Estatísticas da Wikiquote persa

Zoom           
 
January 2014: Unfortunately monthly database dump generation is delayed for many wikis. Reports will appear later than usual. Our sincere apologies for any inconvenience caused.
Upd. March 2: Dump generation was restarted on February 12. All dumps are up to date now for December, some not for January, some days to go. This is an intermediate update.

Metrics have been collected from a full archive dump, which contains all revisions of every article, meta data and raw content.
See also metrics definitions


 
Monthly counts & Quarterly rankings: janeiro 2015
 
DataWikiquotariansArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
jan 2015+1%   0%   +96%-1%-1%-1%0%+1%-3%0%
dez 20140%   0%   -42%0%0%0%0%0%0%0%
nov 20140%   0%   -68%0%0%0%0%0%0%-0%
out 2014+1%   +3%   -49%+2%+2%+1%0%0%+6%0%
set 2014+1%   +8%   +94%+3%+3%+2%+1%+1%+11%0%
ago 2014+3%   +2%   -49%-1%-1%+1%+1%0%+2%0%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
jan 201515024 4,0 k 10150614311 Mb1,2 M21 k2,4 k3243,3 k345
dez 2014148 4 3,9 k 9,915247312 Mb1,2 M21 k2,4 k3203,4 k345
nov 2014148 7 3,9 k 9,9152312612 Mb1,2 M21 k2,4 k3203,4 k345
out 20141482713,9 k49,9152338912 Mb1,2 M21 k2,4 k3193,4 k346
set 20141461613,8 k910,1154876411 Mb1,2 M21 k2,4 k3183,2 k346
ago 201414548 3,5 k210,7162939311 Mb1,1 M20 k2,3 k3162,9 k346
jul 20141411613,5 k910,8167777011 Mb1,2 M20 k2,3 k3152,9 k345
jun 201414014 3,2 k 11,5171950410 Mb1,1 M19 k2,2 k3132,5 k346
mai 20141393923,2 k1111,4171896810 Mb1,1 M19 k2,2 k3092,5 k345
abr 20141362922,8 k912,418662,5 k10 Mb1,0 M19 k2,2 k3102,0 k345
mar 20141341722,6 k712,819181,0 k9,6 Mb971 k18 k13 k2591,7 k343
fev 20141332432,3 k213,520246819,3 Mb942 k18 k12 k2431,6 k344
jan 20141311612,3 k413,520508509,2 Mb933 k17 k12 k2381,5 k347
dez 20131301522,2 k413,920997528,9 Mb905 k16 k12 k2401,3 k347
nov 2013129 312,0 k614,321535938,6 Mb876 k15 k11 k2051,2 k352
out 2013129 411,9 k115,524252788,8 Mb893 k15 k10 k1971,2 k357
set 20131291311,8 k115,524355308,7 Mb888 k15 k10,0 k1441,1 k357
ago 20131282831,8 k415,524459978,6 Mb878 k14 k9,3 k1261,1 k357
jul 201312627 1,7 k115,925391838,5 Mb855 k14 k9,1 k117963361
jun 201312446 1,7 k 1625692098,4 Mb850 k14 k9,1 k117953361
mai 201312038 1,7 k 1625621238,4 Mb844 k14 k9,0 k117943361
abr 201311724 1,7 k115,925611698,4 Mb843 k14 k9,0 k117944361
mar 201311522 1,6 k11625571368,3 Mb831 k14 k9,0 k116924361
fev 201311313 1,6 k 16,12545968,1 Mb819 k14 k9,0 k115912360
jan 201311226 1,6 k 16,125542538,1 Mb817 k14 k9,0 k115915360
dez 201211024 1,6 k 1624821067,9 Mb789 k14 k8,8 k114909357
nov 2012108 1 1,6 k 162480747,9 Mb785 k14 k8,8 k114884357
out 201210812 1,6 k 1624871167,9 Mb785 k14 k8,8 k114879357
set 201210711 1,6 k11624791787,8 Mb778 k14 k8,8 k114879357
ago 201210614 1,6 k116,224971797,8 Mb773 k14 k8,7 k114873357
jul 201210516 1,5 k 16,225182837,7 Mb770 k14 k8,7 k114846356
jun 201210413 1,5 k 16,125211617,7 Mb767 k14 k8,7 k114841356
mai 201210315 1,5 k 16,225352197,6 Mb763 k13 k8,5 k115836356
abr 201210226 1,5 k116,225352667,5 Mb756 k13 k8,5 k111811356
mar 20121002311,5 k 16,225592947,5 Mb754 k13 k8,4 k109793355
fev 20129812 1,5 k 16,125801597,5 Mb757 k13 k8,3 k109794357
jan 20129714 1,5 k 1625731487,5 Mb754 k13 k8,3 k109794357
dez 20119628 1,5 k 1625811497,4 Mb752 k13 k8,2 k109784360
nov 20119436 1,5 k 1624911667,2 Mb720 k13 k8,2 k109776360
out 20119112 1,5 k 15,924572237,0 Mb707 k13 k8,2 k110767360
set 20119014 1,5 k 15,824571257,0 Mb706 k13 k8,0 k110768360
ago 20118912 1,5 k 15,824601337,0 Mb704 k13 k8,0 k110757359
jul 201188 1 1,5 k 15,724481527,0 Mb701 k13 k7,9 k110758358
jun 20118823 1,5 k 15,624351316,9 Mb696 k13 k7,8 k109744349
mai 20118614 1,4 k 15,624281146,9 Mb691 k13 k7,8 k110737347
abr 201185 5 1,4 k 15,524202046,8 Mb686 k13 k7,8 k110733347
mar 20118538 1,4 k115,524185806,8 Mb681 k13 k7,7 k110725347
fev 2011823711,4 k315,423836786,6 Mb658 k13 k7,5 k92685324
jan 2011794931,3 k315,923978716,3 Mb619 k13 k7,5 k37640260
dez 201075 2 1,2 k 16,524484606,0 Mb581 k12 k7,2 k7602226
nov 20107525 1,2 k 16,224332256,0 Mb576 k12 k7,2 k10574226
out 20107337 1,2 k 16,124361775,9 Mb572 k12 k7,1 k9566221
set 20107057 1,2 k11624302815,9 Mb569 k12 k7,0 k9548220
ago 20106517 1,2 k 1624157225,7 Mb559 k12 k7,0 k6521216
jul 20106445 1,2 k 15,623721785,6 Mb539 k12 k6,9 k5493209
jun 20106015 1,2 k 15,623771215,5 Mb537 k12 k6,9 k5488209
mai 20105917 1,1 k 15,623451575,4 Mb524 k12 k6,8 k5479208
abr 20105814 1,1 k 15,623442235,4 Mb520 k12 k6,8 k5425208
mar 201057 5 1,1 k 15,523822205,3 Mb524 k12 k6,7 k4412206
fev 20105747 1,1 k115,624022265,3 Mb521 k12 k6,6 k4400207
jan 201053 5 1,1 k 15,623893445,2 Mb510 k12 k6,5 k4393205
dez 20095324 1,1 k 15,423151935,0 Mb487 k12 k6,5 k4377204
nov 20095114 1,1 k 15,423132354,9 Mb483 k12 k6,4 k4377204
out 200950 4 1,1 k115,322635154,8 Mb468 k12 k6,4 k4343201
set 20095027 1,0 k115,222262724,6 Mb449 k12 k6,1 k4316199
ago 20094817 1,0 k 15,322431,0 k4,5 Mb440 k12 k6,0 k3299196
jul 20094716 1,0 k214,421752004,4 Mb423 k12 k5,9 k137277196
jun 200946 3 940115,222891574,3 Mb417 k11 k5,9 k138261196
mai 20094625 920115,423302624,2 Mb415 k11 k5,9 k137260194
abr 200944 6 893 15,523893004,2 Mb413 k11 k5,8 k139256213
mar 200944151882 15,423914934,2 Mb407 k11 k5,7 k139254212
fev 200943371867115,123834394,1 Mb398 k11 k5,6 k138238195
jan 20094015 836115,124072314,0 Mb388 k11 k5,5 k134214172
dez 200839141812 15,324483063,9 Mb383 k11 k5,5 k134212171
nov 200838 4 800 15,124581473,9 Mb379 k11 k5,3 k134200164
out 20083816 791 15,124511733,8 Mb374 k11 k5,3 k135193160
set 20083717 78311524752483,8 Mb374 k11 k5,2 k135192157
ago 200836172755315,324924223,7 Mb364 k10 k5,1 k134171154
jul 200835 7 672116,527291793,6 Mb355 k9,9 k4,8 k129168139
jun 20083525 650 16,827621403,5 Mb347 k9,8 k4,8 k127162139
mai 200833271639216,927665673,5 Mb342 k9,7 k4,7 k125149134
abr 200831272585117,528176473,2 Mb318 k8,7 k4,6 k114107131
mar 200829 5 551 17,428082233,0 Mb299 k7,7 k4,3 k10990132
fev 200829 41546117,128126033,0 Mb297 k7,7 k4,2 k10887130
jan 200829372518116,927298272,8 Mb273 k6,6 k4,2 k10085129
dez 200726481479 16,526654972,5 Mb246 k5,5 k4,0 k9268110
nov 200722 4 466 15,926381192,4 Mb238 k4,9 k3,9 k8667109
out 200722131459 15,926949302,4 Mb239 k4,9 k3,9 k8565109
set 200721151444114,426579322,3 Mb228 k4,2 k3,6 k7355109
ago 200720 51423 12,925686592,1 Mb210 k3,4 k2,7 k4154104
jul 200720261412111,624599112,0 Mb196 k3,1 k2,5 k3042102
jun 200718 2139119,922591851,7 Mb171 k1,6 k2,4 k203999
mai 200718 31375 9,822471951,6 Mb164 k1,5 k2,3 k123897
abr 20071814 36919,522102761,6 Mb158 k1,4 k2,3 k113892
mar 200717 2135119,222052601,5 Mb150 k1,3 k2,2 k103189
fev 200717 1 335 8,822141201,5 Mb143 k1,2 k2,1 k103182
