Estatísticas da Wikiquote persa

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist

Metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.
See also metrics definitions


 
Monthly counts & Quarterly rankings: junho 2015
 
DataWikiquotariansArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
jun 2015+1%   +1%   -30%      0%
mai 2015+2%   +1%   +50%      +1%
abr 2015+1%   0%   -66%      0%
mar 2015+1%   +4%   +86%+2%+2%+2%+1%+5%+10%+1%
fev 2015+1%   0%   +92%0%0%+1%0%-0%0%0%
jan 2015+1%   0%   +96%-1%-1%-1%0%+1%-3%0%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
jun 201515615 3,0 k113,5 180      1,5 k
mai 201515538 3,0 k 13,5 258      1,5 k
abr 201515228 3,0 k 13,5 172      1,5 k
mar 20151502713,0 k413,5205651112 Mb1,2 M21 k2,3 k1,5 k3,7 k1,5 k
fev 20151481512,9 k 13,9209027512 Mb1,2 M20 k2,3 k1,4 k3,3 k1,5 k
jan 201514724 2,9 k 13,8208414311 Mb1,2 M20 k2,3 k1,4 k3,3 k1,5 k
dez 2014145 4 2,8 k 13,721087312 Mb1,2 M20 k2,3 k1,4 k3,4 k1,5 k
nov 2014145 7 2,8 k 13,7210712612 Mb1,2 M20 k2,3 k1,4 k3,4 k1,5 k
out 20141453612,8 k313,7210638912 Mb1,2 M20 k2,3 k1,4 k3,4 k1,5 k
set 20141421612,7 k714,1214976411 Mb1,2 M20 k2,3 k1,4 k3,2 k1,4 k
ago 201414148 2,5 k114,9227039311 Mb1,1 M20 k2,3 k1,3 k2,9 k1,4 k
jul 20141371612,5 k615,1233876311 Mb1,1 M20 k2,2 k1,3 k2,8 k1,3 k
jun 201413624 2,3 k 15,9237350410 Mb1,1 M19 k2,2 k1,3 k2,5 k1,2 k
mai 20141343922,3 k815,7237296810 Mb1,1 M19 k2,2 k1,3 k2,5 k1,2 k
abr 20141312922,0 k517,325992,5 k10 Mb1,0 M18 k2,1 k1,0 k2,0 k1,2 k
mar 2014129 621,9 k417,225911,0 k9,6 Mb967 k18 k13 k9121,7 k1,0 k
fev 20141292431,8 k117,826796809,3 Mb938 k17 k12 k8461,6 k928
jan 20141271611,7 k117,727028509,2 Mb929 k17 k12 k8231,5 k908
dez 20131261521,7 k117,626867528,9 Mb902 k16 k12 k8001,3 k828
nov 2013125 211,7 k217,626665938,6 Mb873 k15 k11 k7491,2 k756
out 2013125 411,6 k 17,928132778,8 Mb890 k15 k10 k6971,2 k625
set 20131251311,6 k117,828145298,7 Mb886 k15 k9,9 k6351,1 k617
ago 20131242831,6 k117,828209968,6 Mb876 k14 k9,2 k5951,1 k614
jul 201312216 1,5 k117,629221838,5 Mb854 k14 k9,1 k528963601
jun 201312146 1,5 k 17,829532098,4 Mb849 k14 k9,1 k521953594
mai 201311738 1,5 k 17,729461238,4 Mb844 k14 k9,0 k521943594
abr 201311424 1,5 k 17,729441698,4 Mb842 k14 k9,0 k522944593
mar 201311222 1,5 k 17,729321368,3 Mb830 k14 k8,9 k520924587
fev 2013110 3 1,5 k 17,72905968,1 Mb818 k14 k8,9 k521912577
jan 201311026 1,5 k 17,729182538,1 Mb816 k14 k8,9 k522915577
dez 201210823 1,5 k 17,628311067,9 Mb788 k14 k8,8 k522909571
nov 2012106 1 1,5 k 17,62827747,9 Mb784 k14 k8,7 k520884570
out 201210612 1,5 k 17,628371167,9 Mb785 k14 k8,7 k522879570
set 201210511 1,4 k117,628281787,8 Mb778 k14 k8,7 k522879569
ago 201210414 1,4 k117,828551797,8 Mb773 k14 k8,7 k521873569
jul 201210316 1,4 k 17,928792837,7 Mb770 k14 k8,6 k522846566
jun 201210213 1,4 k 17,828831617,7 Mb766 k14 k8,5 k522841564
mai 201210115 1,4 k 17,929032197,6 Mb763 k13 k8,4 k522836563
abr 201210026 1,4 k117,929072667,5 Mb756 k13 k8,3 k517811563
mar 20129823 1,3 k 1829352947,5 Mb753 k13 k8,2 k515793560
fev 20129612 1,3 k 17,829521597,5 Mb756 k13 k8,2 k520794558
jan 20129534 1,3 k 17,729431487,5 Mb753 k13 k8,1 k518794557
dez 20119217 1,3 k 17,729451497,4 Mb751 k13 k8,1 k517784555
nov 20119136 1,3 k 17,728371667,2 Mb719 k13 k8,1 k515776552
out 201188 2 1,3 k 17,628012237,0 Mb706 k13 k8,0 k515767552
set 20118814 1,3 k 17,527981257,0 Mb705 k13 k7,8 k514768551
ago 20118712 1,3 k 17,528021337,0 Mb704 k13 k7,8 k511757550
jul 201186 1 1,3 k 17,427871527,0 Mb700 k13 k7,8 k511758549
jun 20118623 1,3 k 17,427911316,9 Mb696 k13 k7,7 k508744546
mai 20118414 1,3 k 17,427831146,9 Mb691 k13 k7,6 k513737543
abr 201183 5 1,3 k 17,327702046,8 Mb686 k13 k7,6 k512733541
mar 20118337 1,3 k117,327645806,8 Mb680 k13 k7,5 k513725538
fev 2011803711,3 k31727096786,6 Mb658 k13 k7,4 k469685507
jan 2011774931,2 k317,727408716,3 Mb619 k13 k7,3 k346640440
dez 201073 2 1,1 k 18,227914606,0 Mb581 k12 k7,1 k304602394
nov 20107325 1,1 k 17,927752256,0 Mb576 k12 k7,0 k302574394
out 20107137 1,1 k 17,827701775,9 Mb572 k12 k6,9 k300566385
set 20106857 1,1 k 17,727602815,9 Mb568 k12 k6,9 k298548383
ago 20106316 1,1 k117,727427225,7 Mb559 k12 k6,8 k279521376
jul 20106245 1,1 k 17,326961785,6 Mb539 k12 k6,8 k273493370
jun 20105815 1,0 k 17,227001215,5 Mb536 k12 k6,7 k272488368
mai 20105716 1,0 k 17,326671575,4 Mb524 k12 k6,7 k272479367
abr 20105614 1,0 k 17,426692235,4 Mb519 k12 k6,7 k272425367
mar 201055 5 1,0 k 17,427162205,3 Mb523 k12 k6,6 k269412365
fev 20105547 997 17,427382265,3 Mb520 k12 k6,5 k268400364
jan 201051 5 985 17,327183445,2 Mb510 k12 k6,3 k263393356
dez 20095124 970 17,326381935,0 Mb487 k12 k6,3 k261377354
nov 20094914 960 17,226352354,9 Mb483 k12 k6,2 k260377353
out 200948 3 954117,125665154,8 Mb467 k12 k6,2 k258343344
set 20094827 933116,925092724,6 Mb449 k12 k6,0 k255316333
ago 20094617 904 17,225241,0 k4,5 Mb440 k12 k5,8 k254299324
jul 20094516 898116,124442004,4 Mb423 k12 k5,8 k251277322
jun 20094413 854116,725891574,3 Mb416 k11 k5,8 k253261314
mai 20094325 812 17,426362624,2 Mb415 k11 k5,7 k250260308
abr 200941 6 809 17,126343004,2 Mb413 k11 k5,6 k252256303
mar 200941151802 16,926264934,2 Mb407 k11 k5,6 k252254298
fev 200940371793116,526134394,1 Mb398 k11 k5,5 k222238277
jan 20093715 774116,325942314,0 Mb388 k11 k5,4 k215214239
dez 200836141751 16,526423063,9 Mb383 k11 k5,3 k215212237
nov 200835 4 739 16,426551473,9 Mb379 k11 k5,2 k212200230
out 200835 6 731 16,426461733,8 Mb374 k11 k5,1 k209193225
set 20083516 726116,226562483,8 Mb374 k11 k5,1 k208192217
ago 200834172698316,526784223,7 Mb364 k10 k4,9 k207171214
jul 200833 7 61811829461793,6 Mb355 k9,9 k4,7 k191168196
jun 20083315 598 18,329851403,5 Mb347 k9,8 k4,6 k188162195
mai 200832271586218,429935673,5 Mb342 k9,7 k4,5 k185149190
abr 200830272536119,130606473,2 Mb318 k8,7 k4,4 k169107184
mar 200828 5 512 18,730082233,0 Mb299 k7,7 k4,2 k16090174
fev 200828141507118,430036033,0 Mb296 k7,7 k4,1 k15887172
jan 200827372484118,128898272,8 Mb273 k6,6 k4,1 k14285166
dez 200724381448 17,728224972,5 Mb246 k5,5 k3,9 k12668145
nov 200721 4 435 17,127921192,4 Mb238 k4,9 k3,8 k12167143
out 200721131429 1728479302,4 Mb239 k4,9 k3,7 k12365142
set 200720151417 15,327819322,3 Mb228 k4,2 k3,5 k10755137
ago 200719 51404 13,526356592,1 Mb210 k3,4 k2,7 k6354125
jul 200719261396112,125019112,0 Mb196 k3,1 k2,5 k5042119
jun 200717 21377 10,322761851,7 Mb171 k1,6 k2,4 k3739114
mai 200717 3 366 10,122471951,6 Mb164 k1,5 k2,3 k2838108
abr 20071714 361 9,722102761,6 Mb158 k1,4 k2,3 k2738104
mar 200716 21346 9,322052601,5 Mb150 k1,3 k2,2 k2631101
fev 200716 1 341 8,722141201,5 Mb143 k1,2 k2,1 k273195
