Estatísticas da Wikiquote persa

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist

Metrics have been collected from a full archive dump, which contains all revisions of every article, meta data and raw content.
See also metrics definitions


 
Monthly counts & Quarterly rankings: fevereiro 2014
 
DataWikiquotariansArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
fev 2014+2%   +2%   -19%+1%+1%+3%+2%+3%+7%+2%
jan 2014+2%   +3%   +14%+3%+3%+8%+3%+3%+15%+9%
dez 2013+1%   +3%   +26%+4%+3%+3%+7%+7%+7%+10%
nov 2013+1%   +3%   +108%-2%-2%+3%+6%+7%+2%+22%
out 20130%   +1%   -46%+1%+1%0%+4%+10%+8%+1%
set 2013+1%   +1%   -47%+2%+1%+2%+7%+7%+2%+1%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
fev 20141332431,8 k117,826786959,4 Mb946 k17 k12 k8471,7 k935
jan 20141312711,7 k117,827008589,3 Mb937 k17 k12 k8241,5 k916
dez 20131291521,7 k117,726747539,0 Mb906 k16 k12 k8011,3 k837
nov 20131281211,7 k217,726545978,6 Mb876 k15 k11 k7501,2 k759
out 2013127 411,6 k 1828042878,8 Mb896 k15 k10 k6991,2 k624
set 20131271311,6 k117,928075348,8 Mb891 k15 k9,9 k6371,1 k616
ago 20131263931,6 k317,828121,0 k8,6 Mb882 k14 k9,2 k5971,1 k607
jul 201312317 1,5 k118,229161898,5 Mb859 k14 k9,1 k530978592
jun 201312246 1,5 k 18,429412098,5 Mb852 k14 k9,1 k522954586
mai 201311838 1,5 k 18,329341238,4 Mb846 k14 k9,0 k522944586
abr 201311524 1,5 k 18,229321708,4 Mb845 k14 k9,0 k523945585
mar 201311322 1,4 k 18,329201368,3 Mb833 k14 k8,9 k521925578
fev 2013111 3 1,4 k 18,32893968,2 Mb821 k14 k8,9 k522913568
jan 201311126 1,4 k 18,429062588,2 Mb819 k14 k8,9 k523916568
dez 201210923 1,4 k 18,228191077,9 Mb791 k14 k8,8 k523910562
nov 2012107 1 1,4 k 18,22818747,9 Mb787 k14 k8,8 k521885561
out 201210712 1,4 k 18,228271167,9 Mb787 k14 k8,8 k523880561
set 201210611 1,4 k118,228191797,8 Mb780 k14 k8,7 k523880560
ago 201210514 1,4 k118,428451797,8 Mb775 k14 k8,7 k522874560
jul 201210416 1,4 k 18,528682837,8 Mb772 k14 k8,6 k523847557
jun 201210313 1,4 k 18,428721617,7 Mb769 k14 k8,5 k523842556
mai 201210215 1,3 k 18,528922197,6 Mb766 k13 k8,4 k523837556
abr 201210126 1,3 k118,528962667,6 Mb758 k13 k8,3 k518812556
mar 2012992311,3 k 18,629242947,5 Mb756 k13 k8,3 k516794553
fev 20129712 1,3 k 18,429411597,6 Mb759 k13 k8,2 k521795551
jan 20129624 1,3 k 18,329321507,5 Mb756 k13 k8,1 k519795550
dez 20119427 1,3 k 18,229341497,5 Mb754 k13 k8,1 k518785549
nov 20119236 1,3 k 18,228271667,2 Mb722 k13 k8,1 k516777546
out 201189 2 1,3 k 18,127912237,1 Mb709 k13 k8,0 k516768546
set 20118914 1,3 k 1827871257,1 Mb708 k13 k7,8 k515769544
ago 20118812 1,3 k 17,927921337,0 Mb706 k13 k7,8 k512758543
jul 201187 1 1,3 k 17,827771537,0 Mb703 k13 k7,8 k512759542
jun 20118723 1,3 k 17,827801317,0 Mb698 k13 k7,7 k509745541
mai 20118514 1,3 k 17,827721146,9 Mb693 k13 k7,6 k514738538
abr 201184 5 1,3 k 17,727602046,9 Mb688 k13 k7,6 k513734536
mar 20118437 1,3 k 17,727545806,8 Mb683 k13 k7,5 k514726533
fev 2011813711,2 k317,426996916,6 Mb660 k13 k7,4 k470686500
jan 2011784931,2 k318,227398766,3 Mb621 k13 k7,3 k347641430
dez 201074 2 1,1 k 18,827874626,0 Mb583 k12 k7,1 k305602378
nov 20107425 1,1 k 18,527722256,0 Mb578 k12 k7,0 k303574378
out 20107237 1,1 k 18,327661775,9 Mb573 k12 k6,9 k301566368
set 20106957 1,1 k 18,227572815,9 Mb570 k12 k6,9 k299548366
ago 20106417 1,0 k 18,227397245,8 Mb560 k12 k6,8 k280521359
jul 20106345 1,0 k 17,826931785,6 Mb540 k12 k6,8 k274493352
jun 20105915 1,0 k 17,726961215,5 Mb538 k12 k6,7 k273488350
mai 20105817 1,0 k 17,726641575,4 Mb525 k12 k6,7 k273479349
abr 20105714 1,0 k 17,726662235,4 Mb521 k12 k6,7 k273425349
mar 201056 5 992 17,727122205,3 Mb525 k12 k6,6 k270412347
fev 20105647 979 17,727352265,3 Mb522 k12 k6,5 k269400346
jan 201052 5 966 17,727153455,2 Mb511 k12 k6,3 k264393340
dez 20095224 954 17,626311935,0 Mb488 k12 k6,3 k262377339
nov 20095014 947 17,526292354,9 Mb484 k12 k6,2 k261377338
out 200949 4 942117,425595184,8 Mb468 k12 k6,2 k259343329
set 20094927 926117,125002724,6 Mb449 k12 k6,0 k256316319
ago 20094717 902 17,325151,0 k4,5 Mb440 k12 k5,8 k255299311
jul 20094616 897216,224362004,4 Mb423 k12 k5,8 k252277309
jun 200945 3 834117,225781574,3 Mb417 k11 k5,8 k254261307
mai 20094524 816 17,426262624,2 Mb415 k11 k5,7 k251260303
abr 200943 6 813 17,126233004,2 Mb413 k11 k5,6 k253256298
mar 200943151806 16,926164984,2 Mb407 k11 k5,6 k253254293
fev 200942371793116,526054394,1 Mb398 k11 k5,5 k222238273
jan 20093915 778116,325862344,0 Mb388 k11 k5,4 k215214234
dez 200838141755 16,526333103,9 Mb384 k11 k5,3 k215212231
nov 200837 4 743 16,326471493,9 Mb380 k11 k5,2 k212200224
out 20083716 735 16,326371823,8 Mb374 k11 k5,1 k209193219
set 20083616 731116,126502483,8 Mb374 k11 k5,1 k208192211
ago 200835172704316,426724223,7 Mb364 k10 k4,9 k207171207
jul 200834 7 624117,829381793,6 Mb355 k9,9 k4,7 k191168189
jun 20083415 603 18,129771403,5 Mb347 k9,8 k4,6 k188162188
mai 200833271592218,229845673,5 Mb342 k9,7 k4,5 k185149183
abr 200831272540118,930516473,2 Mb318 k8,7 k4,4 k169107178
mar 200829 5 516 18,629992233,0 Mb299 k7,7 k4,2 k16090169
fev 200829 41513118,329936063,0 Mb297 k7,7 k4,1 k15887165
jan 200829372491117,828798312,8 Mb273 k6,6 k4,1 k14285158
dez 200726481453 17,528164972,5 Mb246 k5,5 k3,9 k12668137
nov 200722 4 441 16,827861192,4 Mb238 k4,9 k3,8 k12167135
out 200722131435 16,828419312,4 Mb239 k4,9 k3,7 k12365134
set 200721151425 1527759322,3 Mb228 k4,2 k3,5 k10755129
ago 200720 51413 13,226296592,1 Mb210 k3,4 k2,7 k6354115
jul 200720261406111,824959112,0 Mb196 k3,1 k2,5 k5042109
jun 200718 21389 1022701851,7 Mb171 k1,6 k2,4 k3739102
mai 200718 31376 9,822411951,6 Mb164 k1,5 k2,3 k283897
abr 20071814 37019,522042761,6 Mb158 k1,4 k2,3 k273892
mar 200717 2135219,221992601,5 Mb150 k1,3 k2,2 k263189
fev 200717 1 336 8,822071201,5 Mb143 k1,2 k2,1 k273182
jan 200717 2 332 8,621691591,4 Mb139 k1,2 k2,1 k263180
dez 20061713 320 8,421171791,3 Mb131 k1,1 k2,0 k263077