jan 200717 2 331 8,621751591,4 Mb139 k1,2 k2,1 k103180
dez 20061713 319 8,421231791,3 Mb131 k1,1 k2,0 k103077
nov 20061635 314 820881441,3 Mb127 k1,1 k1,9 k102974
out 200613 31303 7,820901991,2 Mb123 k1,1 k1,9 k102772
set 200613 51291 7,420252971,2 Mb115 k9781,8 k92269
ago 20061313128416,61729205985 kb96 k8551,6 k91961
jul 20061236226816,21555511847 kb83 k7951,5 k81661
jun 20069 2122415,11285191642 kb59 k4688767429
mai 20069121186 5,11198163544 kb43 k2088344323
abr 2006812 17614,51114129402 kb37 k1867224220
mar 2006713 15914,21051182324 kb32 k1655813 17
fev 2006612 12014131089304 kb29 k1664441 11
jan 20065 1 99 4152349290 kb28 k1654131 7
dez 20055 1 86 4176141284 kb28 k1653671 6
nov 2005523 71 4,3200887265 kb27 k1602681 4
out 20053 1 60 3,6223721248 kb25 k1572231 3
set 2005312 60 3,2221744243 kb25 k1281971 2
ago 20052   47 3,227665236 kb24 k1251521 1
jul 20052 1 4513,2288687236 kb24 k1251521 1
jun 20052 2 17 3,4737526225 kb23 k86134   
mai 20052   7 4,6176334221 kb23 k86133   
abr 20052 1 7 41762817220 kb23 k86133   
mar 2005211 4 2,81981410134 kb15 k8474   
fev 20051   1 1445 1,9 kb77 106 9 
jan 20051   1 1445 1,9 kb77 106 9 
dez 20041   1 1445 1,9 kb77 106 9 
nov 20041   1 1445 1,9 kb77 106 9 
out 20041   1 1445 1,9 kb77 106 9 
set 20041   1 1445 1,9 kb77 106 9 
ago 200411  1 144511,9 kb77 106 9 
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
The following table ranks this project in relation to projects in other languages with 1000+ articles
Note: data for month(s) after Dec 2014 for one or more large projects are not yet known.
As a temporary approximation missing data for a project are substituted by the highest historic value for that project.
Once those missing data are available final rankings for recent months can shift one or more positions.
out 201413810714321171211111313131049
jul 201413131191422015611111415141049
abr 201413151081511812811111416141349
jan 2014131512121851511911121418141549
out 2013131812819101071511121420161749
jul 20131391092191061511121525202149
abr 20131310131221101061711121525192049
jan 20131311131721151062511121525171949
out 20121316251721201062911121423171949
jul 2012131612152116961911131422171949
abr 201213914142010961811131422171749
jan 20121413131220121061811121222181749
out 20111416231220141062511131222171749
jul 20111419261320141062611131220171749
abr 20111421141020131062011121220171649
jan 20111568520686712121218251648
out 20101671282114761712131219351648
jul 201016713142115762112131219371748
abr 2010171713132012761412131019371848
jan 2010172213122016761312131020381848
out 2009172115201911861813141019381848
jul 200917171012186851513151019131948
abr 200918191214191719191612151018131948
jan 200918191413191218181712151019111848
out 200818131311191318181912151019111948
jul 200817241315221318182012151019111948
abr 20081811126241117171113151020122348
jan 2008199117241415151114151220122648
out 20072020181124181515814151420112548
jul 20072012131524141515713151422162748
abr 200720141415241515151615171719222648
jan 200719252513221813132116151816222448
out 200621201712221813131715151716212148
jul 200621101110221612121217171817202648
abr 200622122111241512121820212424234048
jan 2006272328172319992822212022234648
out 2005251916101913772417171618174348
jul 2005251619101911551513141618164248
abr 200522171672111442013121516104048
jan 20052614155329333037322517101346
out 20042321205258223228262397737
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100ediçõesbytes
 WikiquotariansArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikiquotarians (usuários registrados)
A = Wikiquotarians que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikiquotarians que editaram pelo menos dez vezes desde que chegaram
C = Wikiquotarians que contribuíram cinco vezes ou mais este mês
D = Wikiquotarians que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  5  10  100  1  3  5  10  25  100  5  10  100  1  3  5  10  25  100  250  5  10  100 
Monthly counts for recent history of wiki
jan 20152110442     85       1032       
dez 201418742      73311111 5         
nov 2014248721     62    111143     11 
out 201417117431     94321 11 12322211   
set 201419764211    134111 11 12332211   
ago 20142412876     72111 111104111     
jul 201417965211 1  811      94322     
jun 2014135422  11197521 11 102211  11 
mai 2014201195221 1  532      63211     
abr 201425129522212226411     145411  111
mar 2014211075421 1  84431    155511     
fev 201411444431    5332     9422      
jan 201422764311    821      125431     
dez 201322954422 11 8443     144221     
nov 201312632211 1  52111    143211  11 
out 20131674321     421      922       
set 201314433111 11 6211     85441     
ago 2013181186531 21 6411     622221    
jul 2013158742     43       10311      
jun 201315864   21 3        5      1  
mai 20131811841     62       92211     
abr 2013187421  11 42       10311   1  
mar 2013125211     1        10221      
fev 201395311     62    11 9321   11 
jan 2013187631  22 3     11 7      11 
Quarterly counts for entire history of wiki
jan 20152110442     85       1032       
out 201417117431     94321 11 12322211   
jul 201417965211 1  811      94322     
abr 201425129522212226411     145411  111
jan 201422764311    821      125431     
out 20131674321     421      922       
jul 2013158742     43       10311      
abr 2013187421  11 42       10311   1  
jan 2013187631  22 3     11 7      11 
out 201214322   22 5     11 62     11 
jul 2012187642  32 7321  11 952    11 
abr 2012179652  21 41    111411    2  
jan 20122494    22 41    1115      11 
out 201117521   22171    111911    11 
jul 20111641    11 31       722    11 
abr 2011198521  11 41       621       
jan 2011241296431 33 103332    116332  1  
out 201028874   11 5111     12111      
jul 2010176541  11 4        1         
abr 2010209431  32 311      83111     
jan 2010217522  11 21       72221  1  
out 2009136422  2225221     83221     
jul 2009218643  1  322      104311     
abr 2009199643  11 532      126533  111
jan 2009136532  22 3111     104321     
out 20081710621  11 411      85411     
jul 20081711742     511      72211  11 
abr 200813975421 22 104311    84442     
jan 2008151175321 11 95521    74221     
out 200712532111 22211222     112221     
jul 200712864111    533      432111    
abr 200797442     3111     53322     
jan 200752211     3111     43222     
out 2006853211     2221     32222     
jul 20061286542     93221    933221 11 
abr 2006106222     7331     6321      
jan 200652111     3111     211111 11 
out 20051111               11        
jul 200521111              11111  11 
abr 20051111      1        211111    
jan 2005                            
out 2004                            