jan 200716 2 338 8,421751591,4 Mb139 k1,2 k2,1 k263193
dez 20061613 329 8,121231791,3 Mb131 k1,1 k2,0 k263090
nov 20061524 326 7,720881441,3 Mb127 k1,1 k1,9 k252987
out 200613 3 311 7,620901991,2 Mb123 k1,1 k1,9 k242785
set 200613 5129617,320252971,2 Mb115 k9781,8 k232281
ago 20061313 28016,71729205985 kb96 k8551,6 k231972
jul 20061236226216,31555511847 kb83 k7951,5 k221672
jun 20069 2 230151285191642 kb59 k46887618443
mai 2006912 20014,81198163544 kb43 k20883415337
abr 2006812 17214,61114129402 kb37 k18672212232
mar 2006713 15214,41051182324 kb32 k16558111 28
fev 2006612 11314,3131089304 kb29 k1664443 22
jan 20065 1 95 4,1152349290 kb28 k1654132 15
dez 20055 1 8314,1176141284 kb28 k1653672 12
nov 2005523 67 4,5200887265 kb27 k1602682 11
out 20053 1 55 3,9223721248 kb25 k1572232 9
set 2005312 54 3,6221744243 kb25 k1281971 8
ago 20052   43 3,527665236 kb24 k1251521 5
jul 20052 1 4213,5288687236 kb24 k1251521 4
jun 20052 2 16 3,6737526225 kb23 k86134  2
mai 20052   6 5,3176334221 kb23 k86133  2
abr 2005211 6 4,71762817220 kb23 k86133  1
mar 20051 1 3 3,71981410134 kb15 k8474  1
fev 20051      445 1,9 kb77 106 91
jan 20051      445 1,9 kb77 106 91
dez 20041      445 1,9 kb77 106 91
nov 20041      445 1,9 kb77 106 91
out 20041      445 1,9 kb77 106 91
set 20041      445 1,9 kb77 106 91
ago 200411     44511,9 kb77 106 91
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
The following table ranks this project in relation to projects in other languages with 1000+ articles
abr 201513108 14 18 19      39
jan 2015139161514161811211111131361039
out 20141351061451811111111131461039
jul 2014131210815314961111131561039
abr 2014131010818312881111131761339
jan 20141313121020911881112131871539
out 201313171262014871511121321101739
jul 201313111192081061511121424122039
abr 201313912112011861611121424121939
jan 201313912151914862411121424121839
out 2012131523141916762611121322121839
jul 2012131312131913761811131322121839
abr 20121391413198751711131322121639
jan 201214812121912751811121122121639
out 2011141922121911762511131122111639
jul 201114192312191486231113111991639
abr 20111417139191286191112111991539
jan 20111568520586712121119111539
out 20101671272012761612131119111539
jul 201016713122013762012131119111639
abr 2010171613132011761412131019111739
jan 201018171211201320201312131019111739
out 20091718171920720201813151019111739
jul 20091714101020919191513151019111839
abr 200918161112211419191612151018111839
jan 200918171412211019191712151018101739
out 200818201311211219191912151018101839
jul 200818211313221019191812151019101839
abr 20081911126221018181013151019102239
jan 200819711622121616111415121992439
out 2007191818922161515814151419102339
jul 20071912121322101515713151420122539
abr 200719131315221614141615171719142439
jan 200718212313201913132116151716132239
out 200618191715201813131715151716111939
jul 20061891110201412121217171817112439
abr 200620111910231412121819202221143439
jan 2006242123162217992321201920203839
out 2005231915101912772116161617153639
jul 200523141610189551312131517153539
abr 200521121572311441813121516103339
jan 200523141343310332629272116101237
out 20042118205279222624232076531
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100ediçõesbytes
 WikiquotariansArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikiquotarians (usuários registrados)
A = Wikiquotarians que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikiquotarians que editaram pelo menos dez vezes desde que chegaram
C = Wikiquotarians que contribuíram cinco vezes ou mais este mês
D = Wikiquotarians que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  5  10  100  1  3  5  10  25  100  5  10  100  1  3  5  10  25  100  250  5  10  100 
jun 2015139531     3        822    211
mai 20151812843     61    11 32111  221
abr 20152111842     11521  3321132    331
mar 2015191274311    128731 2211076421 221
fev 201517105221     17843  111199511  11 
jan 2015219442     85       932       
dez 201418742      73311111 3         
nov 2014248721     62    111143     11 
out 201416116431     94321 11 12322211   
set 201419764211    134111 11 1132221    
ago 20142412876     72111 111104111     
jul 201417865211    811      94322     
jun 2014135422  11197521 11 102211  11 
mai 2014201194221    532      63211     
abr 201425129522212226411     124411  111
mar 2014211065421    84431    145511     
fev 201411444431    5332     7322      
jan 201422764311    821      114421     
dez 201322854422    8443     94221     
nov 201310622211    52111    133211  11 
out 20131564321     421      922       
set 201314433111 11 6211     85441     
ago 2013181186431 11 6411     622221    
jul 2013147632     43       10311      
jun 201315864   21 3        5      1  
mai 20131711841     62       82211     
abr 2013187421  11 42       10311   1  
mar 2013115211     1        10221      
fev 201395311     62    11 8321   11 
jan 2013187631  22 3     11 6      11 
abr 20152111842     11521  3321132    331
jan 2015219442     85       932       
out 201416116431     94321 11 12322211   
jul 201417865211    811      94322     
abr 201425129522212226411     124411  111
jan 201422764311    821      114421     
out 20131564321     421      922       
jul 2013147632     43       10311      
abr 2013187421  11 42       10311   1  
jan 2013187631  22 3     11 6      11 
out 201214322   22 5     11 52     11 
jul 201218764   32 7321  11 842    11 
abr 2012179652  21 41    111411    2  
jan 20122484    22 41    1115      11 
out 20111752    22171    111911    11 
jul 20111641    11 31       621    11 
abr 2011198521  11 41       621       
jan 2011241296431 33 103332    116332  1  
out 201028874   11 5111     12111      
jul 2010176541  11 4        1         
abr 2010199431  32 311      73111     
jan 2010217522  11 21       72221  1  
out 2009135322  2225221     83221     
jul 2009208643  1  322      104211     
abr 2009198642  11 532      126433  111
jan 2009136532  22 3111     94321     
out 20081710611  11 411      85411     
jul 20081711742     511      72211  11 
abr 200813975421 22 104311    84442     
jan 2008141175321 11 95521    74221     
out 200712532111 22211222     102221     
jul 200711863111    533      432111    
abr 200797442     3111     53321     
jan 200752211     3111     43221     
out 200685321     2221     32211     
jul 20061286542     93221    933221 11 
abr 2006106222     7331     6321      
jan 200652111     3111     21111     
out 20051111               11        
jul 200521111              11111     
abr 20051111      1        21111     
jan 2005                            
out 2004                            

