russell , 7 3 Music , 8 3 Michael Moore , 9 3 Steve Jobs , 10 3 Kurt Vonnegut , 11 3 Monty Python's Flying Circus , 12 3 William S. Burroughs , 13 3 Richard Feynman , 14 3 Carl Jung , 15 3 John F. Kennedy , 16 3 Linus Torvalds , 17 3 Emo Philips , 18 3 Bill Gates , 19 2 War , 20 2 Death , 21 2 Pope Sixtus V , 22 2 Thomas Jefferson , 23 2 Chauncey Depew , 24 2 Norman Ralph Augustine , 25 2 Kurt Donald Cobain

ago 2004: 1 13 List of people by name , 2 6 List of literary works , 3 5 Main Page , 4 4 Plato , 5 4 Futurama , 6 4 The Simpsons , 7 4 Franklin D. Roosevelt , 8 4 Anonymous , 9 4 Oscar Wilde , 10 3 South Park , 11 3 Buffy the Vampire Slayer , 12 3 Metallica , 13 3 Groucho Marx , 14 3 Friedrich Nietzsche , 15 3 Adolf Hitler , 16 3 Voltaire , 17 2 Acting , 18 2 The Bible , 19 2 Aneurin Bevan , 20 2 Marshall McLuhan , 21 2 Julia Child , 22 2 Washington Irving , 23 2 Shimon Peres , 24 2 Tony Benn , 25 2 Tenzin Gyatso, 14th Dalai Lama

set 2004: 1 20 List of people by name , 2 11 Main Page , 3 9 George W. Bush , 4 6 List of television shows , 5 5 The Simpsons , 6 5 List of films , 7 5 Anonymous , 8 4 Religion , 9 4 Star Wars , 10 4 Mark Twain , 11 4 Douglas Adams , 12 3 War , 13 3 Thomas Jefferson , 14 3 Louis Mountbatten, 1st Earl Mountbatten of Burma , 15 3 George Marshall , 16 3 Magnolia (film) , 17 3 SpongeBob SquarePants , 18 3 Prem Rawat , 19 3 Ferris Bueller's Day Off , 20 3 H. G. Wells , 21 3 Will Rogers , 22 3 List of literary works , 23 2 Music , 24 2 Politics , 25 2 Marriage

out 2004: 1 12 Main Page , 2 11 List of people by name , 3 8 List of films , 4 8 List of literary works , 5 6 Blackadder , 6 5 Prem Rawat , 7 5 Computers , 8 5 Douglas Adams , 9 4 Love , 10 4 Beauty , 11 4 List of television shows , 12 4 Futurama , 13 4 The Simpsons , 14 4 Oscar Wilde , 15 3 William Shakespeare , 16 3 Techniques of Knowledge , 17 3 Atlas Shrugged , 18 3 Duke Nukem , 19 3 Marie Curie , 20 3 Alexander (film) , 21 3 Kinsey (film) , 22 3 Firefly (TV series) , 23 3 Dick Cheney , 24 3 Sherlock Holmes , 25 3 Abortion

nov 2004: 1 11 List of people by name , 2 10 List of films , 3 8 George W. Bush , 4 8 Main Page , 5 6 The Simpsons , 6 6 Albert Einstein , 7 5 Politics , 8 4 Indiana Jones , 9 4 Van Helsing , 10 4 List of proverbs , 11 3 War , 12 3 Love , 13 3 Epitaphs , 14 3 The Twilight Zone (1959 TV series) , 15 3 The Incredibles , 16 3 Michael Badnarik , 17 3 Apocalypse Now , 18 3 American History X , 19 3 Gracie Allen , 20 3 Prem Rawat , 21 3 George Burns , 22 3 Erwin Rommel , 23 3 Babylon 5 , 24 3 Arthur Conan Doyle , 25 3 Doctor Who

dez 2004: 1 17 List of people by name , 2 9 List of films , 3 8 Futurama , 4 7 List of television shows , 5 7 Main Page , 6 5 The Simpsons , 7 5 George W. Bush , 8 5 Last words , 9 5 Adolf Hitler , 10 5 Latin proverbs , 11 4 War , 12 4 Lewis Black , 13 4 Final Fantasy , 14 4 Aqua Teen Hunger Force , 15 4 Family Guy , 16 4 John Kerry , 17 4 Donald Rumsfeld , 18 4 Dune , 19 4 Life of Brian , 20 4 Advertising slogans , 21 4 Mohandas Karamchand Gandhi , 22 4 Chinese proverbs , 23 4 List of literary works , 24 3 Religion , 25 3 Peace

jan 2005: 1 9 List of people by name , 2 6 List of films , 3 5 Main Page , 4 4 Thomas Jefferson , 5 4 List of films/requested , 6 4 George W. Bush , 7 4 Douglas Adams , 8 3 The Simpsons , 9 3 Noam Chomsky , 10 3 Advertising slogans , 11 3 English proverbs , 12 3 Archimedes , 13 3 Latin proverbs , 14 2 Music , 15 2 Politics , 16 2 Love , 17 2 Abraham Lincoln , 18 2 Enrico Fermi , 19 2 Creationism and evolution , 20 2 Gloria Estefan , 21 2 Paracelsus , 22 2 John Dewey , 23 2 Dead Poets Society , 24 2 Batman , 25 2 The 13th Warrior

fev 2005: 1 12 List of people by name , 2 7 Main Page , 3 6 Monty Python and the Holy Grail , 4 5 The Tick , 5 5 List of television shows , 6 5 Dwight D. Eisenhower , 7 4 Final Fantasy , 8 4 Ludwig van Beethoven , 9 4 List of films , 10 4 H. G. Wells , 11 4 James A. Michener , 12 4 Anonymous , 13 3 Truth , 14 3 John D. Carmack , 15 3 Sam Walton , 16 3 Arthur Miller , 17 3 Lawrence Kudlow , 18 3 Aldo Leopold , 19 3 Mighty Morphin Power Rangers , 20 3 Stargate SG-1 , 21 3 Grosse Pointe Blank (1997) , 22 3 Buffy the Vampire Slayer , 23 3 The Simpsons , 24 3 Groucho Marx , 25 3 Margaret Cho

mar 2005: 1 14 List of people by name , 2 6 List of television shows , 3 6 Albert Einstein , 4 5 Star Wars , 5 5 List of films , 6 5 Latin proverbs , 7 4 Angel (TV series) , 8 4 Russell Crowe , 9 4 Black Hawk Down , 10 4 Atheism , 11 4 Douglas Adams , 12 3 God , 13 3 Mary Wollstonecraft , 14 3 Sappho , 15 3 Keith Richards , 16 3 Saint Patrick , 17 3 Tim Moore (writer) , 18 3 David Baddiel , 19 3 Kiefer Sutherland , 20 3 Anthony Robbins , 21 3 Radical Dreamers , 22 3 The Magic School Bus , 23 3 The Incredibles , 24 3 Jurassic Park (film) , 25 3 Alexander Graham Bell

abr 2005: 1 21 List of people by name , 2 12 Mitch Hedberg , 3 9 Pope John Paul II , 4 8 The Simpsons , 5 7 List of television shows , 6 7 List of films , 7 6 Anonymous , 8 6 Main Page , 9 5 Sin City , 10 5 Veronica Mars , 11 5 English proverbs , 12 5 List of literary works , 13 5 Douglas Adams , 14 5 Winston Churchill , 15 4 Dogma (film) , 16 4 Family Guy , 17 4 The Wizard of Oz , 18 4 Star Wars , 19 4 Advertising slogans , 20 4 René Descartes , 21 4 Karl Marx , 22 4 Woody Allen , 23 4 Bertrand Russell , 24 4 Albert Einstein , 25 3 Poetry

mai 2005: 1 13 Star Wars , 2 11 List of people by name , 3 6 Palpatine , 4 6 Mitch Hedberg , 5 6 List of television shows , 6 6 List of films , 7 6 Computers , 8 5 Darth Vader , 9 5 Margaret Thatcher , 10 5 The Simpsons , 11 5 Last words , 12 5 Bill Watterson , 13 4 Epitaphs , 14 4 Jesus , 15 4 Angel (TV series) , 16 4 Star Trek , 17 4 Bill Gates , 18 3 Religion , 19 3 Mothers , 20 3 Politics , 21 3 School of Rock , 22 3 NewsRadio , 23 3 Guinevere Jones , 24 3 Georgia O'Keeffe , 25 3 David Letterman

jun 2005: 1 14 List of films , 2 12 List of people by name , 3 11 List of television shows , 4 8 Star Wars , 5 8 Winston Churchill , 6 7 Batman Begins , 7 7 Mitch Hedberg , 8 7 Socrates , 9 7 Anonymous , 10 6 Darth Vader , 11 6 Plato , 12 6 Ambrose Bierce , 13 5 Religion , 14 5 John Ziman , 15 5 Pyotr Ilyich Tchaikovsky , 16 5 W. Mark Felt , 17 5 Doctor Who , 18 5 Last words , 19 5 Mark Twain , 20 5 Bertrand Russell , 21 4 Politics , 22 4 The Order of the Stick , 23 4 Toy Story , 24 4 The Fifth Element , 25 4 John Derbyshire

jul 2005: 1 9 List of people by name , 2 8 George W. Bush , 3 7 Harry Potter (series) , 4 7 The Simpsons , 5 7 Star Wars , 6 7 List of films , 7 6 Mitch Hedberg , 8 6 Monty Python's Flying Circus , 9 6 Carl Sagan , 10 6 Mark Twain , 11 5 Love , 12 5 London , 13 5 Firefly (TV series) , 14 5 Mystery Science Theater 3000 , 15 5 Abortion , 16 5 Star Trek , 17 5 English proverbs , 18 5 Douglas Adams , 19 4 Religion , 20 4 Jesus , 21 4 Wedding Crashers , 22 4 The Good, the Bad and the Ugly , 23 4 Jacques-Yves Cousteau , 24 4 Kate Clinton , 25 4 Million Dollar Baby

ago 2005: 1 17 List of people by name , 2 8 Family Guy , 3 8 List of films , 4 6 Creationism and evolution , 5 6 Abortion , 6 6 George Bernard Shaw , 7 5 God , 8 5 American Psycho (film) , 9 5 The Hitchhiker's Guide to the Galaxy , 10 5 Buffy the Vampire Slayer , 11 5 List of television shows , 12 5 The Simpsons , 13 5 Star Trek , 14 5 Anonymous , 15 5 Winston Churchill , 16 4 Religion , 17 4 Politics , 18 4 Love , 19 4 Epitaphs , 20 4 Democracy , 21 4 Courage , 22 4 Jacques Chirac , 23 4 Anti-Polonism , 24 4 Fakhri al-Qaisi , 25 4 Swingers (1996 film)