nov 20061635 315 7,920811441,3 Mb127 k1,1 k1,9 k252974
out 200613 31304 7,820841991,2 Mb123 k1,1 k1,9 k242772
set 200613 51292 7,420192971,2 Mb115 k9781,8 k232269
ago 20061313128516,51723205986 kb96 k8551,6 k231961
jul 20061236226916,21549512847 kb83 k7951,5 k221661
jun 20069 2122415,11285191642 kb59 k46887618429
mai 20069121186 5,11198163544 kb43 k20883415323
abr 2006812 17614,51114129402 kb37 k18672212220
mar 2006713 15914,21051182324 kb32 k16558111 17
fev 2006612 12014131089304 kb29 k1664443 11
jan 20065 1 99 4152349290 kb28 k1654132 7
dez 20055 1 86 4176141284 kb28 k1653672 6
nov 2005523 71 4,3200887265 kb27 k1602682 4
out 20053 1 60 3,6223721248 kb25 k1572232 3
set 2005312 60 3,2221744243 kb25 k1281971 2
ago 20052   47 3,227665236 kb24 k1251521 1
jul 20052 1 4513,2288687236 kb24 k1251521 1
jun 20052 2 17 3,4737526225 kb23 k86134   
mai 20052   7 4,6176334221 kb23 k86133   
abr 20052 1 7 41762817220 kb23 k86133   
mar 2005211 4 2,81981410134 kb15 k8474   
fev 20051   1 1445 1,9 kb77 106 9 
jan 20051   1 1445 1,9 kb77 106 9 
dez 20041   1 1445 1,9 kb77 106 9 
nov 20041   1 1445 1,9 kb77 106 9 
out 20041   1 1445 1,9 kb77 106 9 
set 20041   1 1445 1,9 kb77 106 9 
ago 200411  1 144511,9 kb77 106 9 
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
The following table ranks this project in relation to projects in other languages with 1000+ articles
jan 201413911132012119911121518111544
out 201313161272214981511121520131744
jul 201313131092210761511121525171844
abr 2013131213112212761611121525171744
jan 2013131113172115762311121525171744
out 2012131826162118762911121523161744
jul 2012131813142115761911121523151744
abr 201213914142112761811131523151544
jan 201213913112011761811121223151544
out 2011142124122011762511131223151544
jul 2011141827132014862511131220141544
abr 2011142014112013862111121220141444
jan 20111578520476711121219171443
out 20101671282013661712131220171443
jul 201017713132014762112131220161543
abr 2010171813142012761512131019161643
jan 201018191312201520201312131019161643
out 200917211619201018181813141019161643
jul 20091718111019517171513151019161743
abr 200918201215191817171712151018161743
jan 200918211412191217171712151018151643
out 200818141311201317171812151018151743
jul 200817231314221317171812151019151743
abr 20081912126221116161113151019152243
jan 2008199117221414141114151119152443
out 20072019201122181414814151319142343
jul 20072012131622151414713151320182543
abr 200720151415221713131615161618222443
jan 200719242412201712122014141715212243
out 200621181812201712121714141615191943
jul 200620101111201611111215161716172443
abr 200622162311231611111817192424183643
jan 2006272427162318992719202022244243
out 2005252018102013772415171819214043
jul 2005241519101911551413131717193843
abr 200521161572010441813121515123643
jan 20052713145319332834322518111541
out 20042319185248223127252398837
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100ediçõesbytes
 WikiquotariansArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikiquotarians (usuários registrados)
A = Wikiquotarians que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikiquotarians que editaram pelo menos dez vezes desde que chegaram
C = Wikiquotarians que contribuíram cinco vezes ou mais este mês
D = Wikiquotarians que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  5  10  100  1  3  5  10  25  5  10  100  1  3  5  10  25  100  250  5  10  100 
fev 201411444431   5332    10542      
jan 201423874311   821     145431     
dez 201322854422   8443    165221     
nov 201312622211   62111   164322     
out 20131774321    521     1022       
set 20131443311111 6211    95442     
ago 2013201297631   6411    722221    
jul 2013158732    43      10411      
jun 201315864  21 3       6      1  
mai 20131811841    62      92211     
abr 2013187421 11 42      10311   1  
mar 2013115211    1       10221      
fev 201395311    62   11 10331   11 
jan 2013187631 22 3    11 8      11 
dez 2012166311 1  2    2  102        
nov 20121331   11      11 5         
out 201214322  22 5    11 7311   11 
set 2012113111 21 21   1  722    11 
ago 2012166431 11 41   11 722       
jul 2012187641 32 7321 11 952    11 
jun 2012186321 11 5    11 52211     
mai 2012189532 11 842  11 9421   1  
abr 2012179652 21 41   111511    2  
mar 20122273311 22 811  11110522   1  
fev 20121662   22 3111 11 11321   32 
jan 20122584   22 41   11161     11 
jan 201423874311   821     145431     
out 20131774321    521     1022       
jul 2013158732    43      10411      
abr 2013187421 11 42      10311   1  
jan 2013187631 22 3    11 8      11 
out 201214322  22 5    11 7311   11 
jul 2012187641 32 7321 11 952    11 
abr 2012179652 21 41   111511    2  
jan 20122584   22 41   11161     11 
out 20111752   22171   111932    11 
jul 20111641   11 31      722    11 
abr 2011198521 11 41      6211      
jan 201124129643133 103332   116332  1  
out 201028874  11 5111    12111      
jul 2010176541 11 4       1         
abr 2010209431 32 311     84211     
jan 2010217522 11 21      72221  1  
out 2009136422 2225221    83221     
jul 2009208643 1  322     104311     
abr 2009198642 11 532     126533  111
jan 2009136532 22 3111    104321     
out 20081710621 11 411     85411     
jul 20081711742    511     72211  11 
abr 20081397542122 104311   84442     
jan 200815117532111 95521   74221     
out 20071253211122211222    112221     
jul 200712864111   533     432111    
abr 200797442    3111    53322     
jan 200752211    3111    43222     
out 2006853211    2221    32222     
jul 20061286542    93221   933221 11 
abr 2006106222    7331    6321      
jan 200652111    3111    211111 11 
out 20051111             11        
jul 200521111            11111  11 
abr 20051111     1       211111    
jan 2005                          
out 2004                          

 