 

Distribuição de edições de artigos por wikiquotarians
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikiquotariansEdições total
1849100.0%29,262100.0%
332738.5%28,42897.1%
1016219.1%27,48893.9%
32556.5%25,74388.0%
100252.9%24,21982.8%
316121.4%22,17375.8%
100050.6%18,41662.9%
316220.2%13,22245.2%

 

13 wikiquotarians recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions
agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
Sonia SevillaUC1 07,006971,00510set 10, 201017531,23814--
ShervinafsharUC19 01414441nov 11, 20053517501--
AmirAKUC22+211618--mai 28, 2015321---
محسن نامدارزادهUC24+211217--jun 28, 20143661---
A.berjisUC155+14112--mai 28, 20153232--
درپیتUC275...5511jun 19, 20151011--
ZzvfUC276...5522jun 23, 2015611--
KhabarNegarUC321+477431-abr 02, 2014453----
Nargess.nUC327...44--jun 17, 20151211--
RacconishUC407+129311-nov 14, 2014227----
Mohsen326UC414...33--jun 24, 20155----
AhmadrknowledgeUC551...22--jun 03, 201526----
KianUC552...2211jun 29, 2015 22--

 

20 wikiquotarians recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
AmouzandehUC26,216abr 11, 20063366mai 31, 20101855
RAHA68UC32,272abr 30, 20121155abr 06, 201584
SajadUC41,824mar 29, 20053744out 29, 2014243
MardetanhaUC51,098ago 08, 20072882abr 02, 2014453
مهدیUC6706fev 05, 20092335jan 27, 2013883
JDiamondUC7662set 05, 20092123fev 01, 20111609
Jamal NazarethUC8652fev 01, 20111609abr 21, 20111530
TaranetUC9576jan 13, 20082724abr 01, 2014454
WayiranUC10445abr 24, 20082622mai 30, 20111491
Bilijacks~fawikiquoteUC11396nov 16, 20063147abr 20, 2014435
SialkgraphUC12320jul 23, 2013706jul 31, 2014333
Ahura21UC13309mai 24, 20111497ago 14, 2014319
MahanUC14290fev 16, 2014498mar 07, 2015114
MohandesWikiUC15154mar 25, 2014461abr 28, 201562
AbsdostanUC16150set 13, 20092115jan 02, 20121274
CommonsDelinkerUC17145mai 13, 20072969mai 29, 201531
RabinsonUC18144out 11, 20082452jun 16, 20101839
Hard BackrestUC20132dez 31, 20082371abr 24, 2014431
SahimUC21132ago 04, 20101790jan 09, 20121267
FollowerrUC23113jan 09, 20111632mai 11, 20111510

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 4.375 edições foram feitas por usuários anônimos, de um total de 40.707 edições ( 10e %)
  


28 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
AnankeBotUC11,349dez 18, 20082384set 16, 2013651--
TanhabotUC21,191abr 23, 20082623dez 08, 20101664--
ChtitBotUC3966set 08, 20072851fev 06, 20111604--
DexbotUC4672abr 08, 2014447abr 14, 2014441--
EleferenBotUC5464fev 13, 20101962jan 13, 2013897--
SahimrobotUC6412ago 14, 20101780ago 15, 20101779--
MohandesBotUC7372jun 02, 2014392jun 19, 2014375--
FaraBotUC8346out 11, 20072818out 11, 20072818--
KamikazeBotUC9259dez 17, 20101655dez 09, 20111298--
ArthurBotUC10157out 14, 20092084dez 02, 20092035--
MerlIwBotUC11133jul 26, 20121068jun 14, 2013745--
SamoaBotUC12125abr 09, 2014446abr 15, 2014440--
LaaknorBotUC13119out 23, 20082440jan 20, 2013890--
AvicBotUC1488ago 11, 20111418set 07, 20111391--
Idioma-botUC1582mar 02, 20111580jul 16, 20121078--
VolkovBotUC1652jun 30, 20092190abr 16, 20121169--
MjbmrbotUC1746fev 04, 20111606mar 27, 20111555--
JAnDbotUC1843ago 17, 2013681ago 28, 2013670--
CarsracBotUC1942mar 19, 20111563abr 15, 2013805--
DinybotUC2017mar 24, 20073019dez 16, 20072752--
Sir Nicholas de Lenfent BotUC2115abr 09, 20101907abr 19, 20101897--
FiriBotUC2213jan 09, 20111632jan 09, 20111632--
ChobotUC239dez 04, 2012937mar 13, 2013838--
KgsbotUC247dez 13, 20101659jan 18, 20111623--
AmolbotUC253dez 07, 20101665dez 07, 20101665--
RezabotUC261out 18, 20111350out 18, 20111350--
AvocatoBotUC271abr 17, 20121168abr 17, 20121168--
AbotUC281nov 28, 2013578nov 28, 2013578--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110GifJpgPngSvg
jun 20154,5 k7401,7 k1045056261730       370301
mai 20154,5 k7351,7 k1045056251730       370301
abr 20154,5 k7341,7 k1045056241730       370301
mar 20154,5 k7291,7 k1045056231730      500370301
fev 20154,3 k7231,7 k1044665991724      239370301
jan 20154,3 k7161,7 k1044655901723      134370301
dez 20144,3 k7121,7 k1044655891723      59370301
nov 20144,3 k7101,7 k1044655891723      111370301
out 20144,3 k7011,7 k1044655891723      366370301
set 20144,2 k6891,7 k1044135251710      738370301
ago 20143,9 k6741,7 k1043484951704      326370301
jul 20143,8 k6671,7 k1043474771703      746370301
jun 20143,5 k6631,7 k1043474761677      108370301
mai 20143,5 k6551,7 k1013464551676      930368291
abr 20143,2 k6531,7 k1013464551663      1685368291
mar 20142,9 k6481,7 k1013464551656      1012368291
fev 20142,7 k6421,7 k1003464551644      664367291
jan 20142,7 k6361,7 k1003464501635      789367291
dez 20132,5 k6291,7 k1003464491623      728367291
nov 20132,4 k6261,7 k1003464491617      547367291
out 20132,2 k6201,7 k1003374411591      254367291
set 20132,2 k6141,7 k1003374411589      415367291
ago 20132,2 k5951,7 k993374401573      929366291
jul 20132,1 k5891,7 k973374271470      167364291
jun 20132,1 k5791,7 k963374271470      76364281
mai 20132,1 k5751,7 k963374261470      107364281
abr 20132,1 k5701,7 k963374261470      87364281
mar 20132,1 k5631,7 k963374241466      78364281
fev 20132,1 k5521,7 k963374241464      80364281
jan 20132,0 k5451,6 k963374241461      101364281
dez 20122,0 k5421,6 k963374241461      73364281
nov 20122,0 k5331,6 k953374241461      25363281
out 20122,0 k5291,6 k953374241460      49363281
set 20122,0 k5251,6 k953374241459      62363281
ago 20122,0 k5151,6 k953374241459      87363281
jul 20122,0 k5071,6 k953374241458      104363281
jun 20122,0 k5021,6 k953374231458      77363281
mai 20121,9 k4781,6 k953374231458      134363281
abr 20121,9 k4701,6 k943374231458      164362281
mar 20121,9 k4621,6 k943374231458      164362281
fev 20121,9 k4551,6 k943374231458      42362281
jan 20121,9 k4431,6 k943374211458      64362281
dez 20111,9 k4391,6 k943374211457      97362281
nov 20111,9 k4351,6 k943374191457      106362281
out 20111,9 k4201,6 k943374181455      40362281
set 20111,9 k4101,6 k943374161455      70362281
ago 20111,9 k3961,6 k943374141454      36362281
jul 20111,9 k3921,6 k943374121454      35362281
jun 20111,9 k3831,6 k943374121450      79362281
mai 20111,8 k3751,6 k943374121450      60362281
abr 20111,8 k3631,6 k943374101450      98362281
mar 20111,8 k3531,6 k943374101450      304362281
fev 20111,8 k3451,6 k843374031448      607253281
jan 20111,6 k3121,6 k563303741431      737129251
dez 20101,5 k3041,6 k483273621396      51121251
nov 20101,5 k3001,6 k483273621396      113121251
out 20101,5 k2961,6 k483273611395      118121251
set 20101,5 k2871,6 k483273561395      204121251
ago 20101,4 k2791,6 k433273521388      204116251
jul 20101,4 k2631,6 k423272701382      105115251
jun 20101,4 k2631,6 k413272701382      58114251
mai 20101,4 k2451,6 k413262701382      110114251
abr 20101,4 k2401,6 k413262701382      106114251
mar 20101,4 k2331,5 k413262701382      63114251
fev 20101,4 k2301,5 k413252671379      118114251
jan 20101,3 k2261,5 k403252671378      11111425 
dez 20091,3 k2101,4 k403252671378      7211425 
nov 20091,3 k2031,4 k393252671378      12011325 
out 20091,3 k2011,4 k393252671378      19011325 
set 20091,3 k1961,4 k383252671374      22311324 
ago 20091,2 k1861,3 k383252651372      12611324 
jul 20091,2 k1861,3 k383252651372      17011324 
jun 20091,2 k1801,3 k383242621372      10911324 
mai 20091,1 k1781,2 k383242601372      10111324 
abr 20091,1 k1761,2 k383242601372      17811324 
mar 20091,1 k1631,2 k373242321358      43911224 
fev 20091,1 k1481,2 k333241821214      3961923 
jan 20091,0 k1391,1 k323241821145      1421823 
dez 20089881361,1 k323241801141      2061823 
nov 20089691321,1 k323241791140      971823 
out 20089561171,0 k323241741134      1121823 
set 20089431031,0 k323211741134      1521823 
ago 200891299973323211741133      3731823 
jul 200881495941303201701132      1551623 
jun 200879392911303201701130      1211623 
mai 200877685911303201701130      4671623 
abr 200872080880303151671126      5041623 
mar 200868676815293141591123      1481622 
fev 200867973785293141591123      5091622 
jan 200865067753273141591123      7111422 
dez 200759364723253141541105      4391222 
nov 200757860690243141491105      621221 
out 200757158690243101481105      3901221 
set 200755451629243101461105      7321221 
ago 200752943596243101411101      6081221 
jul 20075154056424310132196      8791221 
jun 20074913953224310130194      1651221 
mai 2007474395002329186193      1481220 
abr 2007465374472329086193      2091220 
mar 2007447354092328984187      1941220 
fev 2007436343822224974171      84 220 
jan 2007431313572224974171      113 220 
dez 2006419313102223674171      139 220 
nov 2006413302962123640136      91 120 
out 2006396272462122837135      146 120 
set 2006377272102122537135      225 120 
ago 2006352261732122137135      173 120 
jul 2006334221322121933134      497 120 
jun 200627313952118628128      172 120 
mai 200623711652118627127      143 120 
abr 20062049352118527127      103 120 
mar 20061806182118527 24      124 120 
fev 20061355162018116 14      66 119 
jan 20061105152017014 14      40 119 
dez 2005954151916711 14      29 118 
nov 200578315191629 14      73 118 
out 20056421421556 14      17 11 
set 20056221411555 14      39  1 
ago 20054821311525 14      4  1 
jul 20054621311505 14      87  1 
jun 20051821011444 4      24  1 
mai 2005821011163 2      1  1 
abr 2005711011163 2      15  1 
mar 2005419 1163 2      10    
fev 20051   116              
jan 20051   116              
dez 20041   116              
nov 20041                  
out 20041                  
set 20041                  
ago 20041                  