 

Distribuição de edições de artigos por wikiquotarians
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikiquotariansEdições total
1819100.0%27,986100.0%
330837.6%27,17697.1%
1015118.4%26,26793.9%
32516.2%24,63288.0%
100232.8%23,24983.1%
316121.5%21,48476.8%
100050.6%17,72763.3%
316220.2%12,77845.7%

 

21 wikiquotarians recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions
agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
Sonia SevillaUC1 06,56238482set 10, 201016031,9081--
RAHA68UC3 02,027482249abr 30, 20121005851--
MahanUC14 02871581fev 16, 201434843---
CommonsDelinkerUC20 0129425-mai 13, 20072819----
ManimihanUC25+1822--out 22, 20141001---
محسن نامدارزادهUC38+754329--jun 28, 20142161---
امیرUC117+101312-mai 06, 201113651---
MDTDUC131...1212--jan 02, 20152811--
وهمنUC146...1111--jan 27, 2015311--
TiraniousUC162+10984--ago 23, 20091986----
AviowUC230+28612-ago 13, 20141701---
Connie.Carter88UC262+25353--nov 24, 201467----
Adel ensafiUC306+7441--jun 13, 2014231----
ΓεωργόςUC391...33--jan 11, 20151911--
SepantasobhUC392...33--jan 20, 201510----
ح-اكبريUC522...22--jan 11, 201519----
حامیUC523...22--jan 17, 201513----
Bache mahalUC816...11--jan 06, 201524----
FatemiUC817...11--jan 14, 201516----
Federico Leva (BEIC)UC818...11--jan 27, 20153----
YannUC819...11--jan 31, 2015 ----

 

20 wikiquotarians recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
AmouzandehUC26,216abr 11, 20063216mai 31, 20101705
SajadUC41,824mar 26, 20053597out 29, 201493
MardetanhaUC51,098ago 08, 20072732abr 02, 2014303
مهدیUC6706fev 05, 20092185jan 27, 2013733
JDiamondUC7662set 05, 20091973fev 01, 20111459
Jamal NazarethUC8652fev 01, 20111459abr 21, 20111380
TaranetUC9576jan 13, 20082574abr 01, 2014304
WayiranUC10445abr 24, 20082472mai 30, 20111341
BilijacksUC11396nov 16, 20062997abr 20, 2014285
SialkgraphUC12320jul 23, 2013556jul 31, 2014183
Ahura21UC13310mai 24, 20111347ago 14, 2014169
AbsdostanUC15150set 13, 20091965jan 02, 20121124
RabinsonUC16144out 11, 20082302jun 16, 20101689
ShervinafsharUC17137nov 11, 20053367dez 25, 2013401
Hard BackrestUC18132dez 31, 20082221abr 24, 2014281
SahimUC19132ago 04, 20101640jan 09, 20121117
MohandesWikiUC21123mar 25, 2014311dez 28, 201433
FollowerrUC22113jan 09, 20111482mai 11, 20111360
Mahnaz92UC23108jun 12, 2013597ago 06, 2013542
کافر مقدسUC2482ago 07, 2014176nov 06, 201485

 

usuários anônimos, ordenados por número de contribuições
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
85.185.1.4160
85.185.1.1462
217.219.137.1962
129.217.132.3649
2.186.172.13939
80.71.114.3533
31.58.225.15229
80.75.8.11427
217.219.12.13126
188.158.107.2626

No total 4.276 edições foram feitas por usuários anônimos, de um total de 39.324 edições ( 10e %)
  


30 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
AnankeBotUC11,350dez 18, 20082234set 16, 2013501--
TanhabotUC21,191abr 23, 20082473dez 08, 20101514--
ChtitBotUC3966set 08, 20072701fev 06, 20111454--
DexbotUC4673abr 08, 2014297abr 14, 2014291--
EleferenBotUC5464fev 13, 20101812jan 13, 2013747--
SahimrobotUC6412ago 14, 20101630ago 15, 20101629--
MohandesBotUC7372jun 02, 2014242jun 19, 2014225--
FaraBotUC8346out 11, 20072668out 11, 20072668--
KamikazeBotUC9259dez 17, 20101505dez 09, 20111148--
ArthurBotUC10157out 14, 20091934mar 31, 20111401--
MerlIwBotUC11133jul 26, 2012918jun 14, 2013595--
SamoaBotUC12125abr 09, 2014296abr 15, 2014290--
LaaknorBotUC13119out 23, 20082290jan 20, 2013740--
AvicBotUC1488ago 11, 20111268set 07, 20111241--
Idioma-botUC1582mar 02, 20111430jul 16, 2012928--
タチコマ robotUC1673dez 23, 20111134jan 26, 20154--
VolkovBotUC1752jun 30, 20092040abr 16, 20121019--
MjbmrbotUC1846fev 04, 20111456mar 27, 20111405--
JAnDbotUC1943ago 17, 2013531ago 28, 2013520--
CarsracBotUC2042mar 19, 20111413abr 15, 2013655--
DinybotUC2117mar 24, 20072869dez 16, 20072602--
Sir Nicholas de Lenfent BotUC2215abr 09, 20101757abr 19, 20101747--
FiriBotUC2313jan 09, 20111482jan 09, 20111482--
ChobotUC249dez 04, 2012787mar 13, 2013688--
KgsbotUC257dez 13, 20101509jan 18, 20111473--
AmolbotUC263dez 07, 20101515dez 07, 20101515--
EdwardsBotUC272jul 03, 20111307out 27, 201111911-
RezabotUC281out 18, 20111200out 18, 20111200--
AvocatoBotUC291abr 17, 20121018abr 17, 20121018--
AbotUC301nov 28, 2013428nov 28, 2013428--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110GifJpgPngSvg
jan 20154,3 k7741,7 k1041,5 k5901723      134370301
dez 20144,3 k7701,7 k1041,5 k5891723      59370301
nov 20144,3 k7661,7 k1041,5 k5891723      111370301
out 20144,3 k7571,7 k1041,5 k5891723      366370301
set 20144,2 k7451,7 k1041,5 k5251710      738370301
ago 20143,9 k7301,7 k1041,4 k4951704      326370301
jul 20143,8 k7231,7 k1041,4 k4771703      753370301
jun 20143,5 k7191,7 k1041,4 k4761677      108370301
mai 20143,5 k7111,7 k1011,4 k4551676      930368291
abr 20143,2 k7091,7 k1011,4 k4551663      1686368291
mar 20142,9 k7011,7 k1011,4 k4551656      1012368291
fev 20142,7 k6941,7 k1001,4 k4551644      665367291
jan 20142,7 k6871,7 k1001,4 k4501635      789367291
dez 20132,5 k6761,7 k1001,4 k4491623      728367291
nov 20132,4 k6711,7 k1001,4 k4491617      547367291
out 20132,2 k6641,7 k1001,4 k4411591      255367291
set 20132,2 k6581,7 k1001,4 k4411589      415367291
ago 20132,2 k6371,7 k991,4 k4401573      930366291
jul 20132,1 k6311,7 k971,4 k4271470      167364291
jun 20132,1 k6211,7 k961,4 k4271470      76364281
mai 20132,1 k6171,7 k961,4 k4261470      107364281
abr 20132,1 k6111,7 k961,4 k4261470      87364281
mar 20132,1 k6041,7 k961,4 k4241466      78364281
fev 20132,1 k5931,7 k961,4 k4241464      80364281
jan 20132,0 k5861,6 k961,4 k4241461      101364281
dez 20122,0 k5811,6 k961,4 k4241461      73364281
nov 20122,0 k5721,6 k951,4 k4241461      25363281
out 20122,0 k5681,6 k951,4 k4241460      49363281
set 20122,0 k5631,6 k951,4 k4241459      62363281
ago 20122,0 k5531,6 k951,4 k4241459      87363281
jul 20122,0 k5451,6 k951,4 k4241458      104363281
jun 20122,0 k5381,6 k951,4 k4231458      77363281
mai 20121,9 k5131,6 k951,4 k4231458      134363281
abr 20121,9 k5041,6 k941,4 k4231458      164362281
mar 20121,9 k4931,6 k941,4 k4231458      164362281
fev 20121,9 k4861,6 k941,4 k4231458      42362281
jan 20121,9 k4721,6 k941,4 k4211458      64362281
dez 20111,9 k4681,6 k941,4 k4211457      97362281
nov 20111,9 k4641,6 k941,4 k4191457      106362281
out 20111,9 k4481,6 k941,4 k4181455      40362281
set 20111,9 k4381,6 k941,4 k4161455      70362281
ago 20111,9 k4241,6 k941,4 k4141454      36362281
jul 20111,9 k4181,6 k941,4 k4121454      35362281
jun 20111,9 k4051,6 k941,4 k4121450      79362281
mai 20111,8 k3971,6 k941,4 k4121450      60362281
abr 20111,8 k3831,6 k941,4 k4101450      98362281
mar 20111,8 k3721,6 k941,4 k4101450      304362281
fev 20111,8 k3641,6 k841,4 k4031448      607253281
jan 20111,6 k3271,6 k561,4 k3741431      737129251
dez 20101,5 k3191,6 k481,4 k3621396      51121251
nov 20101,5 k3151,6 k481,4 k3621396      113121251
out 20101,5 k3111,6 k481,4 k3611395      118121251
set 20101,5 k3021,6 k481,4 k3561395      204121251
ago 20101,4 k2941,6 k431,4 k3521388      204116251
jul 20101,4 k2771,6 k421,4 k2701382      105115251
jun 20101,4 k2771,6 k411,4 k2701382      58114251
mai 20101,4 k2551,6 k411,4 k2701382      110114251
abr 20101,4 k2501,6 k411,4 k2701382      106114251
mar 20101,4 k2431,5 k411,4 k2701382      63114251
fev 20101,4 k2401,5 k411,4 k2671379      118114251
jan 20101,3 k2361,5 k401,4 k2671378      11111425 
dez 20091,3 k2181,4 k401,4 k2671378      7211425 
nov 20091,3 k2111,4 k391,4 k2671378      12011325 
out 20091,3 k2091,4 k391,4 k2671378      19011325 
set 20091,3 k2041,4 k381,4 k2671374      22311324 
ago 20091,2 k1911,3 k381,4 k2651372      12611324 
jul 20091,2 k1911,3 k381,4 k2651372      17011324 
jun 20091,2 k1851,3 k381,4 k2621372      10911324 
mai 20091,1 k1831,2 k381,4 k2601372      10111324 
abr 20091,1 k1811,2 k381,4 k2601372      17811324 
mar 20091,1 k1681,2 k371,4 k2321358      43911224 
fev 20091,1 k1521,2 k331,4 k1821214      3961923 
jan 20091,0 k1431,1 k321,4 k1821145      1421823 
dez 20089881401,1 k321,4 k1801141      2061823 
nov 20089691361,1 k321,4 k1791140      971823 
out 20089561191,0 k321,4 k1741134      1121823 
set 20089431051,0 k321,4 k1741134      1521823 
ago 2008912101973321,4 k1741133      3731823 
jul 200881497941301,4 k1701132      1551623 
jun 200879394911301,4 k1701130      1211623 
mai 200877687911301,4 k1701130      4671623 
abr 200872082880301,4 k1671126      5041623 
mar 200868678815291,4 k1591123      1481622 
fev 200867974785291,4 k1591123      5091622 
jan 200865068753271,4 k1591123      7111422 
dez 200759365723251,4 k1541105      4391222 
nov 200757861690241,4 k1491105      621221 
out 200757159690241,3 k1481105      3901221 
set 200755451629241,3 k1461105      7321221 
ago 200752943596241,3 k1411101      6081221 
jul 200751540564241,3 k132196      8791221 
jun 200749139532241,3 k130194      1651221 
mai 200747439500231,2 k86193      1481220 
abr 200746537447231,2 k86193      2091220 
mar 200744735409231,2 k84187      1941220 
fev 2007436343822275974171      84 220 
jan 2007431313572275974171      113 220 
dez 2006419313102272074171      139 220 
nov 2006413302962172040136      91 120 
out 2006396272462170137135      146 120 
set 2006377272102169037135      225 120 
ago 2006352261732166637135      173 120 
jul 2006334221322166133134      497 120 
jun 200627313952159028128      172 120 
mai 200623711652159027127      143 120 
abr 20062049352157827127      103 120 
mar 20061806182157827 24      124 120 
fev 20061355162056616 14      66 119 
jan 20061105152054314 14      40 119 
dez 2005954151953511 14      29 118 
nov 200578315195189 14      73 118 
out 20056421424916 14      17 11 
set 20056221414915 14      39  1 
ago 20054821314715 14      4  1 
jul 20054621314655 14      87  1 
jun 20051821014484 4      24  1 
mai 2005821013543 2      1  1 
abr 2005711013543 2      15  1 
mar 2005419 3543 2      10    
fev 20051   354              
jan 20051   354              
dez 20041   354              
nov 20041                  
out 20041                  
set 20041                  
ago 20041                  