Distribuição de edições de artigos por wikiquotarians
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikiquotariansEdições total
1728100.0%21,911100.0%
327137.2%21,19096.7%
1013618.7%20,41393.2%
32435.9%18,89086.2%
100212.9%17,85181.5%
316111.5%16,28674.3%
100050.7%12,85258.7%
316210.1%6,22328.4%

 

11 wikiquotarians recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions
agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
Sonia SevillaUC2 02,39630437945set 10, 2010126614815--
RAHA68UC4 01,30515715311abr 30, 2012668495--
MahanUC13...2012013131fev 16, 20141199--
SialkgraphUC14-1182283-jul 23, 2013219122--
CommonsDelinkerUC25+161324-mai 13, 20072482----
Ashkan P.UC26-1611211nov 03, 201248114---
MRG90UC80+2171--ago 12, 20131993---
Vahid.shirUC81+217111-jan 17, 2014411---
AmirrezaUC111+211225-jul 25, 2009167841--
Khashi2010UC727...11--fev 16, 201411----
Parham 80UC728...11--fev 16, 201411----

 

20 wikiquotarians recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
AmouzandehUC16,223abr 11, 20062879mai 31, 20101368
SajadUC31,819mar 26, 20053260jan 04, 201454
MardetanhaUC51,109ago 08, 20072395jan 04, 201454
مهدیUC6711fev 05, 20091848jan 27, 2013396
Jamal NazarethUC7665fev 01, 20111122abr 21, 20111043
JDiamondUC8664set 05, 20091636fev 01, 20111122
TaranetUC9554jan 13, 20082237jul 01, 2012606
WayiranUC10445abr 24, 20082135mai 30, 20111004
BilijacksUC11395nov 16, 20062660nov 10, 2012474
Ahura21UC12266mai 24, 20111010out 12, 2013138
AbsdostanUC15150set 13, 20091628jan 02, 2012787
RabinsonUC16145out 11, 20081965jun 16, 20101352
ShervinafsharUC17137nov 11, 20053030dez 25, 201364
SahimUC18133ago 04, 20101303jan 09, 2012780
Hard BackrestUC19130dez 31, 20081884dez 04, 201385
FollowerrUC20113jan 09, 20111145mai 11, 20111023
Mahnaz92UC21108jun 12, 2013260ago 06, 2013205
Sahand AceUC2273dez 09, 201380jan 05, 201453
SpidajUC2367mai 12, 20101387nov 12, 2011838
همانUC2463ago 03, 20082034mai 10, 20111024

 

usuários anônimos, ordenados por número de contribuições
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
85.185.1.4160
85.185.1.1462
217.219.137.1962
2.186.172.13939
80.71.114.3533
31.58.225.15229
80.75.8.11427
217.219.12.13126
188.158.107.2626
217.219.1.926

No total 4.018 edições foram feitas por usuários anônimos, de um total de 31.760 edições ( 12e %)
  


24 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
AnankeBotUC11,350dez 18, 20081897set 16, 2013164--
TanhabotUC21,196abr 23, 20082136dez 08, 20101177--
ChtitBotUC3966set 08, 20072364fev 06, 20111117--
EleferenBotUC4464fev 13, 20101475jan 13, 2013410--
SahimrobotUC5413ago 14, 20101293ago 15, 20101292--
FaraBotUC6347out 11, 20072331out 11, 20072331--
KamikazeBotUC7259dez 17, 20101168dez 09, 2011811--
ArthurBotUC8157out 14, 20091597dez 02, 20091548--
MerlIwBotUC9133jul 26, 2012581jun 14, 2013258--
LaaknorBotUC10119out 23, 20081953jan 20, 2013403--
AvicBotUC1188ago 11, 2011931set 07, 2011904--
Idioma-botUC1282mar 02, 20111093jul 16, 2012591--
VolkovBotUC1352jun 30, 20091703abr 16, 2012682--
MjbmrbotUC1446fev 04, 20111119mar 27, 20111068--
CarsracBotUC1543mar 19, 20111076abr 15, 2013318--
DinybotUC1617mar 24, 20072532dez 16, 20072265--
Sir Nicholas de Lenfent BotUC1715abr 09, 20101420abr 19, 20101410--
FiriBotUC1813jan 09, 20111145jan 09, 20111145--
ChobotUC199dez 04, 2012450mar 13, 2013351--
KgsbotUC207dez 13, 20101172jan 18, 20111136--
AmolbotUC213dez 07, 20101178dez 07, 20101178--
EdwardsBotUC222jul 03, 2011970jul 03, 2011970--
RezabotUC231out 18, 2011863out 18, 2011863--
AvocatoBotUC241abr 17, 2012681abr 17, 2012681--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110GifJpgPngSvg
fev 20142,7 k7751,7 k1001,4 k4571665      674367291
jan 20142,7 k7651,7 k1001,4 k4521656      797367291
dez 20132,6 k7531,7 k1001,4 k4511642      729367291
nov 20132,4 k7461,7 k1001,4 k4511636      552367291
out 20132,3 k7361,7 k1001,4 k4431610      264367291
set 20132,2 k7271,7 k1001,4 k4431608      419367291
ago 20132,2 k6991,7 k991,4 k4421592      982366291
jul 20132,2 k6931,7 k971,4 k4291489      173364291
jun 20132,1 k6831,7 k961,4 k4291489      76364281
mai 20132,1 k6771,7 k961,4 k4281489      107364281
abr 20132,1 k6711,7 k961,4 k4281489      88364281
mar 20132,1 k6641,7 k961,4 k4261485      78364281
fev 20132,1 k6521,7 k961,4 k4261483      80364281
jan 20132,1 k6421,6 k961,4 k4261480      106364281
dez 20122,1 k6361,6 k961,4 k4261480      74364281
nov 20122,0 k6261,6 k951,4 k4261480      25363281
out 20122,0 k6221,6 k951,4 k4261479      49363281
set 20122,0 k6161,6 k951,4 k4261478      62363281
ago 20122,0 k6051,6 k951,4 k4261478      87363281
jul 20122,0 k5931,6 k951,4 k4261476      104363281
jun 20122,0 k5861,6 k951,4 k4251476      77363281
mai 20122,0 k5601,6 k951,4 k4251476      134363281
abr 20121,9 k5511,6 k941,4 k4251476      164362281
mar 20121,9 k5381,6 k941,4 k4251476      164362281
fev 20121,9 k5301,6 k941,4 k4251476      42362281
jan 20121,9 k5111,6 k941,4 k4231476      65362281
dez 20111,9 k5041,6 k941,4 k4231475      97362281
nov 20111,9 k4991,6 k941,4 k4211475      106362281
out 20111,9 k4831,6 k941,4 k4201473      40362281
set 20111,9 k4701,6 k941,4 k4181473      70362281
ago 20111,9 k4551,6 k941,4 k4161472      36362281
jul 20111,9 k4481,6 k941,4 k4141472      35362281
jun 20111,9 k4341,6 k941,4 k4141468      79362281
mai 20111,9 k4241,6 k941,4 k4141468      60362281
abr 20111,9 k4071,6 k941,4 k4121468      98362281
mar 20111,8 k3951,6 k941,4 k4121468      304362281
fev 20111,8 k3871,6 k841,4 k4051465      620253281
jan 20111,6 k3481,6 k561,4 k3751447      742129251
dez 20101,5 k3401,6 k481,4 k3621406      51121251
nov 20101,5 k3361,6 k481,4 k3621406      113121251
out 20101,5 k3301,6 k481,4 k3611405      118121251
set 20101,5 k3211,6 k481,4 k3561405      204121251
ago 20101,5 k3131,6 k431,4 k3521398      205116251
jul 20101,4 k2941,6 k421,4 k2701392      105115251
jun 20101,4 k2941,6 k411,4 k2701392      58114251
mai 20101,4 k2661,6 k411,4 k2701392      110114251
abr 20101,4 k2601,6 k411,4 k2701392      106114251
mar 20101,4 k2491,5 k411,4 k2701392      63114251
fev 20101,4 k2461,5 k411,4 k2671389      118114251
jan 20101,3 k2421,5 k401,4 k2671388      11111425 
dez 20091,3 k2231,4 k401,4 k2671388      7211425 
nov 20091,3 k2161,4 k391,4 k2671388      12011325 
out 20091,3 k2141,4 k391,4 k2671388      19111325 
set 20091,3 k2091,4 k381,4 k2671384      22311324 
ago 20091,2 k1961,3 k381,4 k2651382      12711324 
jul 20091,2 k1961,3 k381,4 k2651382      17011324 
jun 20091,2 k1901,3 k381,4 k2621382      10911324 
mai 20091,1 k1881,2 k381,4 k2601381      10111324 
abr 20091,1 k1861,2 k381,4 k2601381      17811324 
mar 20091,1 k1721,2 k371,4 k2321367      44411224 
fev 20091,1 k1551,2 k331,4 k1821215      3961923 
jan 20091,0 k1461,1 k321,4 k1821146      1441823 
dez 20089911431,1 k321,4 k1801142      2081823 
nov 20089721391,1 k321,4 k1791141      971823 
out 20089591191,0 k321,4 k1741135      1211823 
set 20089451051,0 k321,4 k1741135      1521823 
ago 2008914101973321,4 k1741134      3731823 
jul 200881697941301,4 k1701133      1551623 
jun 200879594911301,4 k1701131      1211623 
mai 200877887911301,4 k1701131      4671623 
abr 200872282880301,4 k1671127      5041623 
mar 200868878815291,4 k1591124      1481622 
fev 200868174785291,4 k1591124      5121622 
jan 200865268753271,4 k1591124      7151422 
dez 200759465723251,4 k1541105      4391222 
nov 200757961690241,4 k1491105      621221 
out 200757259690241,3 k1481105      3901221 
set 200755551629241,3 k1461105      7321221 
ago 200753043596241,3 k1411101      6081221 
jul 200751640564241,3 k132196      8791221 
jun 200749239532241,3 k130194      1651221 
mai 200747539500231,3 k86193      1481220 
abr 200746637447231,3 k86193      2091220 
mar 200744835409231,2 k84187      1941220 
fev 2007437343822276274171      84 220 
jan 2007432313572276274171      113 220 
dez 2006420313102272374171      139 220 
nov 2006414302962172340136      91 120 
out 2006397272462170437135      146 120 
set 2006378272102169337135      225 120 
ago 2006353261732166937135      173 120 
jul 2006335221322166433134      498 120 
jun 200627313952159328128      172 120 
mai 200623711652159327127      143 120 
abr 20062049352158127127      103 120 
mar 20061806182158127 24      124 120 
fev 20061355162056916 14      66 119 
jan 20061105152054614 14      40 119 
dez 2005954151953811 14      29 118 
nov 200578315195219 14      73 118 
out 20056421424946 14      17 11 
set 20056221414945 14      39  1 
ago 20054821314745 14      4  1 
jul 20054621314685 14      87  1 
jun 20051821014514 4      24  1 
mai 2005821013573 2      1  1 
abr 2005711013573 2      15  1 
mar 2005419 3573 2      10    
fev 20051   357              
jan 20051   357              
dez 20041   357              
nov 20041                  
out 20041                  
set 20041                  
ago 20041                  