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

ago 2004: 1 1 Main Page

mar 2005: 1 1 ضرب‌المثل‌های عربی

abr 2005: 1 1 آدولف هیتلر

mai 2005: 1 1 ضرب‌المثل‌های فارسی

jun 2005: 1 2 آقامحمدخان قاجار , 2 2 عزیز نسین , 3 2 صفحهٔ اصلی , 4 1 محمود احمدی‌نژاد

jul 2005: 1 2 ناشناس , 2 1 ویلیام فالکنر

ago 2005: 1 2 صفحهٔ اصلی , 2 1 فهرست بر اساس فيلم‌ها

set 2005: 1 3 صفحهٔ اصلی , 2 2 علی بن ابی‌طالب , 3 2 ناشناس , 4 1 ارنستو چه گوارا

out 2005: 1 1 فهرست افراد براساس نام

nov 2005: 1 2 کورش مدرسی , 2 2 منصور حکمت , 3 2 حمید تقوایی , 4 2 محمود احمدی‌نژاد , 5 1 دوگ لارسون

dez 2005: 1 1 امبرتو اکو

jan 2006: 1 2 اپیکور , 2 2 ارنستو چه گوارا , 3 1 کانت

fev 2006: 1 2 آلبر کامو , 2 2 زیلاکس , 3 1 محمدتقی مصباح یزدی

mar 2006: 1 2 توماس جفرسون , 2 2 ماتریکس , 3 2 فهرست آثار ادبی , 4 2 فهرست افراد بر اساس نام , 5 2 صفحهٔ اصلی , 6 1 کارلوس کاستاندا

abr 2006: 1 4 صفحهٔ اصلی , 2 3 هرمان هسه , 3 2 مارتین لوتر , 4 2 ضرب‌المثل‌های هلندی , 5 2 استانیسلاو لم , 6 2 ارنست همینگوی , 7 2 مایکل جکسون , 8 2 آلبرت اینشتین

mai 2006: 1 2 رابرت آنسون هاین‌لاین , 2 2 رفیق شامی , 3 2 جلال‌الدین محمد بلخی , 4 2 داگلاس آدامز , 5 2 فرانسوا لارشفوکو , 6 2 ضرب‌المثل‌های لاتینی , 7 2 واشنگتن ایروینگ , 8 2 توماس جفرسون , 9 1 محمد خیابانی

jun 2006: 1 2 فرانسوا فنلون , 2 2 ژان دو لافونتن , 3 2 وینستون چرچیل , 4 2 فهرست افراد بر اساس نام , 5 2 صفحهٔ اصلی , 6 1 رنه دکارت

jul 2006: 1 3 هلن کلر , 2 3 آیان حرصی علی , 3 3 آرزو , 4 3 آندره ژید , 5 3 آرتور شوپنهاور , 6 2 سید مرتضی آوینی , 7 2 الویس پریسلی , 8 2 مسیر سبز , 9 2 کازابلانکا , 10 2 رستگاری در شاوشنک , 11 2 ژولیا کریستوا , 12 2 محمود فلکی , 13 2 منوچهر آتشی , 14 2 جنگ عراق , 15 2 باباطاهر , 16 2 ویلیام سارویان , 17 2 کارل سندبرگ , 18 2 اقبال لاهوری , 19 2 فدریکو فلینی , 20 2 فریدریش شیلر , 21 2 رنه دکارت , 22 2 امیرخسرو دهلوی , 23 2 علی‌اکبر دهخدا , 24 2 کندورسه , 25 2 افلاطون

ago 2006: 1 3 ضرب‌المثل‌های آذربایجانی , 2 3 صفحهٔ اصلی , 3 2 صادق هدایت , 4 2 سووشون , 5 2 شازده کوچولو , 6 1 محمدحسین شهریار

set 2006: 1 4 صفحهٔ اصلی , 2 3 فهرست افراد بر اساس نام , 3 2 بيل گيتس , 4 2 ضرب‌المثل‌های آذربایجانی , 5 2 عمر خیام , 6 2 حافظ , 7 2 میکل‌ آنژ , 8 2 محمود احمدی‌نژاد , 9 1 شهریار

out 2006: 1 2 ژان پل , 2 2 حسن تقی‌زاده , 3 2 ضرب‌المثل‌های آذربایجانی , 4 2 حافظ , 5 2 وودی آلن , 6 2 سعدی , 7 2 فهرست افراد بر اساس نام , 8 1 فرانکا ماگنانی

nov 2006: 1 2 باران کوثری , 2 2 کارل گوستاو یونگ , 3 2 برتولت برشت , 4 2 فهرست افراد بر اساس نام , 5 2 صفحهٔ اصلی , 6 1 محمدرضا شفیعی کدکنی

dez 2006: 1 2 غلامرضا روحانی , 2 2 باران کوثری , 3 2 دنیای سوفی , 4 2 جنگ , 5 2 آلبرت اینشتین , 6 2 فهرست آثار ادبی , 7 1 ریچارد رورتی

jan 2007: 1 3 پدرخوانده , 2 2 ریچارد نیکسون , 3 2 نیکوس کازانتزاکیس , 4 2 ری بردبری , 5 2 محمد زکریای رازی , 6 2 محمود احمدی‌نژاد , 7 2 صفحهٔ اصلی , 8 1 ضرب‌المثل‌های اندونزیایی

fev 2007: 1 2 قیصر , 2 2 صفحهٔ اصلی , 3 1 انجیل متی

mar 2007: 1 3 لودویگ فان بتهوون , 2 3 فریدریش نیچه , 3 2 رمکو کامپرت , 4 2 محمدرضا شفیعی کدکنی , 5 2 کلیم کاشانی , 6 2 بایگانی نقل‌قول روز , 7 2 سعدی , 8 2 صفحهٔ اصلی , 9 1 وگ:وگ

abr 2007: 1 3 فریدریش نیچه , 2 2 داستان یک سیندرلا , 3 2 کما , 4 2 تقاطع , 5 2 مهمان (فیلم) , 6 2 اخراجی‌ها , 7 2 فریدون جنیدی , 8 2 ابوریحان بیرونی , 9 2 وحید قزوینی , 10 2 عمر خیام , 11 2 فردوسی , 12 2 جلال‌الدین محمد بلخی , 13 2 مارتین لوتر

mai 2007: 1 2 راه بی‌پایان , 2 2 تله , 3 2 میم مثل مادر , 4 2 هنر , 5 2 جورج برنارد شاو , 6 2 فهرست آثار ادبی , 7 2 ناشناس , 8 1 اسدی طوسی

jun 2007: 1 2 جان رید , 2 2 مائو تسه تونگ , 3 2 باران کوثری , 4 2 محمد خیابانی , 5 2 عشق , 6 1 سرمایه‌داری

