Estatísticas da Wikiquote persa

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist

Metrics have been collected from a full archive dump, which contains all revisions of every article, meta data and raw content.
See also metrics definitions


 
Monthly counts & Quarterly rankings: março 2015
 
DataWikiquotariansArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
mar 2015+1%   +4%   +86%+2%+2%+2%+1%+5%+10%+1%
fev 2015+1%   0%   +92%0%0%+1%0%-0%0%0%
jan 2015+1%   0%   +96%-1%-1%-1%0%+1%-3%0%
dez 20140%   0%   -42%0%0%0%0%-0%0%0%
nov 20140%   0%   -68%0%0%0%0%0%0%0%
out 2014+2%   +4%   -49%+2%+2%+1%0%-0%+6%+2%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
mar 20151512713,0 k413,6205651112 Mb1,2 M21 k2,3 k1,5 k3,7 k1,5 k
fev 20151491512,8 k 13,9209027512 Mb1,2 M20 k2,3 k1,4 k3,3 k1,5 k
jan 201514824 2,8 k 13,9208414311 Mb1,2 M20 k2,3 k1,4 k3,3 k1,5 k
dez 2014146 4 2,8 k 13,821087312 Mb1,2 M20 k2,3 k1,4 k3,4 k1,5 k
nov 2014146 7 2,8 k 13,8210712612 Mb1,2 M20 k2,3 k1,4 k3,4 k1,5 k
out 20141463612,8 k313,8210638912 Mb1,2 M20 k2,3 k1,4 k3,4 k1,5 k
set 20141431612,7 k714,1214976411 Mb1,2 M20 k2,3 k1,4 k3,2 k1,4 k
ago 201414248 2,5 k115227039311 Mb1,1 M20 k2,3 k1,3 k2,9 k1,4 k
jul 20141381612,5 k615,1233876311 Mb1,1 M20 k2,2 k1,3 k2,8 k1,3 k
jun 201413714 2,3 k 16237350410 Mb1,1 M19 k2,2 k1,3 k2,5 k1,2 k
mai 20141363922,3 k815,8237296810 Mb1,1 M19 k2,2 k1,3 k2,5 k1,2 k
abr 20141332922,0 k517,425992,5 k10 Mb1,0 M18 k2,1 k1,0 k2,0 k1,2 k
mar 2014131 621,9 k417,325911,0 k9,6 Mb967 k18 k13 k9121,7 k1,0 k
fev 20141312431,8 k117,926796819,3 Mb938 k17 k12 k8461,6 k927
jan 20141291611,7 k117,927028509,2 Mb929 k17 k12 k8231,5 k908
dez 20131281521,7 k117,826867528,9 Mb902 k16 k12 k8001,3 k829
nov 2013127 211,6 k217,826665938,6 Mb873 k15 k11 k7491,2 k752
out 2013127 411,6 k 18,128132778,8 Mb890 k15 k10 k6971,2 k618
set 20131271311,6 k11828145308,7 Mb886 k15 k9,9 k6351,1 k610
ago 20131262831,6 k317,928209978,6 Mb876 k14 k9,2 k5951,1 k601
jul 201312416 1,5 k118,329221838,5 Mb854 k14 k9,1 k528963586
jun 201312346 1,4 k 18,529532098,4 Mb849 k14 k9,1 k521953580
mai 201311938 1,4 k 18,429461238,4 Mb844 k14 k9,0 k521943580
abr 201311624 1,4 k 18,329441698,4 Mb842 k14 k9,0 k522944579
mar 201311422 1,4 k 18,429321368,3 Mb830 k14 k8,9 k520924573
fev 201311213 1,4 k 18,42905968,1 Mb818 k14 k8,9 k521912563
jan 201311126 1,4 k 18,529182538,1 Mb816 k14 k8,9 k522915563
dez 201210923 1,4 k 18,328311067,9 Mb788 k14 k8,8 k522909557
nov 2012107 1 1,4 k 18,32827747,9 Mb784 k14 k8,7 k520884556
out 201210712 1,4 k 18,328371167,9 Mb785 k14 k8,7 k522879556
set 201210611 1,4 k118,328281787,8 Mb778 k14 k8,7 k522879555
ago 201210514 1,4 k118,528551797,8 Mb773 k14 k8,7 k521873555
jul 201210416 1,4 k 18,628792837,7 Mb770 k14 k8,6 k522846552
jun 201210313 1,3 k 18,528831617,7 Mb766 k14 k8,5 k522841551
mai 201210215 1,3 k 18,629032197,6 Mb763 k13 k8,4 k522836551
abr 201210126 1,3 k118,629072667,5 Mb756 k13 k8,3 k517811551
mar 2012992311,3 k 18,629352947,5 Mb753 k13 k8,2 k515793548
fev 20129712 1,3 k 18,529521597,5 Mb756 k13 k8,2 k520794546
jan 20129624 1,3 k 18,429431487,5 Mb753 k13 k8,1 k518794545
dez 20119427 1,3 k 18,329451497,4 Mb751 k13 k8,1 k517784544
nov 20119236 1,3 k 18,228371667,2 Mb719 k13 k8,1 k515776541