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

ago 2004: 1 1 Main Page

mar 2005: 1 1 ضرب‌المثل‌های عربی

abr 2005: 1 1 آدولف هیتلر

mai 2005: 1 1 ضرب‌المثل‌های فارسی

jun 2005: 1 2 آقامحمدخان قاجار , 2 2 عزیز نسین , 3 2 صفحهٔ اصلی , 4 1 محمود احمدی‌نژاد

jul 2005: 1 2 ناشناس , 2 1 ویلیام فالکنر

ago 2005: 1 2 صفحهٔ اصلی , 2 1 فهرست بر اساس فيلم‌ها

set 2005: 1 3 صفحهٔ اصلی , 2 2 علی بن ابی‌طالب , 3 2 ناشناس , 4 1 ارنستو چه گوارا

out 2005: 1 1 فهرست افراد براساس نام

nov 2005: 1 2 کورش مدرسی , 2 2 منصور حکمت , 3 2 حمید تقوایی , 4 2 محمود احمدی‌نژاد , 5 1 دوگ لارسون

dez 2005: 1 1 امبرتو اکو

jan 2006: 1 2 اپیکور , 2 2 ارنستو چه گوارا , 3 1 کانت

fev 2006: 1 2 آلبر کامو , 2 2 زیلاکس , 3 1 محمدتقی مصباح یزدی

mar 2006: 1 2 توماس جفرسون , 2 2 ماتریکس , 3 2 فهرست آثار ادبی , 4 2 فهرست افراد بر اساس نام , 5 2 صفحهٔ اصلی , 6 1 کارلوس کاستاندا

abr 2006: 1 4 صفحهٔ اصلی , 2 3 هرمان هسه , 3 2 مارتین لوتر , 4 2 ضرب‌المثل‌های هلندی , 5 2 استانیسلاو لم , 6 2 ارنست همینگوی , 7 2 مایکل جکسون , 8 2 آلبرت اینشتین

mai 2006: 1 2 رابرت آنسون هاین‌لاین , 2 2 رفیق شامی , 3 2 جلال‌الدین محمد بلخی , 4 2 داگلاس آدامز , 5 2 فرانسوا لارشفوکو , 6 2 ضرب‌المثل‌های لاتینی , 7 2 واشنگتن ایروینگ , 8 2 توماس جفرسون , 9 1 محمد خیابانی

jun 2006: 1 2 فرانسوا فنلون , 2 2 ژان دو لافونتن , 3 2 وینستون چرچیل , 4 2 فهرست افراد بر اساس نام , 5 2 صفحهٔ اصلی , 6 1 رنه دکارت

jul 2006: 1 3 هلن کلر , 2 3 آیان حرصی علی , 3 3 آرزو , 4 3 آندره ژید , 5 3 آرتور شوپنهاور , 6 2 سید مرتضی آوینی , 7 2 الویس پریسلی , 8 2 مسیر سبز , 9 2 کازابلانکا , 10 2 رستگاری در شاوشنک , 11 2 ژولیا کریستوا , 12 2 محمود فلکی , 13 2 منوچهر آتشی , 14 2 جنگ عراق , 15 2 باباطاهر , 16 2 ویلیام سارویان , 17 2 کارل سندبرگ , 18 2 اقبال لاهوری , 19 2 فدریکو فلینی , 20 2 فریدریش شیلر , 21 2 رنه دکارت , 22 2 امیرخسرو دهلوی , 23 2 علی‌اکبر دهخدا , 24 2 کندورسه , 25 2 افلاطون

ago 2006: 1 3 ضرب‌المثل‌های آذربایجانی , 2 3 صفحهٔ اصلی , 3 2 صادق هدایت , 4 2 سووشون , 5 2 شازده کوچولو , 6 1 محمدحسین شهریار

set 2006: 1 4 صفحهٔ اصلی , 2 3 فهرست افراد بر اساس نام , 3 2 بيل گيتس , 4 2 ضرب‌المثل‌های آذربایجانی , 5 2 عمر خیام , 6 2 حافظ , 7 2 میکل‌ آنژ , 8 2 محمود احمدی‌نژاد , 9 1 شهریار

out 2006: 1 2 ژان پل , 2 2 حسن تقی‌زاده , 3 2 ضرب‌المثل‌های آذربایجانی , 4 2 حافظ , 5 2 وودی آلن , 6 2 سعدی , 7 2 فهرست افراد بر اساس نام , 8 1 فرانکا ماگنانی

nov 2006: 1 2 باران کوثری , 2 2 کارل گوستاو یونگ , 3 2 برتولت برشت , 4 2 فهرست افراد بر اساس نام , 5 2 صفحهٔ اصلی , 6 1 محمدرضا شفیعی کدکنی

dez 2006: 1 2 غلامرضا روحانی , 2 2 باران کوثری , 3 2 دنیای سوفی , 4 2 جنگ , 5 2 آلبرت اینشتین , 6 2 فهرست آثار ادبی , 7 1 ریچارد رورتی