jul 2007: 1 2 سگ , 2 2 گربه , 3 2 عباس کیارستمی , 4 2 نیکلا سارکوزی , 5 2 روز سوم , 6 2 فریدریش انگلس , 7 2 مائو تسه تونگ , 8 2 فریدون جنیدی , 9 2 کارل مارکس , 10 2 سیسرو , 11 2 ضرب‌المثل‌های آلمانی , 12 2 علی شریعتی , 13 2 عشق , 14 1 کد داوینچی

ago 2007: 1 3 سیاست , 2 3 ضرب‌المثل‌های فارسی , 3 2 کریستین بویین , 4 2 سید روح‌الله خمینی , 5 2 ازدواج , 6 2 آزادی , 7 2 ولادیمیر لنین , 8 2 کارل مارکس , 9 2 علویه خانم , 10 2 ضرب‌المثل‌های اسپانیایی , 11 2 سید مرتضی آوینی , 12 2 داگلاس آدامز , 13 2 هنر , 14 2 دانش , 15 2 دوستی , 16 2 جنگ , 17 1 سنگسار

set 2007: 1 3 لئون تروتسکی , 2 3 محمود احمدی‌نژاد , 3 2 شتر , 4 2 مزرعه حیوانات , 5 2 ۱۹۸۴ , 6 2 ملالی جویا , 7 2 سید روح‌الله خمینی , 8 2 فاطمه زهرا/گفتار هایی از فاطمه زهرا , 9 2 فاطمه زهرا/اشعاری از شعرای کهن پیرامون فاطمه زهرا , 10 2 فاطمه زهرا/فاطمه زهرا در نگاه امامان شیعه , 11 2 ولادیمیر لنین , 12 2 ایرج‌میرزا , 13 2 اهلی شیرازی , 14 2 نقل‌قول روز , 15 2 باران کوثری , 16 2 ضرب‌المثل‌های ارمنی , 17 2 ضرب‌المثل‌های ایتالیایی , 18 2 افلاطون , 19 2 دانش , 20 2 آندره ژید , 21 2 جرج هربرت , 22 2 موریس مترلینک , 23 2 فهرست فیلم‌ها , 24 2 لئو بوسکالیا , 25 2 سورن کی‌یر کگارد

out 2007: 1 3 ژان دلا برویر , 2 2 آندری تارکوفسکی , 3 2 جان لاک , 4 2 شتر , 5 2 کارل مارکس , 6 2 باران کوثری , 7 2 ضرب‌المثل‌های ارمنی , 8 2 صادق هدایت , 9 2 ضرب‌المثل‌های آذربایجانی , 10 2 سنایی , 11 2 رقص , 12 2 فهرست فیلم‌ها , 13 1 مرکز موسیقی بتهوون

nov 2007: 1 3 علی بن ابی‌طالب , 2 2 داوید آلفارو سی‌که‌ایروس , 3 2 جیمز ناکس پولک , 4 2 ضرب‌المثل‌های آذربایجانی , 5 2 فیلم , 6 1 انقلاب

dez 2007: 1 5 فهرست افراد بر اساس نام , 2 4 دیوارنوشته , 3 4 ویلیام شکسپیر , 4 3 جلیل ضیاءپور , 5 3 خانه‌ای بر روی آب , 6 3 صلح , 7 3 فریدریش نیچه , 8 3 صفحهٔ اصلی , 9 2 ماهی , 10 2 انقلاب , 11 2 جورج دبلیو بوش , 12 2 محمدحسین شهریار , 13 2 ضرب‌المثل‌های آذربایجانی , 14 2 ضرب‌المثل‌های اسپانیایی , 15 2 فهرست نمایش‌های تلویزیونی , 16 2 ابن سینا , 17 2 عشق , 18 2 فهرست فیلم‌ها

jan 2008: 1 5 لوئیس بونوئل , 2 4 فهرست افراد بر اساس نام , 3 4 ضرب‌المثل‌های فارسی , 4 3 جنون , 5 3 محمدحسین شهریار , 6 3 ژان دارک , 7 3 محمود احمدی‌نژاد , 8 2 طبیعت , 9 2 جورج اورول , 10 2 مجنون , 11 2 زنبور , 12 2 مرگ , 13 2 خنده , 14 2 مکس پین , 15 2 کودک , 16 2 خوب، بد، زشت , 17 2 رومن رولان , 18 2 سیمین دانشور , 19 2 مادر , 20 2 فروغ فرخزاد , 21 2 کتاب , 22 2 عطار نیشابوری , 23 2 نیشابور , 24 2 جورج دبلیو بوش , 25 2 دنیای سوفی

fev 2008: 1 3 روشنفکر , 2 2 گل , 3 2 شراب , 4 2 سیمون دو بووار , 5 2 مرگ , 6 2 منیرو روانی‌پور , 7 2 فروغ فرخزاد , 8 2 کتاب , 9 2 تاریخ , 10 2 نقل‌قول روز , 11 2 نیکوس کازانتزاکیس , 12 2 ضرب‌المثل‌های ترکی , 13 2 ضرب‌المثل‌های آذربایجانی , 14 2 هنر , 15 2 عشق , 16 1 عارف قزوینی

mar 2008: 1 3 اورسن ولز , 2 3 فهرست افراد بر اساس نام , 3 2 مائو تسه‌دون , 4 2 سنگسار , 5 2 عشق , 6 2 کارلایل

abr 2008: 1 3 سید علی خامنه‌ای , 2 3 ژیل دلوز , 3 3 فهرست افراد بر اساس نام , 4 3 ناپلئون بناپارت , 5 3 صفحهٔ اصلی , 6 2 سید جمال‌الدین اسدآبادی , 7 2 محمد فضولی , 8 2 چنین گفت زرتشت , 9 2 تقی ارانی , 10 2 شارلوت برونته , 11 2 شیون فومنی , 12 2 فردریک هگل , 13 2 لوچیو کولتی , 14 2 هربرت مارکوزه , 15 2 نیکوس پولانزاس , 16 2 باروخ اسپینوزا , 17 2 گئورگ ویلهلم فریدریش هگل , 18 2 مگس , 19 2 جلیل ضیاءپور , 20 1 سید جمال الدین اسدآبادی

mai 2008: 1 6 فهرست افراد بر اساس نام , 2 3 حسین پناهی , 3 3 عشق , 4 3 صفحهٔ اصلی , 5 2 پروانه , 6 2 جورج گوردون بایرون , 7 2 پاپلی یزدی , 8 2 بلبل , 9 2 هانا آرنت , 10 2 دایره زنگی , 11 2 عارف قزوینی , 12 2 امیلی برونته , 13 2 دانش , 14 2 آرزو , 15 2 موریس مترلینک , 16 1 کسایی مروزی

jun 2008: 1 2 هنری دیوید تورو , 2 2 لنگستون هیوز , 3 2 ستارخان , 4 2 شراب , 5 2 سنگسار , 6 2 بزرگمهر , 7 1 مجوز مستندات آزاد گنو

jul 2008: 1 4 طاهره قرةالعین , 2 3 گوساله , 3 3 عباس کیارستمی , 4 3 فهرست افراد بر اساس نام , 5 2 مرد سوم , 6 2 نیمتاج سلماسی , 7 2 هوشنگ گلشیری , 8 2 نقش رستم , 9 2 تخت جمشید , 10 2 سید محمد طباطبائی , 11 2 رشحه , 12 2 حسین پناهی , 13 2 اورسن ولز

ago 2008: 1 3 بوسه , 2 2 داستان دو شهر , 3 2 سکوت , 4 2 ۱۷ فوریه , 5 2 گراهام گرین , 6 2 هانیبال الخاص , 7 2 شیخ فضل‌الله نوری , 8 2 صائب تبریزی , 9 2 آندری تارکوفسکی , 10 2 لودویگ فان بتهوون , 11 2 مارتین لوتر کینگ جونیور , 12 2 عشق , 13 2 آلبرت اینشتین , 14 2 محمود احمدی‌نژاد , 15 1 اریش فروم

set 2008: 1 3 گربه روی شیروانی داغ (نمایشنامه) , 2 2 امیر نادری , 3 2 محمدحسین پاپلی یزدی , 4 2 تنسی ویلیامز , 5 2 دیپاک چوپرا , 6 2 پاپلی یزدی , 7 1 ۲ مه

out 2008: 1 2 حسام‌الدین خویی , 2 2 میرزا علی‌اکبر صابر , 3 2 امام محمد غزالی , 4 2 علی اکبر دهخدا , 5 1 حسام الدین خویی