set 2005: 1 11 List of films , 2 10 List of people by name , 3 6 Family Guy , 4 6 George W. Bush , 5 4 The Royal Tenenbaums , 6 4 Pure Pwnage , 7 4 James Hudson Taylor , 8 4 Showgirls , 9 4 Angel (TV series) , 10 4 Advertising slogans , 11 3 Religion , 12 3 Intelligence , 13 3 The Bible , 14 3 Andrew S. Tanenbaum , 15 3 Edward Heath , 16 3 The Railway Series , 17 3 Henry VIII of England , 18 3 Max Weber , 19 3 Earth , 20 3 Chief Seattle , 21 3 Adam and Eve , 22 3 The Golden Rule , 23 3 Diogenes Small , 24 3 The Godfather: Part III , 25 3 Troy (film)

out 2005: 1 12 List of people by name , 2 7 Star Wars , 3 7 List of films , 4 7 Albert Einstein , 5 6 Family Guy , 6 5 Buffy the Vampire Slayer , 7 5 List of television shows , 8 5 English proverbs , 9 5 George W. Bush , 10 4 Politics , 11 4 Love , 12 4 God , 13 4 Octavio Paz , 14 4 Lost (TV series) , 15 4 Steve Jobs , 16 4 Che Guevara , 17 4 Benjamin Franklin , 18 4 Mark Twain , 19 3 Science , 20 3 Suicide , 21 3 Life , 22 3 Michael Crichton , 23 3 Blade II , 24 3 Dave Matthews , 25 3 IPod

nov 2005: 1 8 List of films , 2 8 List of misquotations , 3 7 The Simpsons , 4 7 Last words , 5 7 List of people by name , 6 6 George W. Bush , 7 5 Firefly (TV series) , 8 5 List of television shows , 9 5 English proverbs , 10 4 Colin Wilson , 11 4 Extras (TV series) , 12 4 The Office (U.S. TV series) , 13 4 Veronica Mars , 14 4 Final Fantasy , 15 4 Buffy the Vampire Slayer , 16 4 Abortion , 17 4 Advertising slogans , 18 4 Mohandas Karamchand Gandhi , 19 4 Kate Bush , 20 4 Adolf Hitler , 21 4 Douglas Adams , 22 4 Anonymous , 23 4 Latin proverbs , 24 3 Music , 25 3 Jesus

dez 2005: 1 8 Anarchism , 2 8 Star Wars , 3 8 List of films , 4 8 Mark Twain , 5 8 List of people by name , 6 7 The Simpsons , 7 7 Abortion , 8 6 List of television shows , 9 6 George W. Bush , 10 5 True Romance , 11 5 The 40-Year-Old Virgin , 12 5 Billie Joe Armstrong , 13 5 Mitch Hedberg , 14 5 Buffy the Vampire Slayer , 15 5 Advertising slogans , 16 4 Jesus , 17 4 Enya , 18 4 Dane Cook , 19 4 Ursula K. Le Guin , 20 4 Warcraft , 21 4 Robert Oppenheimer , 22 4 Family Guy , 23 4 The Lord of the Rings , 24 4 Last words , 25 4 George Carlin

jan 2006: 1 16 List of people by name , 2 8 List of television shows , 3 7 The Simpsons , 4 6 The Hitchhiker's Guide to the Galaxy , 5 6 Star Wars , 6 6 Mark Twain , 7 5 Nelson Mandela , 8 5 Mystery Science Theater 3000 , 9 5 Star Trek , 10 5 Advertising slogans , 11 5 Adolf Hitler , 12 5 Napoleon I of France , 13 4 Calvin Coolidge , 14 4 The Incredibles , 15 4 Stargate SG-1 , 16 4 Jimmy Wales , 17 4 Red vs. Blue , 18 4 South Park , 19 4 Steve Jobs , 20 4 Family Guy , 21 4 Muhammad , 22 4 List of films , 23 4 Joseph Addison , 24 4 Richard Dawkins , 25 4 Friedrich Nietzsche

fev 2006: 1 7 List of people by name , 2 6 Jack Thompson (attorney) , 3 6 Buffy the Vampire Slayer , 4 6 Abortion , 5 6 List of films , 6 5 Red vs. Blue , 7 5 List of television shows , 8 4 Guilt , 9 4 Anarchism , 10 4 Mitch Hedberg , 11 4 Mystery Science Theater 3000 , 12 4 Indian proverbs , 13 4 George W. Bush , 14 4 Last words , 15 4 Anonymous , 16 4 Winston Churchill , 17 3 Spring , 18 3 Truth , 19 3 Weakness , 20 3 Abraham Lincoln , 21 3 Courage , 22 3 Winter , 23 3 The Rock (entertainer) , 24 3 Robert Graves , 25 3 The Aviator

mar 2006: 1 10 List of people by name , 2 8 George W. Bush , 3 6 Love , 4 6 The Grim Adventures of Billy & Mandy , 5 6 Star Wars , 6 6 List of films , 7 6 Last words , 8 5 The King of Fighters , 9 5 V for Vendetta (film) , 10 5 Jack Thompson (attorney) , 11 5 Mystery Science Theater 3000 , 12 5 Buffy the Vampire Slayer , 13 5 List of television shows , 14 5 Abortion , 15 4 Ward Cunningham , 16 4 Sitting Bull , 17 4 Michael Jackson , 18 4 Sonic the Hedgehog , 19 4 Gilmore Girls , 20 4 Firefly (TV series) , 21 4 Family Guy , 22 4 Mohandas Karamchand Gandhi , 23 4 Bill Gates , 24 3 William Shakespeare , 25 3 Friendship

abr 2006: 1 17 List of people by name , 2 10 V for Vendetta (film) , 3 8 Anonymous , 4 7 Jimmy Wales , 5 7 Star Wars , 6 6 South Park , 7 6 Doctor Who , 8 6 Last words , 9 6 Albert Einstein , 10 5 Whose Line Is It Anyway? , 11 5 Thomas Jefferson , 12 5 Tony Almeida , 13 5 Veronica Mars , 14 5 Stargate SG-1 , 15 5 Buffy the Vampire Slayer , 16 5 List of films , 17 5 George W. Bush , 18 5 Douglas Adams , 19 4 Mick Jagger , 20 4 Crash (2004 film) , 21 4 Sonic the Hedgehog , 22 4 Atheism , 23 4 Pulp Fiction , 24 4 List of television shows , 25 4 Abortion

mai 2006: 1 11 List of people by name , 2 8 Grey's Anatomy , 3 8 George W. Bush , 4 7 The Simpsons , 5 7 Doctor Who , 6 7 List of films , 7 6 Red vs. Blue , 8 6 List of television shows , 9 6 Futurama , 10 6 Johann Wolfgang von Goethe , 11 6 Bill Gates , 12 6 Douglas Adams , 13 6 Anonymous , 14 6 Winston Churchill , 15 5 V for Vendetta (film) , 16 5 House (TV series) , 17 5 Mystery Science Theater 3000 , 18 5 The Princess Bride (film) , 19 5 Last words , 20 5 List of literary works , 21 5 Oscar Wilde , 22 5 Martin Luther King, Jr. , 23 4 God , 24 4 Jesus , 25 4 Kamp Krusty

jun 2006: 1 11 List of people by name , 2 8 Futurama , 3 8 List of films , 4 8 George W. Bush , 5 7 House (TV series) , 6 7 The Simpsons , 7 7 Doctor Who , 8 6 Stargate Atlantis , 9 6 Mystery Science Theater 3000 , 10 6 Muhammad , 11 6 Anonymous , 12 5 Star Trek VI: The Undiscovered Country , 13 5 MythBusters , 14 5 A Clockwork Orange , 15 5 The Mighty Boosh (TV series) , 16 5 Robert A. Heinlein , 17 5 Buffy the Vampire Slayer , 18 5 The Matrix , 19 4 Simplicity , 20 4 Star Wars Episode III: Revenge of the Sith , 21 4 Katherine Harris , 22 4 The Last Temptation of Christ , 23 4 Suikoden II , 24 4 Star Trek: The Original Series , 25 4 Top Gear

jul 2006: 1 18 List of films , 2 8 List of people by name , 3 7 Fictional last words , 4 7 Jimmy Wales , 5 6 Tenth Doctor , 6 6 List of television shows , 7 6 George W. Bush , 8 5 Superman Returns , 9 5 C. S. Lewis , 10 5 Bertrand Russell , 11 4 Religion , 12 4 William Shakespeare , 13 4 Love , 14 4 College football , 15 4 The Adventures of Chico and Guapo , 16 4 Thierry Henry , 17 4 Stargate Atlantis , 18 4 MythBusters , 19 4 Jesse Ventura , 20 4 Frida Kahlo , 21 4 Naruto , 22 4 Mitch Hedberg , 23 4 Pirates of the Caribbean: The Curse of the Black Pearl , 24 4 The Simpsons , 25 4 Titanic (1997 film)

ago 2006: 1 10 List of television shows , 2 10 List of people by name , 3 9 Stargate SG-1 , 4 9 List of films , 5 8 Talladega Nights: The Ballad of Ricky Bobby , 6 8 The Simpsons , 7 7 Mel Gibson , 8 7 Top Gear , 9 6 Fictional last words , 10 6 House (TV series) , 11 6 Mitch Hedberg , 12 6 Buffy the Vampire Slayer , 13 5 The Bible , 14 5 Snakes on a Plane , 15 5 Hannah Montana , 16 5 Gilmore Girls , 17 5 Mystery Science Theater 3000 , 18 5 Babylon 5 , 19 5 Futurama , 20 5 English proverbs , 21 5 Benjamin Franklin , 22 5 Douglas Adams , 23 5 Anonymous , 24 4 Abraham Lincoln , 25 4 The 4400

set 2006: 1 12 Steve Irwin , 2 8 Love , 3 8 Anonymous , 4 7 Stargate SG-1 , 5 7 List of television shows , 6 7 George W. Bush , 7 7 List of people by name , 8 6 List of films , 9 6 English proverbs , 10 6 Last words , 11 6 Adolf Hitler , 12 6 Mark Twain , 13 5 Betty Edwards , 14 5 Fictional last words , 15 5 Star Wars Episode IV: A New Hope , 16 5 Anarchism , 17 5 Grey's Anatomy , 18 5 House (TV series) , 19 5 Ann Richards , 20 5 Mystery Science Theater 3000 , 21 5 Buffy the Vampire Slayer , 22 5 Sex , 23 4 Politics , 24 4 Sidney Lanier , 25 4 Barbara Ehrenreich

out 2006: 1 11 George W. Bush , 2 7 List of films , 3 7 List of people by name , 4 7 Anonymous , 5 6 Fictional last words , 6 6 South Park , 7 6 List of television shows , 8 6 The Simpsons , 9 6 Albert Einstein , 10 5 Fire Emblem , 11 5 Metal Gear , 12 5 Futurama , 13 5 Benjamin Franklin , 14 5 Last words , 15 5 Bertrand Russell , 16 4 Solitude , 17 4 The Bible , 18 4 Thomas Jefferson , 19 4 John Pomfret , 20 4 Numb3rs , 21 4 Larry Bird , 22 4 John McKay , 23 4 The Thomas Crown Affair , 24 4 Bleach (manga) , 25 4 G. Edward Griffin