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

ago 2004: 1 1 Main Page

mar 2005: 1 1 ضرب‌المثل‌های عربی

abr 2005: 1 1 آدولف هیتلر

mai 2005: 1 1 ضرب‌المثل‌های فارسی

jun 2005: 1 2 آقامحمدخان قاجار , 2 2 عزیز نسین , 3 2 صفحهٔ اصلی , 4 1 محمود احمدی‌نژاد

jul 2005: 1 2 ناشناس , 2 1 ویلیام فالکنر

ago 2005: 1 2 صفحهٔ اصلی , 2 1 فهرست بر اساس فيلم‌ها

set 2005: 1 3 صفحهٔ اصلی , 2 2 علی بن ابی‌طالب , 3 2 ناشناس , 4 1 ارنستو چه گوارا

out 2005: 1 1 فهرست افراد براساس نام

nov 2005: 1 2 کورش مدرسی , 2 2 منصور حکمت , 3 2 حمید تقوایی , 4 2 محمود احمدی‌نژاد , 5 1 دوگ لارسون

dez 2005: 1 1 امبرتو اکو

jan 2006: 1 2 اپیکور , 2 2 ارنستو چه گوارا , 3 1 کانت

fev 2006: 1 2 آلبر کامو , 2 2 زیلاکس , 3 1 محمدتقی مصباح یزدی

mar 2006: 1 2 توماس جفرسون , 2 2 ماتریکس , 3 2 فهرست آثار ادبی , 4 2 فهرست افراد بر اساس نام , 5 2 صفحهٔ اصلی , 6 1 کارلوس کاستاندا

abr 2006: 1 4 صفحهٔ اصلی , 2 3 هرمان هسه , 3 2 مارتین لوتر , 4 2 ضرب‌المثل‌های هلندی , 5 2 استانیسلاو لم , 6 2 ارنست همینگوی , 7 2 مایکل جکسون , 8 2 آلبرت اینشتین

mai 2006: 1 2 رابرت آنسون هاین‌لاین , 2 2 رفیق شامی , 3 2 جلال‌الدین محمد بلخی , 4 2 داگلاس آدامز , 5 2 فرانسوا لارشفوکو , 6 2 ضرب‌المثل‌های لاتینی , 7 2 واشنگتن ایروینگ , 8 2 توماس جفرسون , 9 1 محمد خیابانی

jun 2006: 1 2 فرانسوا فنلون , 2 2 ژان دو لافونتن , 3 2 وینستون چرچیل , 4 2 فهرست افراد بر اساس نام , 5 2 صفحهٔ اصلی , 6 1 رنه دکارت

jul 2006: 1 3 هلن کلر , 2 3 آیان حرصی علی , 3 3 آرزو , 4 3 آندره ژید , 5 3 آرتور شوپنهاور , 6 2 سید مرتضی آوینی , 7 2 الویس پریسلی , 8 2 مسیر سبز , 9 2 کازابلانکا , 10 2 رستگاری در شاوشنک , 11 2 ژولیا کریستوا , 12 2 محمود فلکی , 13 2 منوچهر آتشی , 14 2 جنگ عراق , 15 2 باباطاهر , 16 2 ویلیام سارویان , 17 2 کارل سندبرگ , 18 2 اقبال لاهوری , 19 2 فدریکو فلینی , 20 2 فریدریش شیلر , 21 2 رنه دکارت , 22 2 امیرخسرو دهلوی , 23 2 علی‌اکبر دهخدا , 24 2 کندورسه , 25 2 افلاطون

ago 2006: 1 3 ضرب‌المثل‌های آذربایجانی , 2 3 صفحهٔ اصلی , 3 2 صادق هدایت , 4 2 سووشون , 5 2 شازده کوچولو , 6 1 محمدحسین شهریار

set 2006: 1 4 صفحهٔ اصلی , 2 3 فهرست افراد بر اساس نام , 3 2 بيل گيتس , 4 2 ضرب‌المثل‌های آذربایجانی , 5 2 عمر خیام , 6 2 حافظ , 7 2 میکل‌آنژ , 8 2 محمود احمدی‌نژاد , 9 1 شهریار