out 201189 2 1,3 k 18,228012237,0 Mb706 k13 k8,0 k515767541
set 20118914 1,3 k 1827981257,0 Mb705 k13 k7,8 k514768539
ago 20118812 1,3 k 1828021337,0 Mb704 k13 k7,8 k511757538
jul 201187 1 1,3 k 17,927871527,0 Mb700 k13 k7,8 k511758537
jun 20118723 1,3 k 17,927911316,9 Mb696 k13 k7,7 k508744536
mai 20118514 1,3 k 17,927831146,9 Mb691 k13 k7,6 k513737533
abr 201184 5 1,3 k 17,827702046,8 Mb686 k13 k7,6 k512733531
mar 20118437 1,2 k 17,827645806,8 Mb680 k13 k7,5 k513725528
fev 2011813711,2 k317,527096786,6 Mb658 k13 k7,4 k469685495
jan 2011784931,2 k318,227408716,3 Mb619 k13 k7,3 k346640427
dez 201074 2 1,1 k 18,827914606,0 Mb581 k12 k7,1 k304602377
nov 20107425 1,1 k 18,527752256,0 Mb576 k12 k7,0 k302574377
out 20107237 1,1 k 18,427701775,9 Mb572 k12 k6,9 k300566367
set 20106957 1,1 k 18,227602815,9 Mb568 k12 k6,9 k298548365
ago 20106417 1,0 k 18,227427225,7 Mb559 k12 k6,8 k279521358
jul 20106345 1,0 k 17,826961785,6 Mb539 k12 k6,8 k273493351
jun 20105915 1,0 k 17,727001215,5 Mb536 k12 k6,7 k272488349
mai 20105817 1,0 k 17,826671575,4 Mb524 k12 k6,7 k272479348
abr 20105714 999 17,826692235,4 Mb519 k12 k6,7 k272425348
mar 201056 5 988 17,727162205,3 Mb523 k12 k6,6 k269412346
fev 20105647 975 17,827382265,3 Mb520 k12 k6,5 k268400345
jan 201052 5 962 17,827183445,2 Mb510 k12 k6,3 k263393339
dez 20095224 950 17,626381935,0 Mb487 k12 k6,3 k261377338
nov 20095014 943 17,526352354,9 Mb483 k12 k6,2 k260377337
out 200949 4 938117,425665154,8 Mb467 k12 k6,2 k258343328
set 20094927 922117,125092724,6 Mb449 k12 k6,0 k255316318
ago 20094717 898 17,325241,0 k4,5 Mb440 k12 k5,8 k254299310
jul 20094616 893216,224442004,4 Mb423 k12 k5,8 k251277308
jun 200945 3 830117,225891574,3 Mb416 k11 k5,8 k253261306
mai 20094524 812 17,426362624,2 Mb415 k11 k5,7 k250260302
abr 200943 6 809 17,126343004,2 Mb413 k11 k5,6 k252256297
mar 200943151802 16,926264934,2 Mb407 k11 k5,6 k252254292
fev 200942371790116,626134394,1 Mb398 k11 k5,5 k222238272
jan 20093915 775116,325942314,0 Mb388 k11 k5,4 k215214233
dez 200838141752 16,526423063,9 Mb383 k11 k5,3 k215212231
nov 200837 4 740 16,426551473,9 Mb379 k11 k5,2 k212200224
out 20083716 732 16,326461733,8 Mb374 k11 k5,1 k209193219
set 20083616 729116,226562483,8 Mb374 k11 k5,1 k208192211
ago 200835172702316,426784223,7 Mb364 k10 k4,9 k207171207
jul 200834 7 622117,929461793,6 Mb355 k9,9 k4,7 k191168189
jun 20083415 601 18,229851403,5 Mb347 k9,8 k4,6 k188162188
mai 200833271590218,329935673,5 Mb342 k9,7 k4,5 k185149183
abr 20083127253811930606473,2 Mb318 k8,7 k4,4 k169107178
mar 200829 5 514 18,630082233,0 Mb299 k7,7 k4,2 k16090169
fev 200829 41511118,330036033,0 Mb296 k7,7 k4,1 k15887165
jan 200829372489117,928898272,8 Mb273 k6,6 k4,1 k14285158
dez 200726481452 17,528224972,5 Mb246 k5,5 k3,9 k12668137
nov 200722 4 440 16,927921192,4 Mb238 k4,9 k3,8 k12167135
out 200722131434 16,828479302,4 Mb239 k4,9 k3,7 k12365134
set 200721151424 1527819322,3 Mb228 k4,2 k3,5 k10755129
ago 200720 51412 13,226356592,1 Mb210 k3,4 k2,7 k6354115
jul 200720261405111,825019112,0 Mb196 k3,1 k2,5 k5042109
jun 200718 21388 1022761851,7 Mb171 k1,6 k2,4 k3739102
mai 200718 31375 9,822471951,6 Mb164 k1,5 k2,3 k283897
abr 20071814 36919,522102761,6 Mb158 k1,4 k2,3 k273892
mar 200717 2135119,222052601,5 Mb150 k1,3 k2,2 k263189