nov 2006: 1 17 List of people by name , 2 11 List of films , 3 9 House (TV series) , 4 9 Futurama , 5 9 Anonymous , 6 8 Metalocalypse , 7 8 South Park , 8 8 George W. Bush , 9 7 Buffy the Vampire Slayer , 10 7 English proverbs , 11 6 Love , 12 6 South Park/Season 10 , 13 6 MythBusters , 14 6 Atheism , 15 6 Friends (TV series) , 16 6 Fyodor Dostoevsky , 17 6 Advertising slogans , 18 6 Last words , 19 5 Michael Richards , 20 5 Borat: Cultural Learnings of America for Make Benefit Glorious Nation of Kazakhstan , 21 5 The Simpsons/Season 18 , 22 5 Lawrence Eagleburger , 23 5 Dane Cook , 24 5 Battlestar Galactica (2003) , 25 5 Fahrenheit 451

dez 2006: 1 12 George W. Bush , 2 9 List of films , 3 8 Love , 4 8 List of television shows , 5 7 House (TV series) , 6 7 List of people by name , 7 6 Happy Feet , 8 6 The Office (U.S. TV series) , 9 6 Last words , 10 5 Buffy the Vampire Slayer/Season 4 , 11 5 Fictional last words , 12 5 One Tree Hill , 13 5 Kim Possible , 14 5 Jimmy Wales , 15 5 John Adams , 16 5 Family Guy , 17 5 The Simpsons , 18 5 Advertising slogans , 19 5 English proverbs , 20 5 List of misquotations , 21 5 List of literary works , 22 5 Winston Churchill , 23 5 Albert Einstein , 24 4 Science , 25 4 Evil

jan 2007: 1 14 List of people by name , 2 11 List of films , 3 10 Love , 4 9 Last words , 5 8 Futurama , 6 8 George W. Bush , 7 7 Hannah Montana , 8 7 Sex , 9 7 English proverbs , 10 7 Anonymous , 11 7 Winston Churchill , 12 6 Friendship , 13 6 Urban decay , 14 6 José Rizal , 15 6 Metalocalypse , 16 6 Tenth Doctor , 17 6 Jack Thompson (attorney) , 18 6 Warcraft , 19 6 The Hitchhiker's Guide to the Galaxy , 20 6 Family Guy , 21 6 List of television shows , 22 6 Saddam Hussein , 23 5 God , 24 5 Elias Aslaksen , 25 5 Mike Huckabee

fev 2007: 1 11 House (TV series) , 2 10 List of films , 3 9 Jesus , 4 9 Grey's Anatomy , 5 8 Christianity , 6 8 Last words , 7 6 George Washington , 8 6 Fictional last words , 9 6 The Office (U.S. TV series) , 10 6 Muhammad Ali , 11 6 List of television shows , 12 6 Sex , 13 6 Mohandas Karamchand Gandhi , 14 6 George W. Bush , 15 6 List of people by name , 16 5 War , 17 5 Thomas Jefferson , 18 5 The Simpsons/Season 9 , 19 5 Star Wars Episode V: The Empire Strikes Back , 20 5 MythBusters , 21 5 Scrubs (TV series) , 22 5 SpongeBob SquarePants , 23 5 Gilmore Girls , 24 5 Family Guy , 25 5 Futurama

mar 2007: 1 10 List of films , 2 9 300 (film) , 3 9 George W. Bush , 4 7 Love , 5 7 Jesus , 6 7 Islam , 7 7 Scrubs (TV series) , 8 7 Aqua Teen Hunger Force , 9 7 Futurama , 10 7 Muhammad , 11 7 Last words , 12 7 List of people by name , 13 6 Mark Twain , 14 5 Thomas Jefferson , 15 5 Borat: Cultural Learnings of America for Make Benefit Glorious Nation of Kazakhstan , 16 5 Life on Mars (TV series) , 17 5 Grey's Anatomy , 18 5 Mitch Hedberg , 19 5 Sex , 20 5 Robert Frost , 21 5 Richard Nixon , 22 4 William Shakespeare , 23 4 God , 24 4 Ryōkan , 25 4 Ivan Turgenev

abr 2007: 1 20 List of people by name , 2 13 Tenth Doctor , 3 13 List of films , 4 10 List of television shows , 5 9 Naruto , 6 8 Kurt Vonnegut , 7 8 Last words , 8 8 Anonymous , 9 7 Blades of Glory (film) , 10 7 English proverbs , 11 7 Winston Churchill , 12 6 Scrubs (TV series) , 13 6 Futurama , 14 6 List of literary works , 15 6 Albert Einstein , 16 5 Edward Whittemore , 17 5 Patrick Pearse , 18 5 The Daleks , 19 5 The Office (U.S. TV series) , 20 5 House (TV series) , 21 5 SpongeBob SquarePants , 22 5 John Adams , 23 5 Firefly (TV series) , 24 5 Mystery Science Theater 3000 , 25 5 George W. Bush

mai 2007: 1 15 List of people by name , 2 14 List of films , 3 13 House (TV series) , 4 13 List of literary works , 5 11 Grey's Anatomy , 6 11 Anonymous , 7 10 Scrubs (TV series) , 8 10 Jimmy Wales , 9 10 Star Wars , 10 9 Tenth Doctor , 11 9 List of television shows , 12 9 George W. Bush , 13 8 Naruto , 14 8 Adolf Hitler , 15 7 Dragon Ball Z , 16 7 Heroes (TV series) , 17 7 Bleach (manga) , 18 7 Last words , 19 6 Pirates of the Caribbean: At World's End , 20 6 Futurama , 21 6 Advertising slogans , 22 5 Religion , 23 5 Charlotte Wilson , 24 5 Crash Tag Team Racing , 25 5 300 (film)

jun 2007: 1 13 Love , 2 12 Tenth Doctor , 3 11 Dragon Ball Z , 4 10 List of films , 5 10 List of people by name , 6 9 Naruto , 7 7 Bleach (manga) , 8 7 Anakin Skywalker , 9 6 Robot Chicken , 10 6 Mitch Hedberg , 11 6 Pokémon , 12 6 Jurassic Park (film) , 13 6 Buffy the Vampire Slayer , 14 6 English proverbs , 15 6 Albert Einstein , 16 5 Dragon Ball Z: Bio-Broly , 17 5 Dragon Ball Z: Wrath of the Dragon , 18 5 Fantastic Four: Rise of the Silver Surfer , 19 5 Knocked Up , 20 5 Dragon Ball GT , 21 5 The Simpsons/Season 7 , 22 5 Dragon Ball , 23 5 Hannah Montana , 24 5 Islam , 25 5 List of television shows

jul 2007: 1 11 List of people by name , 2 10 Harry Potter and the Deathly Hallows , 3 9 The Simpsons Movie , 4 9 List of films , 5 8 Islam , 6 8 Scrubs (TV series) , 7 8 Qur'an , 8 8 List of television shows , 9 7 Love , 10 7 Dragon Ball , 11 7 Harry Potter and the Order of the Phoenix , 12 7 Tenth Doctor , 13 6 The Pursuit of Happyness , 14 6 Transformers (film) , 15 6 300 (film) , 16 6 Harry Potter and the Philosopher's Stone , 17 6 Harry Potter and the Half-Blood Prince , 18 6 House (TV series) , 19 6 Barack Obama , 20 6 The Sopranos , 21 6 Futurama , 22 5 Harry Potter and the Order of the Phoenix (film) , 23 5 The Simpsons/Season 8 , 24 5 Bleach (manga) , 25 5 Ron Paul

ago 2007: 1 12 List of films , 2 10 List of people by name , 3 9 List of television shows , 4 9 George W. Bush , 5 9 Albert Einstein , 6 8 Ron Paul , 7 7 The Simpsons Movie , 8 6 Riaz Ahmed Gohar Shahi , 9 6 Firefly (TV series) , 10 6 Futurama , 11 5 Macy Gray , 12 5 What Women Want , 13 5 Saudi Arabia , 14 5 The Simpsons/Season 4 , 15 5 Tenth Doctor , 16 5 Dracula (1992) , 17 5 Gilmore Girls , 18 5 Last words , 19 5 Anonymous , 20 4 Love , 21 4 Judaism , 22 4 BioShock , 23 4 Superbad , 24 4 Stardust (2007 film) , 25 4 The Fly II

set 2007: 1 10 List of films , 2 10 George W. Bush , 3 9 BioShock , 4 9 List of people by name , 5 7 House (TV series) , 6 6 Warhammer 40,000: Dawn of War , 7 6 Scrubs (TV series) , 8 5 Zionism , 9 5 James Spader , 10 5 Naruto the Movie: Ninja Clash in the Land of Snow , 11 5 Thomas and Friends , 12 5 Anonymous , 13 4 Love , 14 4 God , 15 4 Family Guy/Season 6 , 16 4 Fictional last words in films , 17 4 Syracuse, Sicily , 18 4 Hannah Montana , 19 4 Stuart Merrill , 20 4 Kim Possible , 21 4 Jimmy Wales , 22 4 Ovadia Yosef , 23 4 SpongeBob SquarePants , 24 4 List of television shows , 25 4 Napoleon I of France

out 2007: 1 13 List of people by name , 2 11 Portal (game) , 3 8 Scrubs (TV series) , 4 7 Christianity , 5 6 Palindromes , 6 6 Rush Hour 3 , 7 6 The Office (U.S. TV series) , 8 6 Grey's Anatomy , 9 6 House (TV series) , 10 5 Muhammad , 11 4 Alice Bailey , 12 4 Rabbit-Proof Fence (film) , 13 4 The Big Bang Theory , 14 4 Material Girls , 15 4 Barney & Friends , 16 4 Metalocalypse , 17 4 Hannah Montana , 18 4 Benjamin N. Cardozo , 19 4 The Colbert Report , 20 4 Doris Lessing , 21 4 Hillary Rodham Clinton , 22 4 M*A*S*H (TV series) , 23 4 The Matrix Reloaded , 24 4 List of films , 25 4 Ronald Reagan

nov 2007: 1 15 List of people by name , 2 8 List of films , 3 8 Anonymous , 4 8 Albert Einstein , 5 7 Adam Mickiewicz , 6 7 Futurama , 7 6 Mistakes , 8 6 The Office (U.S. TV series) , 9 5 God , 10 5 Synagogue , 11 5 Never , 12 5 Fictional last words in films , 13 5 Brett Favre , 14 5 Top Gear , 15 5 Scrubs (TV series) , 16 5 Hillary Rodham Clinton , 17 5 David Ben-Gurion , 18 5 The Simpsons , 19 5 Martin Luther King, Jr. , 20 4 Abraham Lincoln , 21 4 Friendship , 22 4 Time , 23 4 Rodney King , 24 4 Pushing Daisies , 25 4 Iran