jan 2007: 1 3 پدرخوانده , 2 2 ریچارد نیکسون , 3 2 نیکوس کازانتزاکیس , 4 2 ری بردبری , 5 2 محمد زکریای رازی , 6 2 محمود احمدی‌نژاد , 7 2 صفحهٔ اصلی , 8 1 ضرب‌المثل‌های اندونزیایی

fev 2007: 1 2 قیصر , 2 2 صفحهٔ اصلی , 3 1 انجیل متی

mar 2007: 1 3 لودویگ فان بتهوون , 2 3 فریدریش نیچه , 3 2 رمکو کامپرت , 4 2 محمدرضا شفیعی کدکنی , 5 2 کلیم کاشانی , 6 2 بایگانی نقل‌قول روز , 7 2 سعدی , 8 2 صفحهٔ اصلی , 9 1 وگ:وگ

abr 2007: 1 3 فریدریش نیچه , 2 2 داستان یک سیندرلا , 3 2 کما , 4 2 تقاطع , 5 2 مهمان (فیلم) , 6 2 اخراجی‌ها , 7 2 فریدون جنیدی , 8 2 ابوریحان بیرونی , 9 2 وحید قزوینی , 10 2 عمر خیام , 11 2 فردوسی , 12 2 جلال‌الدین محمد بلخی , 13 2 مارتین لوتر

mai 2007: 1 2 راه بی‌پایان , 2 2 تله , 3 2 میم مثل مادر , 4 2 هنر , 5 2 جورج برنارد شاو , 6 2 فهرست آثار ادبی , 7 2 ناشناس , 8 1 اسدی طوسی

jun 2007: 1 2 جان رید , 2 2 مائو تسه تونگ , 3 2 باران کوثری , 4 2 محمد خیابانی , 5 2 عشق , 6 1 سرمایه‌داری

jul 2007: 1 2 سگ , 2 2 گربه , 3 2 عباس کیارستمی , 4 2 نیکلا سارکوزی , 5 2 روز سوم , 6 2 فریدریش انگلس , 7 2 مائو تسه تونگ , 8 2 فریدون جنیدی , 9 2 کارل مارکس , 10 2 سیسرو , 11 2 ضرب‌المثل‌های آلمانی , 12 2 علی شریعتی , 13 2 عشق , 14 1 کد داوینچی

ago 2007: 1 3 سیاست , 2 3 ضرب‌المثل‌های فارسی , 3 2 کریستین بویین , 4 2 سید روح‌الله خمینی , 5 2 ازدواج , 6 2 آزادی , 7 2 ولادیمیر لنین , 8 2 کارل مارکس , 9 2 علویه خانم , 10 2 ضرب‌المثل‌های اسپانیایی , 11 2 سید مرتضی آوینی , 12 2 داگلاس آدامز , 13 2 هنر , 14 2 دانش , 15 2 دوستی , 16 2 جنگ , 17 1 سنگسار

set 2007: 1 3 لئون تروتسکی , 2 3 محمود احمدی‌نژاد , 3 2 شتر , 4 2 مزرعه حیوانات , 5 2 ۱۹۸۴ , 6 2 ملالی جویا , 7 2 سید روح‌الله خمینی , 8 2 فاطمه زهرا/گفتار هایی از فاطمه زهرا , 9 2 فاطمه زهرا/اشعاری از شعرای کهن پیرامون فاطمه زهرا , 10 2 فاطمه زهرا/فاطمه زهرا در نگاه امامان شیعه , 11 2 ولادیمیر لنین , 12 2 ایرج‌میرزا , 13 2 اهلی شیرازی , 14 2 نقل‌قول روز , 15 2 باران کوثری , 16 2 ضرب‌المثل‌های ارمنی , 17 2 ضرب‌المثل‌های ایتالیایی , 18 2 افلاطون , 19 2 دانش , 20 2 آندره ژید , 21 2 جرج هربرت , 22 2 موریس مترلینک , 23 2 فهرست فیلم‌ها , 24 2 لئو بوسکالیا , 25 2 سورن کی‌یر کگارد

out 2007: 1 3 ژان دلا برویر , 2 2 آندری تارکوفسکی , 3 2 جان لاک , 4 2 شتر , 5 2 کارل مارکس , 6 2 باران کوثری , 7 2 ضرب‌المثل‌های ارمنی , 8 2 صادق هدایت , 9 2 ضرب‌المثل‌های آذربایجانی , 10 2 سنایی , 11 2 رقص , 12 2 فهرست فیلم‌ها , 13 1 مرکز موسیقی بتهوون

nov 2007: 1 3 علی بن ابی‌طالب , 2 2 داوید آلفارو سی‌که‌ایروس , 3 2 جیمز ناکس پولک , 4 2 ضرب‌المثل‌های آذربایجانی , 5 2 فیلم , 6 1 انقلاب

dez 2007: 1 5 فهرست افراد بر اساس نام , 2 4 دیوارنوشته , 3 4 ویلیام شکسپیر , 4 3 جلیل ضیاءپور , 5 3 خانه‌ای بر روی آب , 6 3 صلح , 7 3 فریدریش نیچه , 8 3 صفحهٔ اصلی , 9 2 ماهی , 10 2 انقلاب , 11 2 جورج دبلیو بوش , 12 2 محمدحسین شهریار , 13 2 ضرب‌المثل‌های آذربایجانی , 14 2 ضرب‌المثل‌های اسپانیایی , 15 2 فهرست نمایش‌های تلویزیونی , 16 2 ابن سینا , 17 2 عشق , 18 2 فهرست فیلم‌ها

jan 2008: 1 5 لوئیس بونوئل , 2 4 فهرست افراد بر اساس نام , 3 4 ضرب‌المثل‌های فارسی , 4 3 جنون , 5 3 محمدحسین شهریار , 6 3 ژان دارک , 7 3 محمود احمدی‌نژاد , 8 2 طبیعت , 9 2 جورج اورول , 10 2 مجنون , 11 2 زنبور , 12 2 مرگ , 13 2 خنده , 14 2 مکس پین , 15 2 کودک , 16 2 خوب، بد، زشت , 17 2 رومن رولان , 18 2 سیمین دانشور , 19 2 مادر , 20 2 فروغ فرخزاد , 21 2 کتاب , 22 2 عطار نیشابوری , 23 2 نیشابور , 24 2 جورج دبلیو بوش , 25 2 دنیای سوفی

fev 2008: 1 3 روشنفکر , 2 2 گل , 3 2 شراب , 4 2 سیمون دوبوار , 5 2 مرگ , 6 2 منیرو روانی‌پور , 7 2 فروغ فرخزاد , 8 2 کتاب , 9 2 تاریخ , 10 2 نقل‌قول روز , 11 2 نیکوس کازانتزاکیس , 12 2 ضرب‌المثل‌های ترکی , 13 2 ضرب‌المثل‌های آذربایجانی , 14 2 هنر , 15 2 عشق , 16 1 عارف قزوینی

mar 2008: 1 3 اورسن ولز , 2 3 فهرست افراد بر اساس نام , 3 2 مائو تسه‌دون , 4 2 سنگسار , 5 2 عشق , 6 2 کارلایل

abr 2008: 1 3 سید علی خامنه‌ای , 2 3 ژیل دلوز , 3 3 فهرست افراد بر اساس نام , 4 3 ناپلئون بناپارت , 5 3 صفحهٔ اصلی , 6 2 سید جمال‌الدین اسدآبادی , 7 2 محمد فضولی , 8 2 چنین گفت زرتشت , 9 2 تقی ارانی , 10 2 شارلوت برونته , 11 2 شیون فومنی , 12 2 فردریک هگل , 13 2 لوچیو کولتی , 14 2 هربرت مارکوزه , 15 2 نیکوس پولانزاس , 16 2 باروخ اسپینوزا , 17 2 گئورگ ویلهلم فریدریش هگل , 18 2 مگس , 19 2 جلیل ضیاءپور , 20 1 سید جمال الدین اسدآبادی

mai 2008: 1 6 فهرست افراد بر اساس نام , 2 3 حسین پناهی , 3 3 عشق , 4 3 صفحهٔ اصلی , 5 2 پروانه , 6 2 جورج گوردون بایرون , 7 2 پاپلی یزدی , 8 2 بلبل , 9 2 هانا آرنت , 10 2 دایره زنگی , 11 2 عارف قزوینی , 12 2 امیلی برونته , 13 2 دانش , 14 2 آرزو , 15 2 موریس مترلینک , 16 1 کسایی مروزی

jun 2008: 1 2 هنری دیوید تورو , 2 2 لنگستون هیوز , 3 2 ستارخان , 4 2 شراب , 5 2 سنگسار , 6 2 بزرگمهر , 7 1 مجوز مستندات آزاد گنو