out 2006: 1 2 ژان پل , 2 2 حسن تقی‌زاده , 3 2 ضرب‌المثل‌های آذربایجانی , 4 2 حافظ , 5 2 وودی آلن , 6 2 سعدی , 7 2 فهرست افراد بر اساس نام , 8 1 فرانکا ماگنانی

nov 2006: 1 2 باران کوثری , 2 2 کارل گوستاو یونگ , 3 2 برتولت برشت , 4 2 فهرست افراد بر اساس نام , 5 2 صفحهٔ اصلی , 6 1 محمدرضا شفیعی کدکنی

dez 2006: 1 2 غلامرضا روحانی , 2 2 باران کوثری , 3 2 دنیای سوفی , 4 2 جنگ , 5 2 آلبرت اینشتین , 6 2 فهرست آثار ادبی , 7 1 ریچارد رورتی

jan 2007: 1 3 پدرخوانده , 2 2 ریچارد نیکسون , 3 2 نیکوس کازانتزاکیس , 4 2 ری بردبری , 5 2 محمد زکریای رازی , 6 2 محمود احمدی‌نژاد , 7 2 صفحهٔ اصلی , 8 1 ضرب‌المثل‌های اندونزیایی

fev 2007: 1 2 قیصر , 2 2 صفحهٔ اصلی , 3 1 انجیل متی

mar 2007: 1 3 لودویگ وان بتهوون , 2 3 فریدریش نیچه , 3 2 رمکو کامپرت , 4 2 محمدرضا شفیعی کدکنی , 5 2 کلیم کاشانی , 6 2 بایگانی نقل‌قول روز , 7 2 سعدی , 8 2 صفحهٔ اصلی , 9 1 وگ:وگ

abr 2007: 1 3 فریدریش نیچه , 2 2 داستان یک سیندرلا , 3 2 کما , 4 2 تقاطع , 5 2 مهمان , 6 2 اخراجی‌ها , 7 2 فریدون جنیدی , 8 2 ابوریحان بیرونی , 9 2 وحید قزوینی , 10 2 عمر خیام , 11 2 فردوسی , 12 2 جلال‌الدین محمد بلخی , 13 2 مارتین لوتر

mai 2007: 1 2 راه بی‌پایان , 2 2 تله , 3 2 میم مثل مادر , 4 2 هنر , 5 2 جورج برنارد شاو , 6 2 فهرست آثار ادبی , 7 2 ناشناس , 8 1 اسدی طوسی

jun 2007: 1 2 جان رید , 2 2 مائو تسه تونگ , 3 2 باران کوثری , 4 2 محمد خیابانی , 5 2 عشق , 6 1 سرمایه‌داری

jul 2007: 1 2 سگ , 2 2 گربه , 3 2 عباس کیارستمی , 4 2 نیکلا سارکوزی , 5 2 روز سوم , 6 2 فریدریش انگلس , 7 2 مائو تسه تونگ , 8 2 فریدون جنیدی , 9 2 کارل مارکس , 10 2 سیسرو , 11 2 ضرب‌المثل‌های آلمانی , 12 2 علی شریعتی , 13 2 عشق , 14 1 کد داوینچی

ago 2007: 1 3 سیاست , 2 3 ضرب‌المثل‌های فارسی , 3 2 کریستین بویین , 4 2 سید روح‌الله خمینی , 5 2 ازدواج , 6 2 آزادی , 7 2 ولادیمیر لنین , 8 2 کارل مارکس , 9 2 علویه خانم , 10 2 ضرب‌المثل‌های اسپانیایی , 11 2 سید مرتضی آوینی , 12 2 داگلاس آدامز , 13 2 هنر , 14 2 دانش , 15 2 دوستی , 16 2 جنگ , 17 1 سنگسار

set 2007: 1 3 لئون تروتسکی , 2 3 محمود احمدی‌نژاد , 3 2 شتر , 4 2 مزرعه حیوانات , 5 2 ۱۹۸۴ , 6 2 ملالی جویا , 7 2 سید روح‌الله خمینی , 8 2 فاطمه زهرا/گفتار هایی از فاطمه زهرا , 9 2 فاطمه زهرا/اشعاری از شعرای کهن پیرامون فاطمه زهرا , 10 2 فاطمه زهرا/فاطمه زهرا در نگاه امامان شیعه , 11 2 ولادیمیر لنین , 12 2 ایرج‌میرزا , 13 2 اهلی شیرازی , 14 2 نقل‌قول روز , 15 2 باران کوثری , 16 2 ضرب‌المثل‌های ارمنی , 17 2 ضرب‌المثل‌های ایتالیایی , 18 2 افلاطون , 19 2 دانش , 20 2 آندره ژید , 21 2 جرج هربرت , 22 2 موریس مترلینک , 23 2 فهرست فیلم‌ها , 24 2 لئو بوسکالیا , 25 2 سورن کی‌یر کگارد

out 2007: 1 3 ژان دلا برویر , 2 2 آندری تارکوفسکی , 3 2 جان لاک , 4 2 شتر , 5 2 کارل مارکس , 6 2 باران کوثری , 7 2 ضرب‌المثل‌های ارمنی , 8 2 صادق هدایت , 9 2 ضرب‌المثل‌های آذربایجانی , 10 2 سنایی , 11 2 رقص , 12 2 فهرست فیلم‌ها , 13 1 مرکز موسیقی بتهوون

nov 2007: 1 3 علی بن ابی‌طالب , 2 2 داوید آلفارو سی‌که‌ایروس , 3 2 جیمز ناکس پولک , 4 2 ضرب‌المثل‌های آذربایجانی , 5 2 فیلم , 6 1 انقلاب

dez 2007: 1 5 فهرست افراد بر اساس نام , 2 4 دیوارنوشته , 3 4 ویلیام شکسپیر , 4 3 جلیل ضیاءپور , 5 3 خانه‌ای بر روی آب , 6 3 صلح , 7 3 فریدریش نیچه , 8 3 صفحهٔ اصلی , 9 2 ماهی , 10 2 انقلاب , 11 2 جورج دبلیو بوش , 12 2 محمدحسین شهریار , 13 2 ضرب‌المثل‌های آذربایجانی , 14 2 ضرب‌المثل‌های اسپانیایی , 15 2 فهرست نمایش‌های تلویزیونی , 16 2 ابن سینا , 17 2 عشق , 18 2 فهرست فیلم‌ها

jan 2008: 1 5 لوئیس بونوئل , 2 4 فهرست افراد بر اساس نام , 3 4 ضرب‌المثل‌های فارسی , 4 3 جنون , 5 3 محمدحسین شهریار , 6 3 ژان دارک , 7 3 محمود احمدی‌نژاد , 8 2 طبیعت , 9 2 جورج اورول , 10 2 مجنون , 11 2 زنبور , 12 2 مرگ , 13 2 خنده , 14 2 مکس پین , 15 2 کودک , 16 2 خوب، بد، زشت , 17 2 رومن رولان , 18 2 سیمین دانشور , 19 2 مادر , 20 2 فروغ فرخزاد , 21 2 کتاب , 22 2 عطار نیشابوری , 23 2 نیشابور , 24 2 جورج دبلیو بوش , 25 2 دنیای سوفی