nov 2008: 1 4 فهرست افراد بر اساس نام , 2 2 باراک اوباما , 3 1 ژان سیبلیوس

dez 2008: 1 2 گروچو مارکس , 2 2 فردوسی

jan 2009: 1 3 محمد بن عبدالله , 2 2 امیلی دیکنسن , 3 2 گلادیاتور , 4 1 ۱۴ ژانویه

fev 2009: 1 3 زنان , 2 3 محمد علی کلی , 3 2 ماهواره امید , 4 2 حسن طبری آملی , 5 2 سید محمد‌کاظم شریعتمداری , 6 2 ولایت فقیه , 7 2 خلفای راشدین , 8 2 اردبیل , 9 2 شاهین نجفی , 10 2 دایره زنگی , 11 2 وحشی بافقی , 12 2 خیلی دور، خیلی نزدیک , 13 2 قیصر , 14 2 آلفونس کار , 15 2 پائولو کوئیلو , 16 1 محیط طباطبائی

mar 2009: 1 2 علی اکبر شیرودی , 2 2 بهارانه , 3 2 حسن لاهوتی اشکوری , 4 2 حسن طبری آملی , 5 2 شارلوت برونته , 6 2 حسین بن علی , 7 2 هاینریش هاینه , 8 2 گابریل گارسیا مارکز , 9 2 رنه دکارت , 10 2 ژان دو لافونتن , 11 2 رودکی , 12 2 ابن سینا , 13 2 عمر خیام , 14 2 استانیسلاو لم , 15 2 آلبر کامو , 16 2 تالس , 17 2 آلبرت اینشتین , 18 2 جورج برنارد شاو , 19 2 مارشال مک‌لوهان , 20 1 علی صیاد شیرازی

abr 2009: 1 4 فهرست افراد بر اساس نام , 2 3 حسین منصور حلاج , 3 2 ریچارد براتیگان , 4 2 آنا آخماتووا , 5 2 فروغ فرخزاد , 6 2 عطار نیشابوری , 7 2 سعدی , 8 2 یوهان ولفگانگ گوته , 9 2 آلبرت اینشتین , 10 2 منصور حکمت , 11 1 مهدی رجب بیگی

mai 2009: 1 5 فهرست افراد بر اساس نام , 2 2 عماد مغنیه , 3 2 صلح , 4 2 سید روح‌الله خمینی , 5 2 فردوسی

jun 2009: 1 2 تبریز , 2 2 جرج برناردشاو , 3 2 لئوناردو داوینچی , 4 2 دار و دسته‌های نیویورکی , 5 1 لئونارد داوینچی

jul 2009: 1 4 علی بن ابی‌طالب , 2 2 زنان , 3 2 استیون واینبرگ , 4 1 توماس هنری هاکسلی

ago 2009: 1 3 احمد مفتی‌زاده , 2 3 شعارهای مردم در اعتراض به نتیجه انتخابات ریاست جمهوری , 3 3 ضرب‌المثل‌های چینی , 4 2 گیتی نوین , 5 2 میرحسین موسوی , 6 2 آبراهام لینکلن , 7 1 یوسف صانعی

set 2009: 1 3 سید محمد خاتمی , 2 3 علی شریعتی , 3 3 فهرست افراد بر اساس نام , 4 2 در بروژ , 5 2 احمد مفتی‌زاده , 6 2 شعارهای مردم در اعتراض به نتیجه انتخابات ریاست جمهوری , 7 2 میرحسین موسوی , 8 2 دزدان دریایی کارائیب: صندوق مرد مرده , 9 2 حسین پناهی , 10 2 سید علی خامنه‌ای , 11 1 پیامک

out 2009: 1 2 خواب , 2 2 بهلول , 3 2 امام محمد باقر , 4 2 جعفر صادق , 5 2 میرحسین موسوی , 6 2 دنیای سوفی , 7 1 عبدالکریم سروش

nov 2009: 1 4 محمود احمدی‌نژاد , 2 2 ژان پل سارتر , 3 1 چه‌گوارا

dez 2009: 1 1 سید احمد علم‌الهدی

jan 2010: 1 2 ریاضی , 2 2 محمدرضا شجریان , 3 2 سید احمد علم‌الهدی , 4 2 اسفندیار رحیم‌مشایی , 5 2 میرحسین موسوی , 6 1 بیماری

fev 2010: 1 3 جنبش سبز , 2 2 علی رضا بدیع , 3 2 لئوناردو داوینچی , 4 2 فهرست فیلم‌ها , 5 1 پل ورلن

mar 2010: 1 2 شعارهای مردم در اعتراض به نتیجه انتخابات ریاست جمهوری , 2 2 فهرست افراد بر اساس نام , 3 1 کورش کوچک

abr 2010: 1 4 بهاءالله , 2 3 محمود احمدی‌نژاد , 3 2 هرات , 4 2 سید حسن فیروزآبادی , 5 2 میرحسین موسوی , 6 2 سید علی خامنه‌ای , 7 2 وینستون چرچیل , 8 1 پیامک

mai 2010: 1 2 بهاءالله , 2 2 محمدرضا شجریان , 3 2 فردوسی , 4 1 سلام

jun 2010: 1 3 سید روح‌الله خمینی , 2 2 کاظم صدیقی , 3 2 سید علی خامنه‌ای , 4 2 فهرست افراد بر اساس نام , 5 1 حاتم طایی

jul 2010: 1 2 خوزستان , 2 2 بدبیاری‌ها , 3 2 آین رند , 4 2 حسین الهی قمشه‌ای , 5 2 ضرب‌المثل‌های فارسی , 6 1 عین القضاة همدانی

ago 2010: 1 3 محمود احمدی‌نژاد , 2 2 آیزاک آسیموف , 3 2 چای , 4 2 دخانیات , 5 2 خلیج فارس , 6 2 خوزستان , 7 2 علی‌رضا بدیع , 8 2 آمریکا , 9 2 سید علی‌محمد دستغیب , 10 2 نیشابور , 11 2 محمدحسین شهریار , 12 2 امیرخسرو دهلوی , 13 1 پیامک

set 2010: 1 4 علی بن ابی‌طالب , 2 4 فهرست افراد بر اساس نام , 3 3 عمرو عاص , 4 3 باراک اوباما , 5 3 حسین بن علی , 6 2 جلال‌الدین فارسی , 7 2 ابوالحسن بنی‌صدر , 8 2 معاویه پسر ابی‌سفیان , 9 2 سهیل پسر عمرو , 10 2 میدان نقش جهان , 11 2 دمشق , 12 1 پیامک

out 2010: 1 2 قهوه تلخ , 2 2 عبدالجواد غرويان , 3 2 آنتون چخوف , 4 2 علی بن ابی‌طالب , 5 2 جکسون براون , 6 1 قهوه تلخ (سریال)

nov 2010: 1 3 قهوه تلخ , 2 3 جورج برنارد شاو , 3 2 غلامحسین ساعدی , 4 2 غلامعلی بسکی , 5 2 محسن قرائتی , 6 1 هارون‌الرشید

dez 2010: 1 2 سنگسار در اسلام , 2 2 وحشی بافقی , 3 2 فروغ فرخزاد , 4 2 علی بن ابی‌طالب , 5 1 لویی فردینان سلین

jan 2011: 1 3 علی‌رضا افتخاری , 2 3 فهرست فیلم‌ها , 3 3 علی بن ابی‌طالب , 4 3 محمود احمدی‌نژاد , 5 2 پیامک , 6 2 مهدی , 7 2 توبه , 8 2 رضی‌الدین نیشابوری , 9 2 ابرهه , 10 2 قاسم بن محمد , 11 2 عبدالله بن شبرمه , 12 2 شطرنج , 13 2 ابی بن کعب , 14 2 عایشه , 15 2 محمدجواد عزتی , 16 2 ابن عباس , 17 2 ابن قیم الجوزیه , 18 2 حسن بصری , 19 2 زین‌العابدین مراغه‌ای , 20 2 مصر , 21 2 خراسان , 22 2 زین‌العابدین بن علی , 23 2 سبزوار , 24 2 ضرب‌المثل‌های خراسانی , 25 2 شب‌های روشن

fev 2011: 1 3 خلیج فارس , 2 3 ایران , 3 2 معمر قذافی , 4 2 مأمون , 5 2 مشورت , 6 2 مدینه , 7 2 نام‌گذاری فرزند , 8 2 عمر بن خطاب , 9 2 ابوبکر , 10 2 عزت‌الله سحابی , 11 2 عبدالکریم سروش , 12 2 میرحسین موسوی , 13 2 محمدحسین پاپلی یزدی , 14 2 آنتون چخوف , 15 2 منوچهر آتشی , 16 2 عمر خیام , 17 1 شعارهای مردم لیبی در اعتراضات سال ۲۰۱۱