jul 2008: 1 4 طاهره قرةالعین , 2 3 گوساله , 3 3 عباس کیارستمی , 4 3 فهرست افراد بر اساس نام , 5 2 مرد سوم , 6 2 نیمتاج سلماسی , 7 2 هوشنگ گلشیری , 8 2 نقش رستم , 9 2 تخت جمشید , 10 2 سید محمد طباطبائی , 11 2 رشحه , 12 2 حسین پناهی , 13 2 اورسن ولز

ago 2008: 1 3 بوسه , 2 2 داستان دو شهر , 3 2 سکوت , 4 2 ۱۷ فوریه , 5 2 گراهام گرین , 6 2 هانیبال الخاص , 7 2 شیخ فضل‌الله نوری , 8 2 صائب تبریزی , 9 2 آندری تارکوفسکی , 10 2 لودویگ فان بتهوون , 11 2 مارتین لوتر کینگ جونیور , 12 2 عشق , 13 2 آلبرت اینشتین , 14 2 محمود احمدی‌نژاد , 15 1 اریش فروم

set 2008: 1 3 گربه روی شیروانی داغ (نمایشنامه) , 2 2 امیر نادری , 3 2 محمدحسین پاپلی یزدی , 4 2 تنسی ویلیامز , 5 2 دیپاک چوپرا , 6 2 پاپلی یزدی , 7 1 ۲ مه

out 2008: 1 2 حسام‌الدین خویی , 2 2 میرزا علی‌اکبر صابر , 3 2 امام محمد غزالی , 4 2 علی اکبر دهخدا , 5 1 حسام الدین خویی

nov 2008: 1 4 فهرست افراد بر اساس نام , 2 2 باراک اوباما , 3 1 ژان سیبلیوس

dez 2008: 1 2 گروچو مارکس , 2 2 فردوسی

jan 2009: 1 3 محمد بن عبدالله , 2 2 امیلی دیکنسن , 3 2 گلادیاتور , 4 1 ۱۴ ژانویه

fev 2009: 1 3 زنان , 2 3 محمد علی کلی , 3 2 ماهواره امید , 4 2 حسن طبری آملی , 5 2 سید محمد‌کاظم شریعتمداری , 6 2 ولایت فقیه , 7 2 خلفای راشدین , 8 2 اردبیل , 9 2 شاهین نجفی , 10 2 دایره زنگی , 11 2 وحشی بافقی , 12 2 خیلی دور، خیلی نزدیک , 13 2 قیصر , 14 2 آلفونس کار , 15 2 پائولو کوئیلو , 16 1 محیط طباطبائی

mar 2009: 1 2 علی اکبر شیرودی , 2 2 بهارانه , 3 2 حسن لاهوتی اشکوری , 4 2 حسن طبری آملی , 5 2 شارلوت برونته , 6 2 حسین بن علی , 7 2 هاینریش هاینه , 8 2 گابریل گارسیا مارکز , 9 2 رنه دکارت , 10 2 ژان دو لافونتن , 11 2 رودکی , 12 2 ابن سینا , 13 2 عمر خیام , 14 2 استانیسلاو لم , 15 2 آلبر کامو , 16 2 تالس , 17 2 آلبرت اینشتین , 18 2 جورج برنارد شاو , 19 2 مارشال مک‌لوهان , 20 1 علی صیاد شیرازی

abr 2009: 1 4 فهرست افراد بر اساس نام , 2 3 حسین منصور حلاج , 3 2 ریچارد براتیگان , 4 2 آنا آخماتووا , 5 2 فروغ فرخزاد , 6 2 عطار نیشابوری , 7 2 سعدی , 8 2 یوهان ولفگانگ گوته , 9 2 آلبرت اینشتین , 10 2 منصور حکمت , 11 1 مهدی رجب بیگی

mai 2009: 1 5 فهرست افراد بر اساس نام , 2 2 عماد مغنیه , 3 2 صلح , 4 2 سید روح‌الله خمینی , 5 2 فردوسی

jun 2009: 1 2 تبریز , 2 2 جرج برناردشاو , 3 2 لئوناردو داوینچی , 4 2 دار و دسته‌های نیویورکی , 5 1 لئونارد داوینچی

jul 2009: 1 4 علی بن ابی‌طالب , 2 2 زنان , 3 2 استیون واینبرگ , 4 1 توماس هنری هاکسلی

ago 2009: 1 3 احمد مفتی‌زاده , 2 3 شعارهای مردم در اعتراض به نتیجه انتخابات ریاست جمهوری , 3 3 ضرب‌المثل‌های چینی , 4 2 گیتی نوین , 5 2 میرحسین موسوی , 6 2 آبراهام لینکلن , 7 1 یوسف صانعی

set 2009: 1 3 سید محمد خاتمی , 2 3 علی شریعتی , 3 3 فهرست افراد بر اساس نام , 4 2 در بروژ , 5 2 احمد مفتی‌زاده , 6 2 شعارهای مردم در اعتراض به نتیجه انتخابات ریاست جمهوری , 7 2 میرحسین موسوی , 8 2 دزدان دریایی کارائیب: صندوق مرد مرده , 9 2 حسین پناهی , 10 2 سید علی خامنه‌ای , 11 1 پیامک

out 2009: 1 2 خواب , 2 2 بهلول , 3 2 امام محمد باقر , 4 2 جعفر صادق , 5 2 میرحسین موسوی , 6 2 دنیای سوفی , 7 1 عبدالکریم سروش

nov 2009: 1 4 محمود احمدی‌نژاد , 2 2 ژان پل سارتر , 3 1 چه‌گوارا

dez 2009: 1 1 سید احمد علم‌الهدی

jan 2010: 1 2 ریاضی , 2 2 محمدرضا شجریان , 3 2 سید احمد علم‌الهدی , 4 2 اسفندیار رحیم‌مشایی , 5 2 میرحسین موسوی , 6 1 بیماری

fev 2010: 1 3 جنبش سبز , 2 2 علی رضا بدیع , 3 2 لئوناردو داوینچی , 4 2 فهرست فیلم‌ها , 5 1 پل ورلن

mar 2010: 1 2 شعارهای مردم در اعتراض به نتیجه انتخابات ریاست جمهوری , 2 2 فهرست افراد بر اساس نام , 3 1 کورش کوچک

abr 2010: 1 4 بهاءالله , 2 3 محمود احمدی‌نژاد , 3 2 هرات , 4 2 سید حسن فیروزآبادی , 5 2 میرحسین موسوی , 6 2 سید علی خامنه‌ای , 7 2 وینستون چرچیل , 8 1 پیامک

mai 2010: 1 2 بهاءالله , 2 2 محمدرضا شجریان , 3 2 فردوسی , 4 1 سلام

jun 2010: 1 3 سید روح‌الله خمینی , 2 2 کاظم صدیقی , 3 2 سید علی خامنه‌ای , 4 2 فهرست افراد بر اساس نام , 5 1 حاتم طایی

jul 2010: 1 2 خوزستان , 2 2 بدبیاری‌ها , 3 2 آین رند , 4 2 حسین الهی قمشه‌ای , 5 2 ضرب‌المثل‌های فارسی , 6 1 عین القضاة همدانی

ago 2010: 1 3 محمود احمدی‌نژاد , 2 2 آیزاک آسیموف , 3 2 چای , 4 2 دخانیات , 5 2 خلیج فارس , 6 2 خوزستان , 7 2 علی‌رضا بدیع , 8 2 آمریکا , 9 2 سید علی‌محمد دستغیب , 10 2 نیشابور , 11 2 محمدحسین شهریار , 12 2 امیرخسرو دهلوی , 13 1 پیامک

set 2010: 1 4 علی بن ابی‌طالب , 2 4 فهرست افراد بر اساس نام , 3 3 عمرو عاص , 4 3 باراک اوباما , 5 3 حسین بن علی , 6 2 جلال‌الدین فارسی , 7 2 ابوالحسن بنی‌صدر , 8 2 معاویه پسر ابی‌سفیان , 9 2 سهیل پسر عمرو , 10 2 میدان نقش جهان , 11 2 دمشق , 12 1 پیامک

out 2010: 1 2 قهوه تلخ , 2 2 عبدالجواد غرويان , 3 2 آنتون چخوف , 4 2 علی بن ابی‌طالب , 5 2 جکسون براون , 6 1 قهوه تلخ (سریال)

nov 2010: 1 3 قهوه تلخ , 2 3 جورج برنارد شاو , 3 2 غلامحسین ساعدی , 4 2 غلامعلی بسکی , 5 2 محسن قرائتی , 6 1 هارون‌الرشید

dez 2010: 1 2 سنگسار در اسلام , 2 2 وحشی بافقی , 3 2 فروغ فرخزاد , 4 2 علی بن ابی‌طالب , 5 1 لویی فردینان سلین