dez 2007: 1 9 List of people by name , 2 8 House (TV series) , 3 8 Futurama , 4 8 List of films , 5 7 Ron Paul , 6 6 Jesus , 7 6 Barney & Friends , 8 6 Naruto , 9 6 List of television shows , 10 5 Love , 11 5 Howard Safir , 12 5 Reinhard Heydrich , 13 5 Scrubs (TV series) , 14 5 Metal Gear Solid 3: Snake Eater , 15 5 C. S. Lewis , 16 5 Adolf Hitler , 17 4 Turkey , 18 4 Alan Alda , 19 4 I Am Legend (film) , 20 4 Pakistan , 21 4 Benazir Bhutto , 22 4 Family Guy/Season 5 , 23 4 Metal Gear , 24 4 Stephen Jay Gould , 25 4 Monk (TV series)

jan 2008: 1 11 George W. Bush , 2 9 Chip Berlet , 3 8 List of films , 4 8 English proverbs , 5 7 Heath Ledger , 6 7 List of people by name , 7 6 Juno (film) , 8 6 Fictional last words in films , 9 6 Torchwood , 10 6 Rush Limbaugh , 11 6 Anonymous , 12 5 Edna St. Vincent Millay , 13 5 Barney & Friends , 14 5 Portal (game) , 15 5 The Simpsons/Season 13 , 16 5 The Suite Life of Zack & Cody , 17 5 Avatar: The Last Airbender , 18 5 Edmund Hillary , 19 5 Futurama , 20 5 Richard Feynman , 21 5 Advertising slogans , 22 4 Black Kettle , 23 4 Lawrence Ferlinghetti , 24 4 List of people by name, N-O , 25 4 List of people by name, D

fev 2008: 1 8 George W. Bush , 2 7 List of people by name, A , 3 7 John McCain , 4 7 Rush Limbaugh , 5 7 Hillary Rodham Clinton , 6 7 Martin Luther King, Jr. , 7 6 William Shakespeare , 8 6 List of people by name, N-O , 9 6 List of people by name, D , 10 6 Barack Obama , 11 6 George H. W. Bush , 12 6 Anonymous , 13 6 Albert Einstein , 14 5 Love , 15 5 Christianity , 16 5 The Bible , 17 5 Elephants , 18 5 Family Guy/Season 6 , 19 5 Fullmetal Alchemist , 20 5 Naruto , 21 5 List of films , 22 5 Isaac Newton , 23 5 Benjamin Franklin , 24 5 Oscar Wilde , 25 4 Abraham Lincoln

mar 2008: 1 9 List of people by name, S , 2 9 List of people by name, N-O , 3 9 George W. Bush , 4 8 List of television shows , 5 6 List of people by name, D , 6 6 Torchwood , 7 6 George H. W. Bush , 8 6 List of films , 9 5 Love , 10 5 Terminator: The Sarah Connor Chronicles , 11 5 List of people by name, A , 12 5 Dragon Ball Z , 13 5 Flavor Flav , 14 5 Rush Limbaugh , 15 5 Anatole France , 16 5 Internet , 17 4 William Shakespeare , 18 4 Jesus , 19 4 Cloverfield , 20 4 Rick Astley , 21 4 Juno (film) , 22 4 Nero Wolfe , 23 4 Thomas Jefferson , 24 4 Barney & Friends , 25 4 The Simpsons/Season 18

abr 2008: 1 13 Tenth Doctor , 2 9 List of television shows , 3 8 House (TV series) , 4 7 Barack Obama , 5 7 George W. Bush , 6 6 William Shakespeare , 7 6 Love , 8 6 List of people by name, S , 9 6 List of people by name, N-O , 10 6 List of people by name, A , 11 6 Barney & Friends , 12 6 Fullmetal Alchemist , 13 6 Noam Chomsky , 14 6 English proverbs , 15 6 Anonymous , 16 6 Albert Einstein , 17 5 Matt Sanchez , 18 5 The Simpsons/Season 19 , 19 5 The Mist (film) , 20 5 The Simpsons/Season 18 , 21 5 Warhammer 40,000: Dawn of War , 22 5 Sonic the Hedgehog , 23 5 Angel (TV series) , 24 5 Rush Limbaugh , 25 5 Firefly (TV series)

mai 2008: 1 12 Tenth Doctor , 2 10 List of films , 3 8 List of people by name, N-O , 4 8 House (TV series) , 5 7 William the Silent , 6 7 Iron Man (film) , 7 7 List of people by name, A , 8 7 Dane Cook , 9 6 Abraham Lincoln , 10 6 Matt Sanchez , 11 6 Indiana Jones and the Kingdom of the Crystal Skull , 12 6 Portal (game) , 13 6 John F. Kennedy , 14 6 George W. Bush , 15 6 Martin Luther King, Jr. , 16 5 God , 17 5 Short Circuit , 18 5 Joseph Gordon-Levitt , 19 5 David Allen (author) , 20 5 List of people by name, S , 21 5 Fictional last words in films , 22 5 American Dad! , 23 5 Winston Churchill , 24 5 Albert Einstein , 25 4 Religion

jun 2008: 1 14 Tenth Doctor , 2 8 List of people by name, A , 3 8 John McCain , 4 8 George Carlin , 5 7 Love , 6 7 George Washington , 7 7 Kung Fu Panda , 8 7 List of people by name, D , 9 7 Barney & Friends , 10 6 List of people by name, S , 11 6 List of people by name, N-O , 12 6 List of films , 13 6 Mark Twain , 14 5 War , 15 5 Life , 16 5 Dragon Ball Z: Season 4 , 17 5 Grand Theft Auto IV , 18 5 Dragon Ball Z: Cooler's Revenge , 19 5 Thomas Jefferson , 20 5 Dragon Ball Z , 21 5 Hannah Montana , 22 5 The Venture Bros. , 23 5 Arthur Wellesley, 1st Duke of Wellington , 24 5 Futurama , 25 4 Angels

jul 2008: 1 18 Tenth Doctor , 2 14 The Dark Knight , 3 8 Dr. Horrible's Sing-Along Blog , 4 8 Hancock (film) , 5 8 Futurama , 6 7 Matt Sanchez , 7 7 List of people by name, S , 8 7 John McCain , 9 6 List of films , 10 6 Adolf Hitler , 11 6 List of literary works , 12 5 Wanted (2008 film) , 13 5 List of people by name, N-O , 14 5 July 18 , 15 5 Pokémon , 16 5 Thomas Henry Huxley , 17 5 Anonymous , 18 4 Circles , 19 4 Randy Pausch , 20 4 Christopher McCandless , 21 4 Nazism , 22 4 Æon Flux (film) , 23 4 Fictional last words in films , 24 4 Charlotte Brontë , 25 4 That's So Suite Life of Hannah Montana

ago 2008: 1 8 The Dark Knight , 2 7 Portal (game) , 3 7 John McCain , 4 7 List of films , 5 6 Whose Line Is It Anyway? , 6 6 List of people by name, N-O , 7 6 Barack Obama , 8 6 Bill O'Reilly (commentator) , 9 6 Last words , 10 5 Michael Phelps , 11 5 Hank Aaron , 12 5 List of people by name, S , 13 5 List of people by name, D , 14 5 List of people by name, A , 15 5 English proverbs , 16 4 Mice , 17 4 Alex Mero , 18 4 I'm No Angel , 19 4 Gilbert du Motier, marquis de Lafayette , 20 4 Michael Gambon , 21 4 Fictional last words in films , 22 4 Jeff Dunham , 23 4 Stargate Atlantis , 24 4 Pat Robertson , 25 4 Scrubs (TV series)

set 2008: 1 11 Sarah Palin , 2 9 Anonymous , 3 6 Barack Obama , 4 5 List of people by name, N-O , 5 5 Tenth Doctor , 6 5 September 22 , 7 5 John McCain , 8 5 Carmen Sandiego , 9 5 Mystery Science Theater 3000 , 10 5 Isaac Newton , 11 5 Benjamin Franklin , 12 5 Last words , 13 4 Eugen Drewermann , 14 4 List of people by name, A , 15 4 October 1 , 16 4 The Suite Life of Zack & Cody , 17 4 Half-Life , 18 4 House (TV series) , 19 4 Angel (TV series) , 20 4 Jimmy Wales , 21 4 Richard Feynman , 22 3 Quotations , 23 3 Love , 24 3 Life , 25 3 Whose Line Is It Anyway?

out 2008: 1 9 List of literary works , 2 8 List of films , 3 7 October 31 , 4 7 October 16 , 5 6 Sarah Palin , 6 6 October 30 , 7 6 October 29 , 8 6 October 28 , 9 6 October 2 , 10 5 Abraham Lincoln , 11 5 Kenan Evren , 12 5 Pirates of the Caribbean: At World's End , 13 5 October 27 , 14 5 October 18 , 15 5 October 17 , 16 5 October 15 , 17 5 October 8 , 18 5 November 1 , 19 5 The Office (U.S. TV series) , 20 5 House (TV series) , 21 5 John McCain , 22 5 Barack Obama , 23 5 Mark Twain , 24 5 Albert Einstein , 25 4 Quotations

nov 2008: 1 14 Barack Obama , 2 9 November 30 , 3 8 It's Always Sunny in Philadelphia , 4 7 Sarah Palin , 5 7 30 Rock , 6 7 November 26 , 7 7 November 24 , 8 7 November 20 , 9 7 November 11 , 10 6 Love , 11 6 The Big Bang Theory , 12 6 November 28 , 13 6 November 22 , 14 6 November 18 , 15 6 November 16 , 16 6 November 15 , 17 6 November 14 , 18 6 November 13 , 19 6 November 4 , 20 6 December 1 , 21 6 Bambi , 22 6 The Office (UK TV series) , 23 6 Scrubs (TV series) , 24 6 James Bond (film series) , 25 6 List of literary works

dez 2008: 1 8 Love , 2 8 List of films , 3 7 December 5 , 4 6 Sarah Palin , 5 6 List of people by name, A , 6 6 Tenth Doctor , 7 6 December 9 , 8 6 Top Gear , 9 6 Benjamin Franklin , 10 5 30 Rock , 11 5 December 20 , 12 5 December 13 , 13 5 December 11 , 14 5 December 8 , 15 5 December 7 , 16 5 The Office (U.S. TV series) , 17 5 National Lampoon's Christmas Vacation , 18 5 House (TV series) , 19 5 Friends (TV series) , 20 5 Ayn Rand , 21 5 John F. Kennedy , 22 5 George W. Bush , 23 5 Last words , 24 4 Life , 25 4 Matthew Perry (actor)

jan 2009: 1 48 John Dewey , 2 8 Barack Obama , 3 8 List of films , 4 7 Jimmy Wales , 5 6 Muhammad , 6 6 English proverbs , 7 6 Last words , 8 6 John Lennon , 9 5 Truth , 10 5 Jalal Talabani , 11 5 Psych (TV series) , 12 5 Macedonia (region) , 13 5 30 Rock , 14 5 Futurama , 15 5 George W. Bush , 16 5 Hamlet , 17 4 Politics , 18 4 Love , 19 4 Abraham Lincoln , 20 4 Freedom , 21 4 Matthew Barney , 22 4 James Rosenquist , 23 4 Arthur Rubinstein , 24 4 The Simpsons Hit & Run , 25 4 The Outline of History