fev 2008: 1 3 روشنفکر , 2 2 گل , 3 2 شراب , 4 2 سیمون دوبوار , 5 2 مرگ , 6 2 منیرو روانی‌پور , 7 2 فروغ فرخزاد , 8 2 کتاب , 9 2 تاریخ , 10 2 نقل‌قول روز , 11 2 نیکوس کازانتزاکیس , 12 2 ضرب‌المثل‌های ترکی , 13 2 ضرب‌المثل‌های آذربایجانی , 14 2 هنر , 15 2 عشق , 16 1 عارف قزوینی

mar 2008: 1 3 اورسن ولز , 2 3 فهرست افراد بر اساس نام , 3 2 مائو تسه‌دون , 4 2 سنگسار , 5 2 عشق , 6 2 کارلایل

abr 2008: 1 3 سید علی خامنه‌ای , 2 3 ژیل دلوز , 3 3 فهرست افراد بر اساس نام , 4 3 ناپلئون بناپارت , 5 3 صفحهٔ اصلی , 6 2 سید جمال‌الدین اسدآبادی , 7 2 محمد فضولی , 8 2 چنین گفت زرتشت , 9 2 تقی ارانی , 10 2 شارلوت برونته , 11 2 شیون فومنی , 12 2 فردریک هگل , 13 2 لوچیو کولتی , 14 2 هربرت مارکوزه , 15 2 نیکوس پولانزاس , 16 2 باروخ اسپینوزا , 17 2 گئورگ ویلهلم فریدریش هگل , 18 2 مگس , 19 2 جلیل ضیاءپور , 20 1 سید جمال الدین اسدآبادی

mai 2008: 1 6 فهرست افراد بر اساس نام , 2 3 حسین پناهی , 3 3 عشق , 4 3 صفحهٔ اصلی , 5 2 پروانه , 6 2 جورج گوردون بایرون , 7 2 پاپلی یزدی , 8 2 بلبل , 9 2 هانا آرنت , 10 2 دایره زنگی , 11 2 عارف قزوینی , 12 2 امیلی برونته , 13 2 دانش , 14 2 آرزو , 15 2 موریس مترلینک , 16 1 کسایی مروزی

jun 2008: 1 2 هنری دیوید تورو , 2 2 لنگستون هیوز , 3 2 ستارخان , 4 2 شراب , 5 2 سنگسار , 6 2 بزرگمهر , 7 1 مجوز مستندات آزاد گنو

jul 2008: 1 4 طاهره , 2 3 گوساله , 3 3 عباس کیارستمی , 4 3 فهرست افراد بر اساس نام , 5 2 مرد سوم , 6 2 نیمتاج سلماسی , 7 2 هوشنگ گلشیری , 8 2 نقش رستم , 9 2 تخت جمشید , 10 2 سید محمد طباطبائی , 11 2 رشحه , 12 2 حسین پناهی , 13 2 اورسن ولز

ago 2008: 1 3 بوسه , 2 2 داستان دو شهر , 3 2 سکوت , 4 2 ۱۷ فوریه , 5 2 گراهام گرین , 6 2 هانیبال الخاص , 7 2 شیخ فضل‌الله نوری , 8 2 صائب تبریزی , 9 2 آندری تارکوفسکی , 10 2 لودویگ وان بتهوون , 11 2 مارتین لوتر کینگ جونیور , 12 2 عشق , 13 2 آلبرت اینشتین , 14 2 محمود احمدی‌نژاد , 15 1 اریش فروم

set 2008: 1 3 گربه روی شیروانی داغ (نمایشنامه) , 2 2 امیر نادری , 3 2 محمدحسین پاپلی یزدی , 4 2 تنسی ویلیامز , 5 2 دیپاک چوپرا , 6 2 پاپلی یزدی , 7 1 ۲ مه

out 2008: 1 2 حسام‌الدین خویی , 2 2 علی‌اکبر طاهرزاده , 3 2 امام محمد غزالی , 4 2 علی اکبر دهخدا , 5 1 حسام الدین خویی

nov 2008: 1 4 فهرست افراد بر اساس نام , 2 2 باراک اوباما , 3 1 ژان سیبلیوس

dez 2008: 1 2 گروچو مارکس , 2 2 فردوسی

jan 2009: 1 3 محمد بن عبدالله , 2 2 امیلی دیکنسن , 3 2 گلادیاتور , 4 1 دزدان دريايي كارائيب

fev 2009: 1 3 زنان , 2 3 محمد علی کلی , 3 2 ماهواره امید , 4 2 حسن طبری آملی , 5 2 سید محمد‌کاظم شریعتمداری , 6 2 ولایت فقیه , 7 2 خلفای راشدین , 8 2 اردبیل , 9 2 شاهین نجفی , 10 2 دایره زنگی , 11 2 وحشی بافقی , 12 2 خیلی دور، خیلی نزدیک , 13 2 قیصر , 14 2 آلفونس کار , 15 2 پائولو کوئیلو , 16 1 محیط طباطبائی

mar 2009: 1 2 علی اکبر شیرودی , 2 2 بهارانه , 3 2 حسن لاهوتی اشکوری , 4 2 حسن طبری آملی , 5 2 شارلوت برونته , 6 2 حسین بن علی , 7 2 هاینریش هاینه , 8 2 گابریل گارسیا مارکز , 9 2 رنه دکارت , 10 2 ژان دو لافونتن , 11 2 رودکی , 12 2 ابن سینا , 13 2 عمر خیام , 14 2 استانیسلاو لم , 15 2 آلبر کامو , 16 2 تالس , 17 2 آلبرت اینشتین , 18 2 جورج برنارد شاو , 19 2 مارشال مک‌لوهان , 20 1 علی صیاد شیرازی

abr 2009: 1 4 فهرست افراد بر اساس نام , 2 3 حسین منصور حلاج , 3 2 ریچارد براتیگان , 4 2 آنا آخماتووا , 5 2 فروغ فرخزاد , 6 2 عطار نیشابوری , 7 2 سعدی , 8 2 یوهان ولفگانگ گوته , 9 2 آلبرت اینشتین , 10 2 منصور حکمت , 11 1 مهدی رجب بیگی

mai 2009: 1 5 فهرست افراد بر اساس نام , 2 2 عماد مغنیه , 3 2 صلح , 4 2 سید روح‌الله خمینی , 5 2 فردوسی

jun 2009: 1 2 تبریز , 2 2 جرج برناردشاو , 3 2 لئوناردو داوینچی , 4 2 دار و دسته‌های نیویورکی , 5 1 لئونارد داوینچی

jul 2009: 1 4 علی بن ابی‌طالب , 2 2 زنان , 3 2 استیون واینبرگ , 4 1 توماس هنری هاکسلی

ago 2009: 1 3 احمد مفتی‌زاده , 2 3 شعارهای مردم در اعتراض به نتیجه انتخابات ریاست جمهوری , 3 3 ضرب‌المثل‌های چینی , 4 2 گیتی نوین , 5 2 میرحسین موسوی , 6 2 آبراهام لینکلن , 7 1 یوسف صانعی

set 2009: 1 3 سید محمد خاتمی , 2 3 علی شریعتی , 3 3 فهرست افراد بر اساس نام , 4 2 در بروژ , 5 2 احمد مفتی‌زاده , 6 2 شعارهای مردم در اعتراض به نتیجه انتخابات ریاست جمهوری , 7 2 میرحسین موسوی , 8 2 دزدان دریایی کارائیب: صندوق مرد مرده , 9 2 حسین پناهی , 10 2 سید علی خامنه‌ای , 11 1 پیامک

out 2009: 1 2 خواب , 2 2 بهلول , 3 2 امام محمد باقر , 4 2 جعفر صادق , 5 2 میرحسین موسوی , 6 2 دنیای سوفی , 7 1 عبدالکریم سروش