jan 2011: 1 3 علی‌رضا افتخاری , 2 3 فهرست فیلم‌ها , 3 3 علی بن ابی‌طالب , 4 3 محمود احمدی‌نژاد , 5 2 پیامک , 6 2 مهدی , 7 2 توبه , 8 2 رضی‌الدین نیشابوری , 9 2 ابرهه , 10 2 قاسم بن محمد , 11 2 عبدالله بن شبرمه , 12 2 شطرنج , 13 2 ابی بن کعب , 14 2 عایشه , 15 2 محمدجواد عزتی , 16 2 ابن عباس , 17 2 ابن قیم الجوزیه , 18 2 حسن بصری , 19 2 زین‌العابدین مراغه‌ای , 20 2 مصر , 21 2 خراسان , 22 2 زین‌العابدین بن علی , 23 2 سبزوار , 24 2 ضرب‌المثل‌های خراسانی , 25 2 شب‌های روشن

fev 2011: 1 3 خلیج فارس , 2 3 ایران , 3 2 معمر قذافی , 4 2 مأمون , 5 2 مشورت , 6 2 مدینه , 7 2 نام‌گذاری فرزند , 8 2 عمر بن خطاب , 9 2 ابوبکر , 10 2 عزت‌الله سحابی , 11 2 عبدالکریم سروش , 12 2 میرحسین موسوی , 13 2 محمدحسین پاپلی یزدی , 14 2 آنتون چخوف , 15 2 منوچهر آتشی , 16 2 عمر خیام , 17 1 شعارهای مردم لیبی در اعتراضات سال ۲۰۱۱

mar 2011: 1 4 علی بن ابی‌طالب , 2 3 محمدجواد عزتی , 3 3 عمر بن خطاب , 4 3 ابوبکر , 5 3 نیشابور , 6 3 آدولف هیتلر , 7 2 کیم وو چونگ , 8 2 طاهر بن حسین , 9 2 فاروق , 10 2 ابوعثمان سعید مغربی , 11 2 سید حسن مدرس , 12 2 نجم‌الدین اربکان , 13 2 روژه گارودی , 14 2 معمر قذافی , 15 2 قدس , 16 2 ادیب نیشابوری , 17 2 زبان عربی , 18 2 زبان فارسی , 19 1 ابو حفص حداد

abr 2011: 1 2 ابوسعید ابوالخیر , 2 2 ضرب‌المثل‌های خراسانی , 3 1 لودویک زامنهوف

mai 2011: 1 2 جفرسون دیویس , 2 2 خواجه عبدالله انصاری , 3 2 علویه خانم , 4 1 ناصر حجازی

jun 2011: 1 2 ابوبکر , 2 2 ایران , 3 1 آشنایی با مادر

jul 2011: 1 1 علی بن ابیطالب

ago 2011: 1 3 عمر بن خطاب , 2 2 کورش بزرگ , 3 1 میرزا حسین‌علی نوری

set 2011: 1 3 فهرست آثار ادبی , 2 2 جرم (فیلم) , 3 2 فرینج , 4 2 نیشابور , 5 2 کازابلانکا , 6 2 فهرست فیلم‌ها , 7 1 هوشنگ ایرانی

out 2011: 1 2 جدایی نادر از سیمین , 2 2 نیشابور , 3 1 اینشتین

nov 2011: 1 4 ازدواج , 2 3 مبارزه متعالی , 3 2 شعور خلاق , 4 2 کلام خلاق , 5 2 قضاوت , 6 1 یوحنای مجنون

dez 2011: 1 3 ایلیا میم , 2 2 پیمان فتاحی , 3 2 هامون , 4 2 محمدرضا پهلوی , 5 2 محمد مصدق , 6 2 مایکل جکسون , 7 1 مصطفی چمران

jan 2012: 1 3 ضرب‌المثل‌های فارسی , 2 2 علاءالدین ملماسی , 3 2 سید روح‌الله خمینی , 4 2 فریدون جنیدی , 5 2 فهرست فیلم‌ها , 6 1 هوپ‌هوپ‌نامه

fev 2012: 1 2 آمل , 2 1 طالب آملی

mar 2012: 1 2 پیمان فتاحی , 2 2 جلال‌الدین محمد بلخی , 3 2 مریلین منسون , 4 2 فهرست آثار ادبی , 5 2 فهرست افراد بر اساس نام , 6 1 اریک کانتونا

abr 2012: 1 5 ماهواره امید , 2 3 فهرست افراد بر اساس نام , 3 2 سکسوالیته , 4 2 بایزید بسطامی , 5 2 جانی دپ , 6 2 مذهب , 7 2 علی شریعتی , 8 1 شادی

mai 2012: 1 3 مارک تواین , 2 2 پرویز شهریاری , 3 2 شاهین نجفی , 4 2 جورج برنارد شاو , 5 2 فهرست افراد بر اساس نام , 6 1 کارل سیگن

jun 2012: 1 2 سیروان خسروی , 2 1 بابک خرمدین

jul 2012: 1 3 رضا پهلوی , 2 2 ارباب کمان نقره‌ای , 3 2 جورج برنارد شاو , 4 2 مارک تواین , 5 1 اتاقی از آن خود

ago 2012: 1 3 فهرست فیلم‌ها , 2 2 دیوانه‌ای از قفس پرید , 3 2 سفر به انتهای شب , 4 2 عمر بن خطاب , 5 2 هانا آرنت , 6 2 صادق هدایت , 7 2 ایمانوئل کانت , 8 1 زیستن چون پروانه

set 2012: 1 1 بهار ۶۳

out 2012: 1 1 ضرب‌المثل‌های کردی

nov 2012: 1 5 فهرست افراد بر اساس نام , 2 2 عمر بن خطاب , 3 1 محمود کریمی حکاک

dez 2012: 1 2 مصطفی دلشاد تهرانی , 2 2 فهرست افراد بر اساس نام , 3 1 امیر قلعه نویی

jan 2013: 1 3 عمر بن خطاب , 2 2 جورج اورول , 3 2 عشق , 4 2 فهرست افراد بر اساس نام , 5 1 لیلا صادقی

fev 2013: 1 2 ناجی العلی , 2 2 آسیا عبدالله

mar 2013: 1 2 سید علی خامنه‌ای , 2 1 انیو موریکونه

abr 2013: 1 3 ماکسیمیلیان روبسپیر , 2 3 سن ژوست , 3 3 انیو موریکونه , 4 3 مختارنامه (مجموعه تلویزیونی) , 5 2 حرفه‌ای , 6 2 سید محمد‌کاظم شریعتمداری , 7 2 علی شریعتی , 8 1 عماد خراسانی

mai 2013: 1 4 دینو بوتزاتی , 2 4 آزادی , 3 3 عماد خراسانی , 4 3 ضرب‌المثل‌های بختیاری , 5 3 فریدون مشیری , 6 1 ماکسیم گورکی

jun 2013: 1 2 مالکوم لطیف شباز , 2 2 حسن روحانی , 3 1 آبراهام مازلو

jul 2013: 1 2 ایندیرا گاندی , 2 1 100 گفتار

ago 2013: 1 3 حسن روحانی , 2 3 عمر بن خطاب , 3 3 ابوبکر , 4 2 محمد بن موسی خوارزمی , 5 2 داوید هیلبرت , 6 2 محمدعلی جمال‌زاده , 7 2 پینوکیو (فیلم) , 8 2 ناخدا خورشید , 9 2 باغ‌های کندلوس , 10 2 لودویگ ویتگنشتاین , 11 2 والتر اسکات , 12 2 راینر ماریا ریلکه , 13 2 کاشان , 14 2 توماس هاکسلی , 15 2 البرت هوبارد , 16 2 ایندیرا گاندی , 17 2 دوایت آیزنهاور , 18 2 فرانک تایگر , 19 2 آلیس واکر , 20 2 پایتخت , 21 2 داریوش بزرگ , 22 2 گشت ارشاد , 23 2 شیخ بهائی , 24 2 دیوانه‌ای از قفس پرید , 25 2 سعادت‌آباد

set 2013: 1 3 فهرست افراد بر اساس نام , 2 2 شمع , 3 2 زیرپوست شهر , 4 2 جیمز جویس , 5 2 گی دو موپاسان , 6 2 جان استاینبک , 7 2 ابوبکر کرجی , 8 2 آنه فرانک , 9 2 پینوکیو (فیلم) , 10 1 پاتریس لومومبا

out 2013: 1 2 نورعلی الهی , 2 2 پینوکیو (فیلم) , 3 2 ایرانی , 4 2 سید محمد خاتمی , 5 2 فهرست فیلم‌ها , 6 2 علی بن ابی‌طالب , 7 1 شمس تبریزی

nov 2013: 1 2 محمدجواد ظریف , 2 2 نورعلی الهی , 3 2 لودویگ ویتگنشتاین , 4 2 شطرنج , 5 2 عشق , 6 2 علی بن ابی‌طالب , 7 1 علی زین العابدین