fev 2009: 1 21 John Dewey , 2 8 List of people by name , 3 7 Barack Obama , 4 7 List of television shows , 5 7 List of literary works , 6 6 Catherine of Aragon , 7 6 List of films , 8 5 Love , 9 5 List of people by name, A , 10 5 Thomas Jefferson , 11 5 30 Rock , 12 5 Harry Potter and the Prisoner of Azkaban , 13 5 Hannah Montana , 14 5 John Adams , 15 5 Margaret Thatcher , 16 5 Advertising slogans , 17 5 George W. Bush , 18 5 Albert Einstein , 19 4 Total Drama Island , 20 4 Religion , 21 4 The Formation of Vegetable Mould through the Action of Worms , 22 4 Floyd Dell , 23 4 The Sword in the Stone (film) , 24 4 For a Few Dollars More , 25 4 The Nostalgia Critic

mar 2009: 1 11 Rachel Maddow , 2 9 List of television shows , 3 8 List of literary works , 4 7 List of people by name, D , 5 7 30 Rock , 6 7 List of films , 7 7 Albert Einstein , 8 6 William Shakespeare , 9 6 The Sword in the Stone (film) , 10 6 Wikipedia , 11 6 Yes, Minister , 12 6 The Hitchhiker's Guide to the Galaxy , 13 6 Gautama Buddha , 14 5 Love , 15 5 Genius , 16 5 Watchmen (film) , 17 5 Eastbound & Down , 18 5 Tristan Corbière , 19 5 Star Wars: The Clone Wars (film) , 20 5 Quantum of Solace , 21 5 Transformers Animated , 22 5 List of people by name, A , 23 5 Harry Potter and the Prisoner of Azkaban , 24 5 March 17 , 25 5 March 14

abr 2009: 1 10 Patrick Henry , 2 8 Thomas Babington Macaulay, 1st Baron Macaulay , 3 8 Isaac Newton , 4 7 List of television shows , 5 6 Truth , 6 6 Star Wars Episode IV: A New Hope , 7 5 Love , 8 5 Abraham Lincoln , 9 5 30 Rock , 10 5 Tenth Doctor , 11 5 April 11 , 12 5 April 10 , 13 5 Camille Paglia , 14 5 Vladimir Lenin , 15 5 List of films , 16 5 Benjamin Franklin , 17 5 Edsger W. Dijkstra , 18 5 List of literary works , 19 5 Albert Einstein , 20 4 Suicide , 21 4 Luck , 22 4 Louis Riel , 23 4 Dionysius Lardner , 24 4 Star Wars: The Clone Wars (film) , 25 4 Transformers Animated

mai 2009: 1 8 Benjamin Franklin , 2 7 30 Rock , 3 7 Last words , 4 6 Peace , 5 6 Star Trek (2009 film) , 6 6 List of people by name, I-J , 7 6 List of people by name, D , 8 6 List of television shows , 9 6 List of films , 10 6 George W. Bush , 11 5 Quotations , 12 5 Sonia Sotomayor , 13 5 Patrick Henry , 14 5 The Shawshank Redemption , 15 5 George Bernard Shaw , 16 4 Love , 17 4 George Washington , 18 4 Maid , 19 4 Imre Kertész , 20 4 True Blood (TV series) , 21 4 The Nostalgia Critic , 22 4 Michael Crichton , 23 4 Team Fortress 2 , 24 4 List of people by name, S , 25 4 List of people by name, A

jun 2009: 1 8 Michael Jackson , 2 5 Jaggi Vasudev , 3 5 Bryce Crawford , 4 5 Phineas and Ferb , 5 5 Top Gear , 6 5 Patrick Henry , 7 5 Metal Gear , 8 5 List of films , 9 5 Helen Keller , 10 5 Voltaire , 11 4 Sun , 12 4 Sky , 13 4 Whose Line Is It Anyway? , 14 4 Dragon Ball Z: Bardock - The Father of Goku , 15 4 List of people by name, A , 16 4 Zero Punctuation , 17 4 Cole Porter , 18 4 300 (film) , 19 4 The Simpsons/Season 1 , 20 4 June 22 , 21 4 Camille Paglia , 22 4 NCIS (TV series) , 23 4 Roger Ebert , 24 4 The Shawshank Redemption , 25 4 Mohandas Karamchand Gandhi

jul 2009: 1 25 Charles Darwin , 2 21 Mohandas Karamchand Gandhi , 3 20 Martin Luther King, Jr. , 4 19 William Shakespeare , 5 19 Thomas Samuel Kuhn , 6 17 Albert Einstein , 7 15 John F. Kennedy , 8 15 Voltaire , 9 14 Muhammad , 10 14 Aristotle , 11 13 Helen Keller , 12 13 Leo Tolstoy , 13 13 Confucius , 14 11 Patrick Henry , 15 10 Religion , 16 10 Science , 17 10 Michael Jackson , 18 10 Timothy Leary , 19 10 Richard Feynman , 20 8 The Cabinet of Dr. Caligari , 21 8 William Saroyan , 22 8 Gautama Buddha , 23 8 Emily Brontë , 24 8 Thomas Paine , 25 8 T. S. Eliot

ago 2009: 1 11 Patrick Henry , 2 9 StarCraft , 3 8 Love , 4 8 List of films , 5 7 Ted Kennedy , 6 5 Quotations , 7 5 Transformers: Revenge of the Fallen , 8 5 NCIS (TV series) , 9 4 Wentworth Miller , 10 4 Bethany Kennedy Scanlon , 11 4 Axl Rose , 12 4 Matt Sanchez , 13 4 Castle (TV series) , 14 4 True Blood (TV series) , 15 4 List of people by name, I-J , 16 4 Command & Conquer 3: Tiberium Wars , 17 4 Phineas and Ferb , 18 4 Psych (TV series) , 19 4 Boxing , 20 4 Michael Jackson , 21 4 Rudolf Hess , 22 4 Dead Poets Society , 23 4 The Matrix , 24 4 English proverbs , 25 3 Religion

set 2009: 1 15 Paulo Freire , 2 9 Benjamin Franklin , 3 7 Transformers: Generation 1 , 4 6 List of films , 5 6 Mao Zedong , 6 5 Trust , 7 5 Manly Palmer Hall , 8 5 John Maynard Keynes , 9 5 Atlas Shrugged , 10 5 Martin Luther , 11 5 Ralph Waldo Emerson , 12 4 Love , 13 4 Anthony Ashley Cooper, 1st Earl of Shaftesbury , 14 4 Angels & Demons (film) , 15 4 Bill McKibben , 16 4 Slobodan Milošević , 17 4 Leighton W. Smith, Jr. , 18 4 Telford Taylor , 19 4 Franco Frattini , 20 4 Ralph Barton Perry , 21 4 Michael Franti , 22 4 Transformers: Revenge of the Fallen , 23 4 Pan Tadeusz , 24 4 Snow White and the Seven Dwarfs (1937 film) , 25 4 The Big Bang Theory

out 2009: 1 9 Rush Limbaugh , 2 7 Glee (TV series) , 3 7 Benjamin Franklin , 4 6 Patrick Henry , 5 5 Ivor Grattan-Guinness , 6 5 Anita Dunn , 7 5 List of people by name, N-O , 8 5 List of films , 9 4 Liberty , 10 4 Samuel Gompers , 11 4 Mary Harris Jones , 12 4 Henry J. Kaiser , 13 4 James Joseph Sylvester , 14 4 Polygamy , 15 4 Caroline Myss , 16 4 Mark Oliphant , 17 4 Barbara De Angelis , 18 4 Family Guy/Season 8 , 19 4 Miley Cyrus , 20 4 The Big Bang Theory , 21 4 Jo Grimond , 22 4 The Office (U.S. TV series) , 23 4 Who Framed Roger Rabbit , 24 4 John Maynard Keynes , 25 4 That '70s Show

nov 2009: 1 6 Tenth Doctor , 2 5 Family Guy/Season 8 , 3 5 Horton Hears a Who! (film) , 4 5 Barack Obama , 5 5 Claude Lévi-Strauss , 6 5 Fight Club (film) , 7 5 Winston Churchill , 8 4 Love , 9 4 Jesse Stuart , 10 4 Tip O'Neill , 11 4 The Twilight Saga: New Moon , 12 4 Alvaro De Rujula , 13 4 Serge Raynaud , 14 4 Stuart Hall , 15 4 Ilan Halevi , 16 4 Sadegh Hedayat , 17 4 Sheikh Mujibur Rahman , 18 4 Boudica (film) , 19 4 Unification Church , 20 4 List of people by name, A , 21 4 Robert W. Bly , 22 4 The Big Bang Theory , 23 4 Derek Abbott , 24 4 V for Vendetta (film) , 25 4 How I Met Your Mother

dez 2009: 1 10 Dragon Ball GT: Season 1 , 2 10 Apocalypse Now , 3 8 V , 4 8 M (1931 film) , 5 7 Life , 6 7 Dragon Ball Z: Season 9 , 7 7 Dragon Ball GT: Season 2 , 8 7 Dragon Ball Z: Season 5 , 9 7 Dragon Ball Z: Season 3 , 10 7 Dragon Ball Z: Season 2 , 11 7 Erich von dem Bach , 12 7 Karl Dönitz , 13 7 Dragon Ball GT , 14 7 Tadamichi Kuribayashi , 15 7 Albert Einstein , 16 6 Dragon Ball Z: Season 6 , 17 6 Dragon Ball Z: Season 1 , 18 6 Akira Toriyama , 19 6 Dragon Ball Z: Wrath of the Dragon , 20 6 Dragon Ball Z , 21 6 Corbin Bleu , 22 5 Love , 23 5 Norman Lamm , 24 5 Harriet Auber , 25 5 Glee (TV series)

jan 2010: 1 8 Tenth Doctor , 2 7 Muhammad , 3 7 Advertising slogans , 4 6 Benjamin Franklin , 5 6 Hamlet , 6 5 George Washington , 7 5 Dimitrije Tucović , 8 5 3 Idiots , 9 5 Sherlock Holmes (2009 film) , 10 5 Hiromu Arakawa , 11 5 Eleventh Doctor , 12 5 Avatar (2009 film) , 13 5 Alan Greenspan , 14 4 William Shakespeare , 15 4 Daniel Bernoulli , 16 4 Conan O'Brien , 17 4 Smith Wigglesworth , 18 4 Andy Kessler (author) , 19 4 Helena Bonham Carter , 20 4 Mihira Bhoja I , 21 4 Freeman's Mind , 22 4 Martin Firrell , 23 4 Theodore Watts-Dunton , 24 4 The Big Bang Theory , 25 4 Howard Zinn