nov 2009: 1 4 محمود احمدی‌نژاد , 2 2 ژان پل سارتر , 3 1 چه‌گوارا

dez 2009: 1 1 سید احمد علم‌الهدی

jan 2010: 1 2 ریاضی , 2 2 محمدرضا شجریان , 3 2 سید احمد علم‌الهدی , 4 2 اسفندیار رحیم‌مشایی , 5 2 میرحسین موسوی , 6 1 بیماری

fev 2010: 1 3 جنبش سبز , 2 2 علی رضا بدیع , 3 2 لئوناردو داوینچی , 4 2 فهرست فیلم‌ها , 5 1 پل ورلن

mar 2010: 1 2 شعارهای مردم در اعتراض به نتیجه انتخابات ریاست جمهوری , 2 2 فهرست افراد بر اساس نام , 3 1 کورش کوچک

abr 2010: 1 4 بهاءالله , 2 3 محمود احمدی‌نژاد , 3 2 هرات , 4 2 سید حسن فیروزآبادی , 5 2 میرحسین موسوی , 6 2 سید علی خامنه‌ای , 7 2 وینستون چرچیل , 8 1 پیامک

mai 2010: 1 2 بهاءالله , 2 2 محمدرضا شجریان , 3 2 فردوسی , 4 1 سلام

jun 2010: 1 3 سید روح‌الله خمینی , 2 2 کاظم صدیقی , 3 2 سید علی خامنه‌ای , 4 2 فهرست افراد بر اساس نام , 5 1 حاتم طایی

jul 2010: 1 2 خوزستان , 2 2 بدبیاری‌ها , 3 2 آین رند , 4 2 حسین الهی قمشه‌ای , 5 2 ضرب‌المثل‌های فارسی , 6 1 عین القضاة همدانی

ago 2010: 1 3 محمود احمدی‌نژاد , 2 2 آیزاک آسیموف , 3 2 چای , 4 2 تنباکو , 5 2 خلیج فارس , 6 2 خوزستان , 7 2 علی‌رضا بدیع , 8 2 آمریکا , 9 2 سید علی‌محمد دستغیب , 10 2 نیشابور , 11 2 محمدحسین شهریار , 12 2 امیرخسرو دهلوی , 13 1 پیامک

set 2010: 1 4 علی بن ابی‌طالب , 2 4 فهرست افراد بر اساس نام , 3 3 عمرو عاص , 4 3 باراک اوباما , 5 3 حسین بن علی , 6 2 جلال‌الدین فارسی , 7 2 ابوالحسن بنی‌صدر , 8 2 معاویه پسر ابی‌سفیان , 9 2 سهیل پسر عمرو , 10 2 میدان نقش جهان , 11 2 دمشق , 12 1 پیامک

out 2010: 1 2 قهوه تلخ , 2 2 عبدالجواد غرويان , 3 2 آنتون چخوف , 4 2 علی بن ابی‌طالب , 5 2 جکسون براون , 6 1 قهوه تلخ (سریال)

nov 2010: 1 3 قهوه تلخ , 2 3 جورج برنارد شاو , 3 2 غلامحسین ساعدی , 4 2 غلامعلی بسکی , 5 2 محسن قرائتی , 6 1 هارون‌الرشید

dez 2010: 1 2 سنگسار در اسلام , 2 2 وحشی بافقی , 3 2 فروغ فرخزاد , 4 2 علی بن ابی‌طالب , 5 1 لویی فردینان سلین

jan 2011: 1 3 علی‌رضا افتخاری , 2 3 فهرست فیلم‌ها , 3 3 علی بن ابی‌طالب , 4 3 محمود احمدی‌نژاد , 5 2 پیامک , 6 2 مهدی , 7 2 توبه , 8 2 رضی‌الدین نیشابوری , 9 2 ابرهه , 10 2 قاسم بن محمد , 11 2 عبدالله بن شبرمه , 12 2 شطرنج , 13 2 ابی بن کعب , 14 2 عایشه , 15 2 محمدجواد عزتی , 16 2 ابن عباس , 17 2 ابن قیم , 18 2 حسن بصری , 19 2 زین‌العابدین مراغه‌ای , 20 2 مصر , 21 2 خراسان , 22 2 زین‌العابدین بن علی , 23 2 سبزوار , 24 2 ضرب‌المثل‌های خراسانی , 25 2 شب‌های روشن

fev 2011: 1 3 خلیج فارس , 2 3 ایران , 3 2 معمر قذافی , 4 2 مأمون , 5 2 مشورت , 6 2 مدینه , 7 2 نام‌گذاری فرزند , 8 2 عمر بن خطاب , 9 2 ابوبکر , 10 2 عزت‌الله سحابی , 11 2 عبدالکریم سروش , 12 2 میرحسین موسوی , 13 2 محمدحسین پاپلی یزدی , 14 2 آنتون چخوف , 15 2 منوچهر آتشی , 16 2 عمر خیام , 17 1 شعارهای مردم لیبی در اعتراضات سال ۲۰۱۱

mar 2011: 1 4 علی بن ابی‌طالب , 2 3 محمدجواد عزتی , 3 3 عمر بن خطاب , 4 3 ابوبکر , 5 3 نیشابور , 6 3 آدولف هیتلر , 7 2 کیم وو چونگ , 8 2 طاهر بن حسین , 9 2 فاروق , 10 2 ابوعثمان سعید مغربی , 11 2 سید حسن مدرس , 12 2 نجم‌الدین اربکان , 13 2 روژه گارودی , 14 2 معمر قذافی , 15 2 قدس , 16 2 ادیب نیشابوری , 17 2 زبان عربی , 18 2 زبان فارسی , 19 1 ابو حفص حداد

abr 2011: 1 2 ابوسعید ابوالخیر , 2 2 ضرب‌المثل‌های خراسانی , 3 1 لودویک زامنهوف

mai 2011: 1 2 جفرسون دیویس , 2 2 خواجه عبدالله انصاری , 3 2 علویه خانم , 4 1 ناصر حجازی

jun 2011: 1 2 ابوبکر , 2 2 ایران , 3 1 آشنایی با مادر

jul 2011: 1 1 علی بن ابیطالب

ago 2011: 1 3 عمر بن خطاب , 2 2 کورش بزرگ , 3 1 میرزا حسین‌علی نوری

set 2011: 1 3 فهرست آثار ادبی , 2 2 جرم (فیلم) , 3 2 فرینج , 4 2 نیشابور , 5 2 کازابلانکا , 6 2 فهرست فیلم‌ها , 7 1 هوشنگ ایرانی

out 2011: 1 2 جدایی نادر از سیمین , 2 2 نیشابور , 3 1 اینشتین

nov 2011: 1 4 ازدواج , 2 3 مبارزه متعالی , 3 2 شعور خلاق , 4 2 کلام خلاق , 5 2 قضاوت , 6 1 یوحنای مجنون

dez 2011: 1 3 ایلیا میم , 2 2 پیمان فتاحی , 3 2 هامون , 4 2 محمدرضا پهلوی , 5 2 محمد مصدق , 6 2 مایکل جکسون , 7 1 مصطفی چمران

jan 2012: 1 3 ضرب‌المثل‌های فارسی , 2 2 علاءالدین ملماسی , 3 2 سید روح‌الله خمینی , 4 2 فریدون جنیدی , 5 2 فهرست فیلم‌ها , 6 1 هوپ‌هوپ‌نامه

fev 2012: 1 2 آمل , 2 1 طالب آملی

mar 2012: 1 2 پیمان فتاحی , 2 2 جلال‌الدین محمد بلخی , 3 2 مریلین منسون , 4 2 فهرست آثار ادبی , 5 2 فهرست افراد بر اساس نام , 6 1 اریک کانتونا