dez 2013: 1 4 دانش , 2 3 جینا جیمسون , 3 3 ارتداد در اسلام , 4 3 سنگسار در اسلام , 5 3 جورج واشنگتن , 6 3 کورش بزرگ , 7 2 سفارت , 8 2 فریدریش هایک , 9 2 خرما , 10 2 نهنگ , 11 2 جوزف کمبل , 12 2 لوئیزا می آلکوت , 13 2 هشت صبح , 14 2 سید علی‌اصغر دستغیب , 15 2 نلسون ماندلا , 16 2 مبارزه متعالی , 17 2 بخشندگی , 18 2 ابوسعید ابوالخیر , 19 2 زکات , 20 2 شطرنج , 21 2 ناصر مکارم شیرازی , 22 2 میرزا کوچک خان جنگلی , 23 2 نماز (اسلام) , 24 2 زنان , 25 2 سکوت

jan 2014: 1 3 شاه اسماعیل دوم , 2 3 آلبرت اشپر , 3 3 علی‌رضا , 4 2 یاس (خواننده) , 5 2 آل کاپون , 6 2 پول , 7 2 اخلاق , 8 2 اراده , 9 2 جوانی , 10 2 حسادت , 11 2 تجربه , 12 2 طمع , 13 2 استبداد , 14 2 جهان , 15 2 بیابان , 16 2 حسن روحانی , 17 2 اندیشیدن , 18 2 عمر بن خطاب , 19 2 زیبایی آمریکایی , 20 2 انسان , 21 2 حسن بن علی , 22 2 زنان , 23 2 بوسه , 24 2 کودک , 25 2 آزادی

fev 2014: 1 3 ژوزه ساراماگو , 2 3 کورش بزرگ , 3 2 تحقیر , 4 2 کورت وانگات , 5 2 علی کریمی , 6 2 آلکساندر سولژنیتسین , 7 2 شمس تبریزی , 8 2 ملاله یوسف‌زی , 9 2 جان استاینبک , 10 2 صدام حسین , 11 2 گهواره گربه , 12 2 شوالیه تاریکی , 13 2 بغداد , 14 2 معمر قذافی , 15 2 حج , 16 2 ابوبکر , 17 2 حامد کرزی , 18 2 سجاد , 19 2 جعفر صادق , 20 2 ایران , 21 2 تهران , 22 2 محمدرضا پهلوی , 23 2 حسین بن علی , 24 2 مخمصه , 25 2 رستگاری در شاوشنک

mar 2014: 1 4 زندگی , 2 3 حسن روحانی , 3 3 عمر مختار , 4 3 انسان , 5 2 پریکلس , 6 2 مجید مجیدی , 7 2 بیل برایسون , 8 2 استیو مارابولی , 9 2 توپاک شکور , 10 2 کریستوفر مارلو , 11 2 ادگار واتسون هاو , 12 2 ساموئل جانسون , 13 2 کلارنس دارو , 14 2 سو تاونسند , 15 2 والتر رالی , 16 2 جان ماری گیبون , 17 2 جان هیت استابز , 18 2 رالف ریچاردسون , 19 2 اشرف ریفی , 20 2 حکومت , 21 2 سال بلو , 22 2 آرت بوخوالد , 23 2 سیلماریلیون , 24 2 دایدو , 25 2 اسلام

abr 2014: 1 3 فاطمه زهرا , 2 2 محدث نوری , 3 2 هریت بیچر استو , 4 2 مارکی دوساد , 5 2 راشل کارسون , 6 2 پسرعمه زا , 7 2 احمد مسجدجامعی , 8 2 چارلز مک‌کارتی , 9 2 جورج کارلین , 10 2 رضا نظری , 11 2 فضل‌الله زاهدی , 12 2 رجب طیب اردوغان , 13 2 عبدالله بن عبدالعزیز , 14 2 محسن موسوی تبریزی , 15 2 عبدالرحمن اوزاعی , 16 2 نادانی , 17 2 آب , 18 2 لوئیزا می آلکوت , 19 2 غیرت , 20 2 صادق زیباکلام , 21 2 رزا لوکزامبورگ , 22 2 محمدعلی جمال‌زاده , 23 2 کاشان , 24 2 والتر گروپیوس , 25 2 ویل راجرز

mai 2014: 1 3 رضا داوری اردکانی , 2 3 مریم طاهری مجد , 3 3 کامبیز درم‌بخش , 4 3 لودویگ ویتگنشتاین , 5 2 ارومیه , 6 2 ایوان تورگنیف , 7 2 نیکلای گوگول , 8 2 مصطفی ملکیان , 9 2 احسان نراقی , 10 2 لیلا حاتمی , 11 2 غلامحسین ابراهیمی دینانی , 12 2 ناتاشا امیری , 13 2 مهشید امیرشاهی , 14 2 فرخنده آقایی , 15 2 شیرین نشاط , 16 2 پگاه احمدی , 17 2 بهاره رهنما , 18 2 ابوتراب خسروی , 19 2 مهدی یزدانی‌خرم , 20 2 حمیدرضا صدر , 21 2 محمد بساطی , 22 2 خیری شلبی , 23 2 علاء الاسوانی , 24 2 ابراهیم اصلان , 25 2 ادوار خراط

jun 2014: 1 2 آنتیستینس , 2 2 اخراجی ها ٢ , 3 2 پیامک , 4 1 ویلیام سامرست موآم

jul 2014: 1 3 اروین د. یالوم , 2 3 گراتزیا دلدا , 3 2 جیم موران , 4 2 نوری مالکی , 5 2 جی.کی. رولینگ , 6 2 دولت اسلامی عراق و شام , 7 2 خسرو شکیبایی , 8 2 ابراهیم فقی , 9 2 حماس , 10 2 پیروز مجتهدزاده , 11 2 سید محمود هاشمی شاهرودی , 12 2 سیما تیرانداز , 13 2 محمدباقر نجفی اصفهانی , 14 2 حسن قزوینی , 15 2 تروریسم , 16 2 ابوبکر کرجی , 17 2 سجاد , 18 2 روز قدس , 19 2 هوشنگ ابتهاج , 20 2 مهدی اخوان ثالث , 21 2 کورش بزرگ , 22 2 حافظ , 23 1 تغار

ago 2014: 1 3 فریدون فرخزاد , 2 3 شیخ فضل‌الله نوری , 3 2 یزدگرد سوم , 4 2 وضعیت سفید , 5 2 علی دیواندری , 6 2 ایران , 7 2 گربه , 8 2 صادق هدایت , 9 2 فهرست افراد بر اساس نام , 10 1 مسیحیت

set 2014: 1 2 مسعود جعفری جوزانی , 2 2 غلامرضا اعوانی , 3 2 محمدامین قانعی‌راد , 4 2 سید جواد طباطبایی , 5 2 هوگو چاوز , 6 2 ماکسیم رودینسون , 7 2 برنارد کوشنر , 8 2 جان راسکین , 9 2 دایدو , 10 2 بدیع‌الزمان همدانی , 11 2 رضا کیانیان , 12 2 حامد کرزی , 13 2 عادل فردوسی‌پور , 14 2 ایران , 15 2 تهران , 16 2 گربه , 17 1 ابن قتیبه دینوری

out 2014: 1 3 حسین شهابی , 2 2 محمد نوریزاد , 3 2 منجمد (فیلم ۲۰۱۳) , 4 2 رسول یونان , 5 2 محمدکریم پیرنیا , 6 2 فریدون آدمیت , 7 2 عبدالسلام عظیمی , 8 2 بن افلک , 9 2 استاد الهی , 10 2 نعمت‌الله فاضلی

nov 2014: 1 4 حسین شهابی , 2 3 جک هندی , 3 2 غلامحسین ابراهیمی دینانی , 4 2 ارتداد در اسلام , 5 1 لودویگ وان بتهوون

dez 2014: 1 2 حسین شهابی , 2 2 هوپ‌هوپ‌نامه , 3 2 جلال‌الدین فارسی , 4 2 حسن رحیم‌پور ازغدی , 5 2 بروس لی , 6 1 علی زعیم

jan 2015: 1 2 زندگی در پیش رو , 2 2 ناجی العلی , 3 2 سهراب سپهری , 4 2 فردوسی , 5 1 میرزا سروش لهراسب

No data on this page have been normalized to 30 day months (as WMF does on certain traffic reports).
Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Terça-feira, 3 de março 2015 04:49

Dump file fawikiquote-20150218-pages-meta-history.xml.7z (full dump), size 9.0 Mb as 7z -> 643 Mb
Dump processed till Jan 31, 2015, on server stat1002, ready at Wed-18/02/2015-19:59 after 1 min, 36 sec.

Versão do script:2.6
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.