fev 2010: 1 7 Benjamin Franklin , 2 7 Albert Einstein , 3 6 Alessandra Torresani , 4 6 List of films , 5 6 Last words , 6 5 Syed Ahmed Khan , 7 5 Hal Varian , 8 5 Billy Davies , 9 5 John Reed (actor) , 10 5 Rita Hayworth , 11 5 Cui Weiping , 12 5 El secreto de sus ojos , 13 5 Thérèse of Lisieux , 14 5 Mass Effect 2 , 15 5 Burn Notice (TV series) , 16 4 Love , 17 4 Abraham Lincoln , 18 4 Knight Moves , 19 4 Solomon Kane , 20 4 Nicholas G. Carr , 21 4 Christ myth theory , 22 4 James Wesley Rawles , 23 4 Vernor Vinge , 24 4 Sebouh Chouldjian , 25 4 Archer (TV series)

mar 2010: 1 9 Francisco Franco , 2 8 Alice in Wonderland (2010 film) , 3 8 Charles Darwin , 4 8 Benjamin Franklin , 5 8 Winston Churchill , 6 6 James Cameron (director) , 7 6 Patrick Henry , 8 6 Robert A. Heinlein , 9 6 Benito Mussolini , 10 6 Gautama Buddha , 11 5 Coco Chanel , 12 5 Hugh Blair , 13 5 Fatos Nano , 14 5 Tom Peters , 15 5 G.I. Joe: The Rise of Cobra , 16 5 William Fitzsimmons , 17 5 Riaz Ahmed Gohar Shahi , 18 5 Libertarianism , 19 5 Mao Zedong , 20 5 Animal Farm , 21 5 Albert Einstein , 22 4 Hope , 23 4 Health , 24 4 Education , 25 4 Women

abr 2010: 1 13 The Rescuers , 2 11 Dumbo , 3 11 The Fox and the Hound , 4 10 Bambi , 5 9 Patrick Henry , 6 8 Eleventh Doctor , 7 8 Charlotte's Web (1973 film) , 8 7 How to Train Your Dragon , 9 7 The SpongeBob SquarePants Movie , 10 7 Lady and the Tramp II: Scamp's Adventure , 11 7 Finding Nemo , 12 6 Riaz Ahmed Gohar Shahi , 13 6 Muhammad , 14 5 The Lion King 1½ , 15 5 Lilo & Stitch , 16 5 South Park , 17 5 Georg Wilhelm Friedrich Hegel , 18 5 The Lion King , 19 4 Aubrey Beardsley , 20 4 Lars Løkke Rasmussen , 21 4 George Lincoln Rockwell , 22 4 James G. Blaine , 23 4 Eagles (band) , 24 4 Beverly Hills Chihuahua , 25 4 Lady and the Tramp

mai 2010: 1 17 Patrick Henry , 2 9 Eleventh Doctor , 3 7 The Rescuers , 4 7 The Fox and the Hound , 5 6 Robert J. Marks II , 6 6 The Lion King 1½ , 7 6 Albert Einstein , 8 5 Miranda July , 9 5 Eric Roll, Baron Roll of Ipsden , 10 5 Kung Fu Panda , 11 5 The Fox and the Hound 2 , 12 5 Tenth Doctor , 13 5 Richard Dawkins , 14 4 War , 15 4 Love , 16 4 Abraham Lincoln , 17 4 Arthur M. Jolly , 18 4 George Best , 19 4 Sun Ra , 20 4 Legion (2010 film) , 21 4 Sonny With a Chance , 22 4 The SpongeBob SquarePants Movie , 23 4 In Plain Sight , 24 4 Lady Gaga , 25 4 Beverly Hills Chihuahua

jun 2010: 1 18 Eleventh Doctor , 2 5 Miss Foozie , 3 5 The Lion King II: Simba's Pride , 4 5 Tenth Doctor , 5 4 Love , 6 4 Marisa Miller , 7 4 Gregory Colbert , 8 4 Sebastian Vettel , 9 4 Fasting , 10 4 Daniel Tosh , 11 4 Helen Thomas , 12 4 Wilhelm Reich , 13 4 Roger Ebert , 14 4 Monk (TV series) , 15 4 Doctor Who , 16 4 The Lion King , 17 4 List of films , 18 4 English proverbs , 19 4 Last words , 20 4 Pierre Trudeau , 21 4 Albert Einstein , 22 3 Jesus , 23 3 Philipp Melanchthon , 24 3 Ingeborg Refling Hagen , 25 3 Julian Assange

jul 2010: 1 7 Love , 2 7 Julian Assange , 3 7 Eleventh Doctor , 4 7 List of films , 5 5 Mallika Sherawat , 6 5 Psych (TV series) , 7 4 Health , 8 4 Ma Zhongying , 9 4 Jean-Baptiste Say , 10 4 Karl Bowman , 11 4 Arthur Laffer , 12 4 Melody (1971 film) , 13 4 It's a Mad, Mad, Mad, Mad World , 14 4 F. S. Flint , 15 4 Sarah Palin , 16 4 Daniel Tosh , 17 4 List of television shows , 18 4 Futurama , 19 4 Muhammad , 20 4 Che Guevara , 21 3 Religion , 22 3 Education , 23 3 Alcoholic beverages , 24 3 Belief , 25 3 George Washington

ago 2010: 1 9 Bob Dole , 2 7 Inception (film) , 3 7 Albert Einstein , 4 6 Last words , 5 6 Karl Marx , 6 5 House (TV series) , 7 5 List of television shows , 8 5 Bill Gates , 9 4 Abraham Lincoln , 10 4 Failure , 11 4 Emil Zátopek , 12 4 Dennis Skinner , 13 4 Nishapur , 14 4 Nigel Slater , 15 4 Wesley Willis , 16 4 Audrey Niffenegger , 17 4 Johann Gottfried Herder , 18 4 İsmail Enver , 19 4 Psych (TV series) , 20 4 The Simpsons/Season 6 , 21 4 Daniel Tosh , 22 4 Peter Pan (2003 film) , 23 4 Futurama , 24 4 The Matrix , 25 4 List of films

set 2010: 1 7 Love , 2 6 Konrad Lorenz , 3 6 Eleventh Doctor , 4 6 Søren Kierkegaard , 5 6 John Lennon , 6 5 The Big Bang Theory , 7 4 Politics , 8 4 Laughter , 9 4 Failure , 10 4 Jesus , 11 4 Ronald Knox , 12 4 Mike + The Mechanics , 13 4 Powder (film) , 14 4 Suhayl ibn Amr , 15 4 Angel Song , 16 4 Yo soy Bea , 17 4 Hans-Georg Gadamer , 18 4 Justin Bieber , 19 4 Hot Fuzz , 20 4 Psych (TV series) , 21 4 J. M. Coetzee , 22 4 Patrick Henry , 23 4 NCIS (TV series) , 24 4 Wikipedia , 25 4 The Hitchhiker's Guide to the Galaxy

out 2010: 1 10 Love , 2 7 Albert Einstein , 3 6 Religion , 4 6 Michael Crichton , 5 5 Freedom , 6 5 Jesus , 7 5 George Monck , 8 5 Georges Bernanos , 9 5 Christian de Duve , 10 5 Radicalism , 11 5 List of people by name, S , 12 5 The Big Bang Theory , 13 5 Final Fantasy , 14 5 List of films , 15 5 Mohandas Karamchand Gandhi , 16 5 Benjamin Franklin , 17 5 Ralph Waldo Emerson , 18 5 Aristotle , 19 4 Courage , 20 4 Charles Murray (author) , 21 4 Christine O'Donnell , 22 4 Todor Zhivkov , 23 4 Arthur Desmond , 24 4 Glee (TV series) , 25 4 The Hangover

nov 2010: 1 6 Yevgeniy Chazov , 2 6 Eleventh Doctor , 3 6 Friends (TV series) , 4 6 Albert Einstein , 5 5 Epifanio de los Santos , 6 5 Dan Patrick , 7 5 William A. Henry III , 8 5 William John Macquorn Rankine , 9 5 Snow Crash , 10 5 English proverbs , 11 4 History , 12 4 Alex Agase , 13 4 Timothy Ferriss , 14 4 Ben Stiller , 15 4 Kris Kristofferson , 16 4 Agis IV , 17 4 Robert Hayne , 18 4 List of people by name, B , 19 4 Glee (TV series) , 20 4 Thomas Jefferson , 21 4 Tenth Doctor , 22 4 How I Met Your Mother , 23 4 Bruce Lee , 24 4 Ayn Rand , 25 4 List of films

dez 2010: 1 7 Douglas Adams , 2 6 Fred Perry , 3 6 Tangled , 4 6 The Big Bang Theory , 5 5 Glee (TV series) , 6 5 Henry Kissinger , 7 5 Joseph Stalin , 8 5 List of television shows , 9 5 John F. Kennedy , 10 5 Last words , 11 5 Anonymous , 12 5 Bertrand Russell , 13 4 Abraham Lincoln , 14 4 Journalism , 15 4 Friendship , 16 4 Françoise Sagan , 17 4 Australia , 18 4 Psych (TV series) , 19 4 Jimmy Wales , 20 4 John Adams , 21 4 William Cowper , 22 4 Jimmy Carter , 23 4 The Lion King , 24 4 George Orwell , 25 4 Wikiquote

jan 2011: 1 8 List of films , 2 5 Abraham Lincoln , 3 5 United States , 4 5 Quarantine (film) , 5 5 Dan Aykroyd , 6 5 The Wizard of Oz , 7 4 Conspiracy , 8 4 George Washington , 9 4 Bartolomeo Vanzetti , 10 4 Steve Maraboli , 11 4 Hostel: Part II , 12 4 A Night at the Opera (film) , 13 4 Don Cherry , 14 4 Julian Assange , 15 4 Sherlock Holmes (2009 film) , 16 4 Eleventh Doctor , 17 4 Saw VI , 18 4 Daniel Tosh , 19 4 Tenth Doctor , 20 4 How I Met Your Mother , 21 4 Chess , 22 4 Franklin D. Roosevelt , 23 4 Mohandas Karamchand Gandhi , 24 3 Truth , 25 3 Love

fev 2011: 1 7 Thomas Jefferson , 2 7 List of films , 3 6 The Big Bang Theory , 4 5 Hosni Mubarak , 5 5 Justin Bieber , 6 5 Eleventh Doctor , 7 4 Homi J. Bhabha , 8 4 Ziaur Rahman , 9 4 Namboku Mizuno , 10 4 John Pilger , 11 4 Anders Fogh Rasmussen , 12 4 Millennium '73 , 13 4 Community (TV series) , 14 4 The Simpsons/Season 3 , 15 4 How I Met Your Mother , 16 4 Glenn Beck , 17 4 English proverbs , 18 4 Benjamin Franklin , 19 4 Bill Gates , 20 4 Albert Einstein , 21 3 Law , 22 3 George Washington , 23 3 Jocelyn Bell Burnell , 24 3 2011 Libyan civil war , 25 3 Hetalia - Axis Powers