abr 2012: 1 5 ماهواره امید , 2 3 فهرست افراد بر اساس نام , 3 2 سکسوالیته , 4 2 بایزید بسطامی , 5 2 جانی دپ , 6 2 مذهب , 7 2 علی شریعتی , 8 1 شادی

mai 2012: 1 3 مارک تواین , 2 2 پرویز شهریاری , 3 2 شاهین نجفی , 4 2 جورج برنارد شاو , 5 2 فهرست افراد بر اساس نام , 6 1 کارل سیگن

jun 2012: 1 2 سیروان خسروی , 2 1 بابک خرمدین

jul 2012: 1 3 رضا پهلوی , 2 2 ارباب کمان نقره‌ای , 3 2 جورج برنارد شاو , 4 2 مارک تواین , 5 1 اتاقی از آن خود

ago 2012: 1 3 فهرست فیلم‌ها , 2 2 دیوانه‌ای از قفس پرید , 3 2 سفر به انتهای شب , 4 2 عمر بن خطاب , 5 2 هانا آرنت , 6 2 صادق هدایت , 7 2 ایمانوئل کانت , 8 1 زیستن چون پروانه

set 2012: 1 1 بهار ۶۳

out 2012: 1 1 ضرب‌المثل‌های کردی

nov 2012: 1 5 فهرست افراد بر اساس نام , 2 2 عمر بن خطاب , 3 1 محمود کریمی حکاک

dez 2012: 1 2 مصطفی دلشاد تهرانی , 2 2 فهرست افراد بر اساس نام , 3 1 امیر قلعه نویی

jan 2013: 1 3 عمر بن خطاب , 2 2 جورج اورول , 3 2 عشق , 4 2 فهرست افراد بر اساس نام , 5 1 لیلا صادقی

fev 2013: 1 2 ناجی علی , 2 2 آسیا عبدالله

mar 2013: 1 2 سید علی خامنه‌ای , 2 1 انیو موریکونه

abr 2013: 1 3 ماکسیمیلین فرانسوا ماری ایزیدور دو روبسپیر , 2 3 سن ژوست , 3 3 انیو موریکونه , 4 3 مختارنامه (مجموعه تلویزیونی) , 5 2 حرفه‌ای , 6 2 سید محمد‌کاظم شریعتمداری , 7 2 علی شریعتی , 8 1 عماد خراسانی

mai 2013: 1 4 دینو بوتزاتی , 2 4 آزادی , 3 3 عماد خراسانی , 4 3 ضرب‌المثل‌های بختیاری , 5 3 فریدون مشیری , 6 1 ماکسیم گورکی

jun 2013: 1 2 مالکوم لطیف شباز , 2 2 حسن روحانی , 3 1 آبراهام مازلو

jul 2013: 1 2 ایندیرا گاندی , 2 1 100 گفتار

ago 2013: 1 3 توماس هاکسلی , 2 3 حسن روحانی , 3 3 عمر بن خطاب , 4 3 ابوبکر , 5 2 محمد بن موسی خوارزمی , 6 2 داوید هیلبرت , 7 2 محمدعلی جمال‌زاده , 8 2 پینوکیو (فیلم) , 9 2 ناخدا خورشید , 10 2 باغ‌های کندلوس , 11 2 لودویگ ویتگنشتاین , 12 2 والتر اسکات , 13 2 راینر ماریا ریلکه , 14 2 نورعلی الهی , 15 2 کاشان , 16 2 البرت هوبارد , 17 2 ایندیرا گاندی , 18 2 دوایت آیزنهاور , 19 2 فرانک تایگر , 20 2 آلیس واکر , 21 2 سن ژوست , 22 2 پایتخت , 23 2 داریوش بزرگ , 24 2 گشت ارشاد , 25 2 شیخ بهائی

set 2013: 1 3 فهرست افراد بر اساس نام , 2 2 شمع , 3 2 زیرپوست شهر , 4 2 جیمز جویس , 5 2 گی دو موپاسان , 6 2 جان استاینبک , 7 2 ابوبکر کرجی , 8 2 آنه فرانک , 9 2 پینوکیو (فیلم) , 10 1 پاتریس لومومبا

out 2013: 1 2 استاد الهی , 2 2 پینوکیو (فیلم) , 3 2 نورعلی الهی , 4 2 ایرانی , 5 2 سید محمد خاتمی , 6 2 فهرست فیلم‌ها , 7 2 علی بن ابی‌طالب , 8 1 شمس تبریزی

nov 2013: 1 2 محمدجواد ظریف , 2 2 استاد الهی , 3 2 لودویگ ویتگنشتاین , 4 2 نورعلی الهی , 5 2 شطرنج , 6 2 عشق , 7 1 علی زین العابدین

dez 2013: 1 4 دانش , 2 3 جینا جیمسون , 3 3 ارتداد در اسلام , 4 3 سنگسار در اسلام , 5 3 جورج واشنگتن , 6 3 کورش بزرگ , 7 2 سفارت , 8 2 فریدریش هایک , 9 2 خرما , 10 2 نهنگ , 11 2 جوزف کمبل , 12 2 لوئیزا می آلکوت , 13 2 هشت صبح , 14 2 سید علی‌اصغر دستغیب , 15 2 نلسون ماندلا , 16 2 مبارزه متعالی , 17 2 بخشندگی , 18 2 ابوسعید ابوالخیر , 19 2 زکات , 20 2 شطرنج , 21 2 ناصر مکارم شیرازی , 22 2 میرزا کوچک خان جنگلی , 23 2 نماز (اسلام) , 24 2 زنان , 25 2 سکوت

jan 2014: 1 3 شاه اسماعیل دوم , 2 3 آلبرت اشپر , 3 3 علی‌رضا , 4 2 یاس (خواننده) , 5 2 آل کاپون , 6 2 پول , 7 2 اخلاق , 8 2 اراده , 9 2 جوانی , 10 2 حسادت , 11 2 تجربه , 12 2 طمع , 13 2 استبداد , 14 2 جهان , 15 2 بیابان , 16 2 حسن روحانی , 17 2 اندیشیدن , 18 2 عمر بن خطاب , 19 2 زیبایی آمریکایی , 20 2 انسان , 21 2 حسن بن علی , 22 2 زنان , 23 2 بوسه , 24 2 کودک , 25 2 آزادی

fev 2014: 1 3 ژوزه ساراماگو , 2 3 کورش بزرگ , 3 2 تحقیر , 4 2 کورت وانگات , 5 2 علی کریمی , 6 2 آلکساندر سولژنیتسین , 7 2 شمس تبریزی , 8 2 ملاله یوسف‌زی , 9 2 جان استاینبک , 10 2 صدام حسین , 11 2 گهواره گربه , 12 2 شوالیه تاریکی , 13 2 بغداد , 14 2 معمر قذافی , 15 2 حج , 16 2 ابوبکر , 17 2 حامد کرزی , 18 2 سجاد , 19 2 جعفر صادق , 20 2 ایران , 21 2 تهران , 22 2 محمدرضا پهلوی , 23 2 حسین بن علی , 24 2 مخمصه , 25 2 رستگاری در شاوشنک

Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Domingo, 30 de março 2014 21:34

Dump file fawikiquote-20140313-pages-meta-history.xml.7z (full dump), size 7.1 Mb as 7z -> 494 Mb
Dump processed till Feb 28, 2014, on server stat1002, ready at Sat-15/03/2014-14:25 after 1 min, 41 sec.

Versão do script:2.6
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.