mar 2011: 1 4 علی بن ابی‌طالب , 2 3 محمدجواد عزتی , 3 3 عمر بن خطاب , 4 3 ابوبکر , 5 3 نیشابور , 6 3 آدولف هیتلر , 7 2 کیم وو چونگ , 8 2 طاهر بن حسین , 9 2 فاروق , 10 2 ابوعثمان سعید مغربی , 11 2 سید حسن مدرس , 12 2 نجم‌الدین اربکان , 13 2 روژه گارودی , 14 2 معمر قذافی , 15 2 قدس , 16 2 ادیب نیشابوری , 17 2 زبان عربی , 18 2 زبان فارسی , 19 1 ابو حفص حداد

abr 2011: 1 2 ابوسعید ابوالخیر , 2 2 ضرب‌المثل‌های خراسانی , 3 1 لودویک زامنهوف

mai 2011: 1 2 جفرسون دیویس , 2 2 خواجه عبدالله انصاری , 3 2 علویه خانم , 4 1 ناصر حجازی

jun 2011: 1 2 ابوبکر , 2 2 ایران , 3 1 آشنایی با مادر

jul 2011: 1 1 علی بن ابیطالب

ago 2011: 1 3 عمر بن خطاب , 2 2 کورش بزرگ , 3 1 میرزا حسین‌علی نوری

set 2011: 1 3 فهرست آثار ادبی , 2 2 جرم (فیلم) , 3 2 فرینج , 4 2 نیشابور , 5 2 کازابلانکا , 6 2 فهرست فیلم‌ها , 7 1 هوشنگ ایرانی

out 2011: 1 2 جدایی نادر از سیمین , 2 2 نیشابور , 3 1 اینشتین

nov 2011: 1 4 ازدواج , 2 3 مبارزه متعالی , 3 2 شعور خلاق , 4 2 کلام خلاق , 5 2 قضاوت , 6 1 یوحنای مجنون

dez 2011: 1 3 ایلیا میم , 2 2 پیمان فتاحی , 3 2 هامون , 4 2 محمدرضا پهلوی , 5 2 محمد مصدق , 6 2 مایکل جکسون , 7 1 مصطفی چمران

jan 2012: 1 3 ضرب‌المثل‌های فارسی , 2 2 علاءالدین ملماسی , 3 2 سید روح‌الله خمینی , 4 2 فریدون جنیدی , 5 2 فهرست فیلم‌ها , 6 1 هوپ‌هوپ‌نامه

fev 2012: 1 2 آمل , 2 1 طالب آملی

mar 2012: 1 2 پیمان فتاحی , 2 2 جلال‌الدین محمد بلخی , 3 2 مریلین منسون , 4 2 فهرست آثار ادبی , 5 2 فهرست افراد بر اساس نام , 6 1 اریک کانتونا

abr 2012: 1 5 ماهواره امید , 2 3 فهرست افراد بر اساس نام , 3 2 سکسوالیته , 4 2 بایزید بسطامی , 5 2 جانی دپ , 6 2 مذهب , 7 2 علی شریعتی , 8 1 شادی

mai 2012: 1 3 مارک تواین , 2 2 پرویز شهریاری , 3 2 شاهین نجفی , 4 2 جورج برنارد شاو , 5 2 فهرست افراد بر اساس نام , 6 1 کارل سیگن

jun 2012: 1 2 سیروان خسروی , 2 1 بابک خرمدین

jul 2012: 1 3 رضا پهلوی , 2 2 ارباب کمان نقره‌ای , 3 2 جورج برنارد شاو , 4 2 مارک تواین , 5 1 اتاقی از آن خود

ago 2012: 1 3 فهرست فیلم‌ها , 2 2 دیوانه‌ای از قفس پرید , 3 2 سفر به انتهای شب , 4 2 عمر بن خطاب , 5 2 هانا آرنت , 6 2 صادق هدایت , 7 2 ایمانوئل کانت , 8 1 زیستن چون پروانه

set 2012: 1 1 بهار ۶۳

out 2012: 1 1 ضرب‌المثل‌های کردی

nov 2012: 1 5 فهرست افراد بر اساس نام , 2 2 عمر بن خطاب , 3 1 محمود کریمی حکاک

dez 2012: 1 2 مصطفی دلشاد تهرانی , 2 2 فهرست افراد بر اساس نام , 3 1 امیر قلعه نویی

jan 2013: 1 3 عمر بن خطاب , 2 2 جورج اورول , 3 2 عشق , 4 2 فهرست افراد بر اساس نام , 5 1 لیلا صادقی

fev 2013: 1 2 ناجی العلی , 2 2 آسیا عبدالله

mar 2013: 1 2 سید علی خامنه‌ای , 2 1 انیو موریکونه

abr 2013: 1 3 ماکسیمیلیان روبسپیر , 2 3 سن ژوست , 3 3 انیو موریکونه , 4 3 مختارنامه (مجموعه تلویزیونی) , 5 2 حرفه‌ای , 6 2 سید محمد‌کاظم شریعتمداری , 7 2 علی شریعتی , 8 1 عماد خراسانی

mai 2013: 1 4 دینو بوتزاتی , 2 4 آزادی , 3 3 عماد خراسانی , 4 3 ضرب‌المثل‌های بختیاری , 5 3 فریدون مشیری , 6 1 ماکسیم گورکی

jun 2013: 1 2 مالکوم لطیف شباز , 2 2 حسن روحانی , 3 1 آبراهام مازلو

jul 2013: 1 2 ایندیرا گاندی , 2 1 100 گفتار

ago 2013: 1 3 حسن روحانی , 2 3 عمر بن خطاب , 3 3 ابوبکر , 4 2 محمد بن موسی خوارزمی , 5 2 داوید هیلبرت , 6 2 محمدعلی جمال‌زاده , 7 2 پینوکیو (فیلم) , 8 2 ناخدا خورشید , 9 2 باغ‌های کندلوس , 10 2 لودویگ ویتگنشتاین , 11 2 والتر اسکات , 12 2 راینر ماریا ریلکه , 13 2 کاشان , 14 2 توماس هاکسلی , 15 2 البرت هوبارد , 16 2 ایندیرا گاندی , 17 2 دوایت آیزنهاور , 18 2 فرانک تایگر , 19 2 آلیس واکر , 20 2 پایتخت , 21 2 داریوش بزرگ , 22 2 گشت ارشاد , 23 2 شیخ بهائی , 24 2 دیوانه‌ای از قفس پرید , 25 2 سعادت‌آباد

set 2013: 1 3 فهرست افراد بر اساس نام , 2 2 شمع , 3 2 زیرپوست شهر , 4 2 جیمز جویس , 5 2 گی دو موپاسان , 6 2 جان استاینبک , 7 2 ابوبکر کرجی , 8 2 آنه فرانک , 9 2 پینوکیو (فیلم) , 10 1 پاتریس لومومبا

out 2013: 1 2 نورعلی الهی , 2 2 پینوکیو (فیلم) , 3 2 ایرانی , 4 2 سید محمد خاتمی , 5 2 فهرست فیلم‌ها , 6 2 علی بن ابی‌طالب , 7 1 شمس تبریزی

nov 2013: 1 2 محمدجواد ظریف , 2 2 نورعلی الهی , 3 2 لودویگ ویتگنشتاین , 4 2 شطرنج , 5 2 عشق , 6 2 علی بن ابی‌طالب , 7 1 علی زین العابدین

dez 2013: 1 4 دانش , 2 3 جینا جیمسون , 3 3 ارتداد در اسلام , 4 3 سنگسار در اسلام , 5 3 جورج واشنگتن , 6 3 کورش بزرگ , 7 2 سفارت , 8 2 فریدریش هایک , 9 2 خرما , 10 2 نهنگ , 11 2 جوزف کمبل , 12 2 لوئیزا می آلکوت , 13 2 هشت صبح , 14 2 سید علی‌اصغر دستغیب , 15 2 نلسون ماندلا , 16 2 مبارزه متعالی , 17 2 بخشندگی , 18 2 ابوسعید ابوالخیر , 19 2 زکات , 20 2 شطرنج , 21 2 ناصر مکارم شیرازی , 22 2 میرزا کوچک خان جنگلی , 23 2 نماز (اسلام) , 24 2 زنان , 25 2 سکوت

jan 2014: 1 3 شاه اسماعیل دوم , 2 3 آلبرت اشپر , 3 3 علی‌رضا , 4 2 یاس (خواننده) , 5 2 آل کاپون , 6 2 پول , 7 2 اخلاق , 8 2 اراده , 9 2 جوانی , 10 2 حسادت , 11 2 تجربه , 12 2 طمع , 13 2 استبداد , 14 2 جهان , 15 2 بیابان , 16 2 حسن روحانی , 17 2 اندیشیدن , 18 2 عمر بن خطاب , 19 2 زیبایی آمریکایی , 20 2 انسان , 21 2 حسن بن علی , 22 2 زنان , 23 2 بوسه , 24 2 کودک , 25 2 آزادی