mar 2011: 1 8 Charlie Sheen , 2 8 List of films , 3 6 Eleventh Doctor , 4 6 Albert Einstein , 5 5 Love , 6 5 Allen West (politician) , 7 5 Rex Ryan , 8 5 30 Rock , 9 5 Tenth Doctor , 10 5 Ninth Doctor , 11 5 Franklin D. Roosevelt , 12 5 Mohandas Karamchand Gandhi , 13 5 English proverbs , 14 5 Winston Churchill , 15 4 God , 16 4 Christianity , 17 4 Jesus , 18 4 Tim Powers , 19 4 Whose Line Is It Anyway? , 20 4 Simon van der Meer , 21 4 Sarah Palin , 22 4 Muammar Gaddafi , 23 4 Criminal Minds , 24 4 House (TV series) , 25 4 Wikipedia

abr 2011: 1 14 Eleventh Doctor , 2 9 Portal 2 , 3 7 Portal (game) , 4 6 How I Met Your Mother , 5 6 Albert Einstein , 6 5 Abraham Lincoln , 7 5 The Big Bang Theory , 8 5 Thomas Jefferson , 9 5 Coming to America , 10 5 Dylan Moran , 11 5 Donald Trump , 12 5 List of television shows , 13 5 Leonardo da Vinci , 14 5 Franklin D. Roosevelt , 15 4 Opinion , 16 4 Edgar Zilsel , 17 4 Poles , 18 4 Charles Sumner , 19 4 Henry Schriver , 20 4 Judah Loew ben Bezalel , 21 4 Henry S. Haskins , 22 4 F. J. Duarte , 23 4 John Elkann , 24 4 Milla Jovovich , 25 4 Bones (TV series)

mai 2011: 1 15 Eleventh Doctor , 2 8 Osama bin Laden , 3 7 Portal 2 , 4 5 Abraham Lincoln , 5 5 The Big Bang Theory , 6 5 Barack Obama , 7 4 Thomas D'Arcy McGee , 8 4 Judy LaMarsh , 9 4 Ajaib Singh , 10 4 Viola Spolin , 11 4 Manmohan Acharya , 12 4 Derren Brown , 13 4 John James Audubon , 14 4 Revolution , 15 4 Kissing , 16 4 Glee (TV series) , 17 4 In Plain Sight , 18 4 Ninth Doctor , 19 4 How I Met Your Mother , 20 4 NCIS (TV series) , 21 4 The Catcher in the Rye , 22 4 List of television shows , 23 4 List of films , 24 4 English proverbs , 25 4 Leo Tolstoy

jun 2011: 1 10 Eleventh Doctor , 2 6 Mohandas Karamchand Gandhi , 3 6 Richard Nixon , 4 5 Kurien Kunnumpuram , 5 5 Time , 6 5 Ninth Doctor , 7 5 List of films , 8 5 English proverbs , 9 4 Ken Robinson , 10 4 Larry LeSueur , 11 4 X-Men: First Class , 12 4 Ta-Nehisi Coates , 13 4 Health , 14 4 Portal 2 , 15 4 Phineas and Ferb , 16 4 Tenth Doctor , 17 4 Pokémon , 18 4 Duke Nukem , 19 4 Thomas Carlyle , 20 4 Mark Twain , 21 4 Aristotle , 22 4 Albert Einstein , 23 3 Valya Dudycz Lupescu , 24 3 Jean Chrétien , 25 3 Bugonia

jul 2011: 1 5 Helmut Newton , 2 5 Jagadguru Rāmabhadrācārya , 3 5 John H. Disher , 4 5 Ronald Reagan , 5 5 English proverbs , 6 4 Harry Potter and the Deathly Hallows – Part 2 , 7 4 Vivian Stanshall , 8 4 Dawud Wharnsby , 9 4 The Virginian , 10 4 Phineas and Ferb , 11 4 Back to the Future , 12 4 Muhammad , 13 4 List of films , 14 4 List of people by name , 15 4 Douglas Adams , 16 3 Eleanor H. Porter , 17 3 Dominicus Corea , 18 3 Mario television series , 19 3 George Woodcock , 20 3 Rufus Wainwright , 21 3 The Wisdom of W.E.B. Du Bois , 22 3 Alexandre Christoyannopoulos , 23 3 Benny Hill , 24 3 John Allen Fraser , 25 3 Nikolai Berdyaev

ago 2011: 1 9 Eleventh Doctor , 2 5 Jack Layton , 3 5 A.C. Cuza , 4 5 Albert Einstein , 5 4 Kelsang Gyatso , 6 4 Ravi Gomatam , 7 4 Edmund Cooper , 8 4 Breaking Bad , 9 4 Bill Hicks , 10 4 Winston Churchill , 11 3 Peter Dicken , 12 3 H. M. Tomlinson , 13 3 Calgacus , 14 3 Hayley Williams , 15 3 Kerry Ellis , 16 3 Final Destination 5 , 17 3 Jimmy Quillen , 18 3 Sidney Hillman , 19 3 Philip Murray , 20 3 Lucian Truscott , 21 3 David Wood (philosopher) , 22 3 Ian Brown , 23 3 Henry VII of England , 24 3 Nicolae Paulescu , 25 3 The Good Guys

set 2011: 1 10 Agnosticism , 2 9 Oscar Wilde , 3 7 Eleventh Doctor , 4 6 Albert Einstein , 5 5 Amos Bronson Alcott , 6 5 The Big Bang Theory , 7 5 Hannah Montana , 8 4 Joe Kehoskie , 9 4 Martha Gellhorn , 10 4 Nycole Turmel , 11 4 Marriage , 12 4 Education , 13 4 How I Met Your Mother , 14 4 Ayn Rand , 15 4 List of films , 16 4 English proverbs , 17 3 Person of Interest (TV series) , 18 3 John Joseph Griffin , 19 3 Stedman Graham , 20 3 Frederic G. Kenyon , 21 3 Nur Muhammad Taraki , 22 3 Patrick Kavanagh , 23 3 Rozen Maiden , 24 3 Halvard Lange , 25 3 Sarah Seltzer

out 2011: 1 14 Steve Jobs , 2 9 Eleventh Doctor , 3 6 Abraham Lincoln , 4 6 Jesus , 5 6 Big Time Rush , 6 6 Muammar Gaddafi , 7 6 Albert Einstein , 8 5 Love , 9 5 Life , 10 5 The Angry Video Game Nerd , 11 5 Gautama Buddha , 12 4 Philip Morrison , 13 4 Adolf Hitler's religious views , 14 4 Dennis Ritchie , 15 4 Mozi , 16 4 Sebastian de Grazia , 17 4 T S Satyan , 18 4 Leo Babauta , 19 4 Religion , 20 4 William Shakespeare , 21 4 George Washington , 22 4 My Best Friend's Wedding , 23 4 Allen Ginsberg , 24 4 SpongeBob SquarePants , 25 4 Joseph Stalin

nov 2011: 1 11 Merlin Mann , 2 6 Advertising slogans , 3 6 Bill Gates , 4 5 God , 5 5 Martin Luther , 6 5 List of television shows , 7 5 Albert Einstein , 8 4 Arlo Guthrie , 9 4 Frederick Brotherton Meyer , 10 4 Pimp C , 11 4 Bushwick Bill , 12 4 Michael von Faulhaber , 13 4 Once Upon a Time (TV series) , 14 4 Abraham Lincoln , 15 4 Hell , 16 4 Growth , 17 4 Glee (TV series) , 18 4 The Nostalgia Critic , 19 4 Eminem , 20 4 House (TV series) , 21 4 Pokémon , 22 4 Charles Darwin , 23 4 Steve Jobs , 24 4 Joseph Stalin , 25 4 List of films

dez 2011: 1 8 Christopher Hitchens , 2 7 Václav Havel , 3 6 Call of Duty: Modern Warfare 3 , 4 6 English proverbs , 5 5 War , 6 5 Love , 7 5 Wikipedia , 8 5 Gautama Buddha , 9 4 Hans Küng , 10 4 Dhirubhai Ambani , 11 4 World War III , 12 4 Ma Anand Sheela , 13 4 Life , 14 4 God , 15 4 Friendship , 16 4 Epitaphs , 17 4 Community (TV series) , 18 4 Anthony Trollope , 19 4 Jean-Luc Picard , 20 4 Steve Jobs , 21 4 Georg Wilhelm Friedrich Hegel , 22 4 Friedrich Nietzsche , 23 3 Hometown , 24 3 Hal Norby , 25 3 Carmine Crocco

jan 2012: 1 9 Albert Einstein , 2 7 List of films , 3 6 Rocky Marciano , 4 5 Josette Sheeran , 5 5 Anaximander , 6 5 Quotations , 7 5 The Nostalgia Critic , 8 5 Lil Wayne , 9 5 Muhammad Ali , 10 5 English proverbs , 11 4 Marjorie Boulton , 12 4 Gustavo Gutierrez , 13 4 Charles Scott Sherrington , 14 4 Dmitri Mendeleev , 15 4 John Cassian , 16 4 Z-Ro , 17 4 Ludwig Hohl , 18 4 Eazy-E , 19 4 Ludacris , 20 4 Nonsense , 21 4 War , 22 4 Love , 23 4 Sherlock (TV series) , 24 4 The Big Bang Theory , 25 4 Victory

fev 2012: 1 5 Ram Dass , 2 5 Ruth Nanda Anshen , 3 5 Candles , 4 5 Joan Maragall , 5 5 Johan Cruyff , 6 5 Josh Homme , 7 5 Rick Santorum , 8 5 List of films , 9 5 Albert Einstein , 10 4 Keiji Nishitani , 11 4 Total Drama Island , 12 4 Erma Bombeck , 13 4 Sheldon Wolin , 14 4 Paul de Lagarde , 15 4 Nastassja Kinski , 16 4 Tarja Halonen , 17 4 Lewis Gordon Pugh , 18 4 Religion , 19 4 Heaven , 20 4 Sherlock (TV series) , 21 4 Victorious , 22 4 On Writing , 23 4 How I Met Your Mother , 24 4 Earth , 25 4 Newt Gingrich

mar 2012: 1 6 Last words , 2 6 Albert Einstein , 3 5 The Lorax (film) , 4 5 Patrick Henry , 5 5 Dr. Seuss , 6 5 Mohandas Karamchand Gandhi , 7 5 Ronald Reagan , 8 5 René Descartes , 9 4 Marilyn Frye , 10 4 Meles Zenawi , 11 4 Howard Thurman , 12 4 Rahul Dravid , 13 4 The Happening (2008 film) , 14 4 Love , 15 4 Eleventh Doctor , 16 4 Star Wars Episode IV: A New Hope , 17 4 Tenzin Gyatso, 14th Dalai Lama , 18 4 Leonardo da Vinci , 19 4 List of misquotations , 20 4 Mark Twain , 21 3 The Hunger Games , 22 3 Pedantry , 23 3 Charles H. Fernald , 24 3 Ronald J. Garan, Jr. , 25 3 Republic: A Novel of America's Future