fev 2014: 1 3 ژوزه ساراماگو , 2 3 کورش بزرگ , 3 2 تحقیر , 4 2 کرت وانه‌گت , 5 2 علی کریمی , 6 2 آلکساندر سولژنیتسین , 7 2 شمس تبریزی , 8 2 ملاله یوسف‌زی , 9 2 جان استاینبک , 10 2 صدام حسین , 11 2 گهواره گربه , 12 2 شوالیه تاریکی , 13 2 بغداد , 14 2 معمر قذافی , 15 2 حج , 16 2 ابوبکر , 17 2 حامد کرزی , 18 2 سجاد , 19 2 جعفر صادق , 20 2 ایران , 21 2 تهران , 22 2 محمدرضا پهلوی , 23 2 حسین بن علی , 24 2 مخمصه , 25 2 رستگاری در شاوشنک

mar 2014: 1 4 زندگی , 2 3 حسن روحانی , 3 3 عمر مختار , 4 3 انسان , 5 2 پریکلس , 6 2 مجید مجیدی , 7 2 بیل برایسون , 8 2 استیو مارابولی , 9 2 توپاک شکور , 10 2 کریستوفر مارلو , 11 2 ادگار واتسون هاو , 12 2 ساموئل جانسون , 13 2 کلارنس دارو , 14 2 سو تاونسند , 15 2 والتر رالی , 16 2 جان ماری گیبون , 17 2 جان هیت استابز , 18 2 رالف ریچاردسون , 19 2 اشرف ریفی , 20 2 حکومت , 21 2 سال بلو , 22 2 آرت بوخوالد , 23 2 سیلماریلیون , 24 2 دایدو , 25 2 اسلام

abr 2014: 1 3 فاطمه زهرا , 2 2 محدث نوری , 3 2 هریت بیچر استو , 4 2 مارکی دوساد , 5 2 راشل کارسون , 6 2 پسرعمه زا , 7 2 احمد مسجدجامعی , 8 2 چارلز مک‌کارتی , 9 2 جورج کارلین , 10 2 رضا نظری , 11 2 فضل‌الله زاهدی , 12 2 رجب طیب اردوغان , 13 2 عبدالله بن عبدالعزیز , 14 2 محسن موسوی تبریزی , 15 2 عبدالرحمن اوزاعی , 16 2 نادانی , 17 2 آب , 18 2 لوئیزا می آلکوت , 19 2 غیرت , 20 2 صادق زیباکلام , 21 2 رزا لوکزامبورگ , 22 2 محمدعلی جمال‌زاده , 23 2 کاشان , 24 2 والتر گروپیوس , 25 2 ویل راجرز

mai 2014: 1 3 رضا داوری اردکانی , 2 3 مریم طاهری مجد , 3 3 کامبیز درم‌بخش , 4 3 لودویگ ویتگنشتاین , 5 2 ارومیه , 6 2 ایوان تورگنیف , 7 2 نیکلای گوگول , 8 2 مصطفی ملکیان , 9 2 احسان نراقی , 10 2 لیلا حاتمی , 11 2 غلامحسین ابراهیمی دینانی , 12 2 ناتاشا امیری , 13 2 مهشید امیرشاهی , 14 2 فرخنده آقایی , 15 2 شیرین نشاط , 16 2 پگاه احمدی , 17 2 بهاره رهنما , 18 2 ابوتراب خسروی , 19 2 مهدی یزدانی‌خرم , 20 2 حمیدرضا صدر , 21 2 محمد بساطی , 22 2 خیری شلبی , 23 2 علاء الاسوانی , 24 2 ابراهیم اصلان , 25 2 ادوار خراط

jun 2014: 1 2 آنتیستینس , 2 2 اخراجی ها ٢ , 3 2 پیامک , 4 1 ویلیام سامرست موآم

jul 2014: 1 3 اروین د. یالوم , 2 3 گراتزیا دلدا , 3 2 جیم موران , 4 2 نوری مالکی , 5 2 جی.کی. رولینگ , 6 2 دولت اسلامی عراق و شام , 7 2 خسرو شکیبایی , 8 2 حماس , 9 2 پیروز مجتهدزاده , 10 2 سید محمود هاشمی شاهرودی , 11 2 سیما تیرانداز , 12 2 محمدباقر نجفی اصفهانی , 13 2 حسن قزوینی , 14 2 تروریسم , 15 2 ابوبکر کرجی , 16 2 سجاد , 17 2 روز قدس , 18 2 هوشنگ ابتهاج , 19 2 مهدی اخوان ثالث , 20 2 کورش بزرگ , 21 2 حافظ , 22 1 تغار

ago 2014: 1 3 فریدون فرخزاد , 2 3 شیخ فضل‌الله نوری , 3 2 یزدگرد سوم , 4 2 وضعیت سفید , 5 2 علی دیواندری , 6 2 ایران , 7 2 گربه , 8 2 صادق هدایت , 9 2 فهرست افراد بر اساس نام , 10 1 مسیحیت

set 2014: 1 2 مسعود جعفری جوزانی , 2 2 غلامرضا اعوانی , 3 2 محمدامین قانعی‌راد , 4 2 سید جواد طباطبایی , 5 2 هوگو چاوز , 6 2 ماکسیم رودینسون , 7 2 برنارد کوشنر , 8 2 جان راسکین , 9 2 دایدو , 10 2 بدیع‌الزمان همدانی , 11 2 رضا کیانیان , 12 2 حامد کرزی , 13 2 عادل فردوسی‌پور , 14 2 ایران , 15 2 تهران , 16 2 گربه , 17 1 ابن قتیبه دینوری

out 2014: 1 3 حسین شهابی , 2 2 محمد نوریزاد , 3 2 منجمد (فیلم ۲۰۱۳) , 4 2 رسول یونان , 5 2 محمدکریم پیرنیا , 6 2 فریدون آدمیت , 7 2 عبدالسلام عظیمی , 8 2 بن افلک , 9 2 استاد الهی , 10 2 نعمت‌الله فاضلی

nov 2014: 1 4 حسین شهابی , 2 3 جک هندی , 3 2 غلامحسین ابراهیمی دینانی , 4 2 ارتداد در اسلام , 5 1 لودویگ وان بتهوون

dez 2014: 1 2 حسین شهابی , 2 2 هوپ‌هوپ‌نامه , 3 2 جلال‌الدین فارسی , 4 2 حسن رحیم‌پور ازغدی , 5 2 بروس لی , 6 1 علی زعیم

jan 2015: 1 2 زندگی در پیش رو , 2 2 ناجی العلی , 3 2 سهراب سپهری , 4 2 فردوسی , 5 1 میرزا سروش لهراسب

fev 2015: 1 3 ویلیام فاکنر , 2 2 بازاریابی شبکه‌ای , 3 2 تئو درات , 4 2 برایان کرنیگان , 5 2 جامیکا کینکید , 6 2 استیون اسپندر , 7 2 مارگارت تاچر , 8 2 دنیس ریچی , 9 2 انجمن حجتیه , 10 2 ایران , 11 2 تهران , 12 2 خواجه عبدالله انصاری , 13 2 اوشو , 14 2 باباطاهر , 15 2 حافظ , 16 2 داگلاس آدامز , 17 2 عشق , 18 2 فرانسیس بیکن

mar 2015: 1 3 پل اردیش , 2 3 ریاضیدان , 3 2 لینوس توروالدز , 4 2 بازاریابی شبکه‌ای , 5 2 برهان غلیون , 6 2 فریدون فرخزاد , 7 2 دولت اسلامی عراق و شام , 8 2 عبدالسلام , 9 2 آدولف اوکس , 10 2 هانس کریستیان آندرسن , 11 2 کن تامسون , 12 2 ایران , 13 2 ونسان ون گوگ , 14 2 فردریک هگل , 15 2 قرآن , 16 2 ابن سینا , 17 2 سعدی , 18 2 ویرجینیا وولف , 19 1 سحر جعفری جوزانی

abr 2015: 1 2 طبل حلبی , 2 2 یوهان ولفگانگ فون گوته , 3 2 هنری پوانکاره , 4 2 حسن روحانی , 5 2 چارلز داروین , 6 1 آنری پوانکاره

mai 2015: 1 2 عرفان خسروی , 2 2 حسین شهابی , 3 2 دولت اسلامی عراق و شام , 4 2 مصطفی چمران , 5 1 هاگاکوره

jun 2015: 1 2 عباس زریاب خویی , 2 2 چشم‌هایش , 3 2 صادق هدایت , 4 2 علی بن ابی‌طالب , 5 1 خرمگس (رمان)

No data on this page have been normalized to 30 day months (as WMF does on certain traffic reports).
Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Quinta-feira, 30 de julho 2015 22:51

Dump file fawikiquote-20150702-stub-meta-history.xml.gz (edits only), size 3.8 Mb as gz -> 27 Mb
Dump processed till Jun 30, 2015, on server stat1002, ready at Sun-05/07/2015-15:39 after 22 sec.

Versão do script:2.6
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.