abr 2012: 1 6 The Hunger Games (film) , 2 5 The Big Bang Theory , 3 5 Muammar Gaddafi , 4 4 Ernesto Grassi , 5 4 Herta Müller , 6 4 Piper Laurie , 7 4 My Little Pony: Friendship is Magic , 8 4 Community (TV series) , 9 4 How I Met Your Mother , 10 4 Incorrect predictions , 11 4 Little Richard , 12 4 The Lion King , 13 4 The Matrix , 14 4 English proverbs , 15 4 Albert Einstein , 16 3 In the Bedroom , 17 3 Boyd K. Packer , 18 3 Johannes Brahms , 19 3 Manav Gupta , 20 3 William Feller , 21 3 Dick Clark , 22 3 Aki Kaurismäki , 23 3 Constantine II of Greece , 24 3 Evagrius Ponticus , 25 3 Mizo proverbs

mai 2012: 1 15 The Avengers (2012 film) , 2 7 Abraham Lincoln , 3 7 Jesus , 4 7 Muammar Gaddafi , 5 7 George Bernard Shaw , 6 5 Vanna Bonta , 7 5 Star Wars Episode VI: Return of the Jedi , 8 5 Patrick Henry , 9 5 George Orwell , 10 4 Penelope Fitzgerald , 11 4 Jeff Beck , 12 4 African proverbs , 13 4 Serbia , 14 4 Rob Ford , 15 4 Hubert Selby, Jr. , 16 4 Augusto Boal , 17 4 George Washington , 18 4 The Big Bang Theory , 19 4 Werner Erhard , 20 4 Family , 21 4 Not Another Teen Movie , 22 4 Pokémon , 23 4 Morality , 24 4 Rudyard Kipling , 25 4 List of television shows

jun 2012: 1 6 List of films , 2 5 John Varley , 3 5 Eleventh Doctor , 4 5 Ray Bradbury , 5 5 English proverbs , 6 4 Transparency , 7 4 Roger Haight , 8 4 Sultan bin Salman bin Abdul-Aziz Al Saud , 9 4 Sister Nivedita , 10 4 Dejan Stojanovic , 11 4 Prometheus (film) , 12 4 Albert Memmi , 13 4 John M. Rodgers , 14 4 Faith , 15 4 New York City , 16 4 Hawaii Five-0 , 17 4 Werner Erhard , 18 4 Tenth Doctor , 19 4 Atheism , 20 4 Bobby Fischer , 21 4 Stan Lee , 22 4 Mohandas Karamchand Gandhi , 23 4 Albert Einstein , 24 3 Christopher Wood (writer) , 25 3 LeBron James

jul 2012: 1 13 The Dark Knight Rises , 2 5 Jerzy Vetulani , 3 5 David Bomberg , 4 5 Wilson Harris , 5 5 God , 6 5 Carl Sagan , 7 5 Albert Einstein , 8 4 Leszek Kołakowski , 9 4 George Goodman , 10 4 Radio Télévision Libre des Mille Collines , 11 4 Richard Rohr , 12 4 Elizabeth May , 13 4 A Bridge Too Far (film) , 14 4 Rayner Heppenstall , 15 4 Chris Patten , 16 4 The Newsroom (U.S. TV series) , 17 4 Abraham Lincoln , 18 4 Barack Obama , 19 4 Thomas Henry Huxley , 20 4 Helen Keller , 21 4 Latin proverbs , 22 3 Organization , 23 3 Susan Cooper , 24 3 Jane Eyre (2011 film) , 25 3 2012 Aurora shooting

ago 2012: 1 12 The Dark Knight Rises , 2 10 List of television shows , 3 9 Mitt Romney , 4 7 Dragon Ball Z: Season 1 , 5 7 Barack Obama , 6 6 Evelyn Underhill , 7 6 The Avengers (2012 film) , 8 6 Supernatural (TV series) , 9 5 SummerSlam , 10 5 Daffy Duck , 11 5 The Hitchhiker's Guide to the Galaxy , 12 5 James Madison , 13 5 Karl Popper , 14 5 List of literary works , 15 5 Latin proverbs , 16 4 James Howard Kunstler , 17 4 Robert Adair (physicist) , 18 4 V. V. S. Laxman , 19 4 Aramaic proverbs , 20 4 Dan Millman , 21 4 Eek! the Cat , 22 4 Eddie Cantor , 23 4 Gurren Lagann , 24 4 Chernobyl disaster , 25 4 Norodom Sihanouk

set 2012: 1 12 Eleventh Doctor , 2 10 Dragon Ball Z: Season 6 , 3 7 American Pie Presents: The Naked Mile , 4 7 Albert Einstein , 5 6 Dragon Ball: General Blue Saga , 6 6 Dragon Ball , 7 6 Mitt Romney , 8 6 Terence McKenna , 9 5 Robert Greene (American author) , 10 5 Camilla, Duchess of Cornwall , 11 5 Religion , 12 5 Dragon Ball: Commander Red Saga , 13 5 Dragon Ball: Tournament Saga , 14 5 Dragon Ball GT: Season 2 , 15 5 The Sopranos: Season 3 , 16 5 Dragon Ball Z: Season 4 , 17 5 Ysabella Brave , 18 5 Dragon Ball GT , 19 5 English proverbs , 20 4 Stella Gibbons , 21 4 Linh Nga , 22 4 Kirby Page , 23 4 Stella Adler , 24 4 Dragon Ball: Piccolo Jr. Saga , 25 4 Dragon Ball: Tien Shinhan Saga

out 2012: 1 7 Albert Einstein , 2 6 Con Houlihan , 3 6 Thomas Jefferson , 4 6 English proverbs , 5 5 Salman Khan , 6 5 Lewis H. Morgan , 7 5 A History of the Warfare of Science with Theology in Christendom , 8 5 Education , 9 5 NCIS (TV series) , 10 5 Mitt Romney , 11 5 Last words , 12 4 Farah Pahlavi , 13 4 MediaWiki , 14 4 Walter Raleigh (professor) , 15 4 Derek Jeter , 16 4 Andrei Zhdanov , 17 4 Punjabi proverbs , 18 4 Cloud Atlas (film) , 19 4 Juhani Pallasmaa , 20 4 English proverbs (alphabetically by proverb) , 21 4 Death , 22 4 Dragon Ball: Piccolo Jr. Saga , 23 4 Dragon Ball: Tien Shinhan Saga , 24 4 Dragon Ball: Commander Red Saga , 25 4 Michelle Obama

nov 2012: 1 6 Barack Obama , 2 6 List of television shows , 3 6 List of films , 4 6 English proverbs , 5 5 Chris Colfer , 6 5 Richard T. Ely , 7 5 Love , 8 5 The Big Bang Theory , 9 5 Thomas Paine , 10 5 Albert Einstein , 11 4 Patrice O'Neal , 12 4 William Gilbert (astronomer) , 13 4 Hipponax , 14 4 William Luther Pierce , 15 4 Klemens von Metternich , 16 4 Isaac Deutscher , 17 4 Sleeper (1973 film) , 18 4 Eduard Pestel , 19 4 Mihajlo D. Mesarovic , 20 4 The Librarian: Curse of the Judas Chalice , 21 4 Salman al-Ouda , 22 4 Liam Hemsworth , 23 4 Justin Bieber , 24 4 Last words in Disney animated films , 25 4 Software

dez 2012: 1 15 Rise of the Guardians , 2 7 Eleventh Doctor , 3 7 Albert Einstein , 4 5 Elizabeth Stuart Phelps Ward , 5 5 Marlene Dietrich , 6 5 Isoroku Yamamoto , 7 5 List of films , 8 4 Kip McKean , 9 4 The Wild One , 10 4 Arnold Lunn , 11 4 Sandy Hook Elementary School shooting , 12 4 Elizabeth Drew Stoddard , 13 4 Alice Meynell , 14 4 Diederik Stapel , 15 4 Edward Higgins White , 16 4 Matilda (film) , 17 4 How I Met Your Mother , 18 4 Ronald Reagan , 19 4 Henry Miller , 20 4 Chinese proverbs , 21 3 James Grant Wilson , 22 3 The Monkees , 23 3 The Odd Couple (film) , 24 3 David Cronenberg , 25 3 Ronnie Radke

jan 2013: 1 7 Religion , 2 6 Michael Dummett , 3 6 Men in Black (film) , 4 5 Henry Gee , 5 5 The Dark Knight Rises , 6 5 The Big Bang Theory , 7 5 Thomas Jefferson , 8 5 How I Met Your Mother , 9 5 Bertrand Russell , 10 4 Gottlob Frege , 11 4 Aaron Swartz , 12 4 Welcome to the N.H.K. , 13 4 Norman Maclean , 14 4 Zakir Naik , 15 4 R. P. Blackmur , 16 4 Dane Clark , 17 4 S. M. Krishna , 18 4 Ibn Saud , 19 4 Eugene M. Kulischer , 20 4 Zine El Abidine Ben Ali , 21 4 Haj Amin al-Husseini , 22 4 Wreck-It Ralph , 23 4 Catalan proverbs , 24 4 Hell's Kitchen (uncensored) , 25 4 Men in Black II

fev 2013: 1 11 Rise of the Guardians , 2 6 Fausto Cercignani , 3 6 Jesus , 4 6 The Dark Crystal , 5 6 Phineas and Ferb , 6 6 Prep , 7 6 Charles Darwin , 8 6 Thomas and Friends , 9 5 Roy E. Disney , 10 5 Jussi Halla-aho , 11 5 Marcin Malek , 12 5 Love , 13 5 The Big Bang Theory , 14 5 Men in Black II , 15 5 War of the Worlds (2005 film) , 16 5 Richard Feynman , 17 5 Terminator 2: Judgment Day , 18 5 List of films , 19 5 Aristotle , 20 4 Malcolm Azania , 21 4 Carole Morin , 22 4 Hafizullah Amin , 23 4 Nguyen Khanh , 24 4 Psy , 25 4 Pac-Man (TV Series)

mar 2013: 1 10 List of films , 2 6 Hell's Kitchen (uncensored) , 3 6 Hugo Chávez , 4 5 Ernest Dimnet , 5 5 How I Met Your Mother , 6 5 Thomas and Friends , 7 5 Bertrand Russell , 8 4 Zheng Yuanjie , 9 4 Evalyn Gates , 10 4 Bassel Khartabil , 11 4 Pope Francis , 12 4 R. K. Narayan , 13 4 Dagobert von Gerhardt , 14 4 T'ao Ch'ien , 15 4 Education , 16 4 The Dark Crystal , 17 4 Censorship , 18 4 List of television shows , 19 4 Guns , 20 4 John F. Kennedy , 21 4 English proverbs , 22 4 Linus Torvalds , 23 4 George Carlin , 24 3 Val Kilmer , 25 3 Anti-intellectualism

Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Terça-feira, 23 de abril 2013 20:56

Dump file enwikiquote-20130405-pages-meta-history.xml.7z (full dump), size 226 Mb as 7z -> 54 Gb
Dump processed till Mar 31, 2013, on server stat1, ready at Wed-10/04/2013-00:53 after 45 min, 23 sec.

Versão do script:2.6
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.