fev 200717 1 335 8,822141201,5 Mb143 k1,2 k2,1 k273182
jan 200717 2 331 8,621751591,4 Mb139 k1,2 k2,1 k263180
dez 20061713 319 8,421231791,3 Mb131 k1,1 k2,0 k263077
nov 20061635 314 820881441,3 Mb127 k1,1 k1,9 k252974
out 200613 31303 7,820901991,2 Mb123 k1,1 k1,9 k242772
set 200613 51291 7,420252971,2 Mb115 k9781,8 k232269
ago 20061313128416,61729205985 kb96 k8551,6 k231961
jul 20061236226816,21555511847 kb83 k7951,5 k221661
jun 20069 2122415,11285191642 kb59 k46887618429
mai 20069121186 5,11198163544 kb43 k20883415323
abr 2006812 17614,51114129402 kb37 k18672212220
mar 2006713 15914,21051182324 kb32 k16558111 17
fev 2006612 12014131089304 kb29 k1664443 11
jan 20065 1 99 4152349290 kb28 k1654132 7
dez 20055 1 86 4176141284 kb28 k1653672 6
nov 2005523 71 4,3200887265 kb27 k1602682 4
out 20053 1 60 3,6223721248 kb25 k1572232 3
set 2005312 60 3,2221744243 kb25 k1281971 2
ago 20052   47 3,227665236 kb24 k1251521 1
jul 20052 1 4513,2288687236 kb24 k1251521 1
jun 20052 2 17 3,4737526225 kb23 k86134   
mai 20052   7 4,6176334221 kb23 k86133   
abr 20052 1 7 41762817220 kb23 k86133   
mar 2005211 4 2,81981410134 kb15 k8474   
fev 20051   1 1445 1,9 kb77 106 9 
jan 20051   1 1445 1,9 kb77 106 9 
dez 20041   1 1445 1,9 kb77 106 9 
nov 20041   1 1445 1,9 kb77 106 9 
out 20041   1 1445 1,9 kb77 106 9 
set 20041   1 1445 1,9 kb77 106 9 
ago 200411  1 144511,9 kb77 106 9 
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
The following table ranks this project in relation to projects in other languages with 1000+ articles
jan 20151310161615161511221111141361047
out 20141351081561511111111141461047
jul 2014131311917312961111141561047
abr 2014131410818410881111141761347
jan 20141314121219128891112141871547
out 201313191282016771511121421101747
jul 201313131292010761511121525122047
abr 2013131013112011761611121525121947
jan 2013131113152214762311121525121847
out 2012131624162120762711121423121847
jul 2012131712152116761911131423121847
abr 201214914142111751811131423121647
jan 201214913122013751811121223121647
out 2011142023122015762511131223111647
jul 201114202812201476241113122091647
abr 201114201410201386201112122091547
jan 20111568521676712121219111547
out 20101671282013661712131220111547
jul 201016713142015762112131220111647
abr 201017181313201220201412131020111747
jan 201018211312201520201312131020111747
out 200917211620201019191813151020111747
jul 20091717101119518181513151020111847
abr 200918191214191718181612151019111847
jan 200918191413191218181712151019101747
out 200818141311191218181912151019101847
jul 200817231314221218181912151020101847
abr 20081811126221117171113151020102147
jan 200819911722141515111415122092447
out 20072019191122171515814151420102347
jul 20072012131522141515713151421132547
abr 200720141415221614141615171719152447
jan 200719252513201813132116151816142247
out 200619201712201813131715151716121947
jul 200619101111201612121217171817122447
abr 200620122111221512121819192324154047
jan 2006252427172218992620191922214547
out 2005231817101812772215161618174247
jul 2005231518101811551412131617164147
abr 200520161571910441813121415103947
jan 20052514145309332834322318101345
out 20042119185238223026252186637
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100ediçõesbytes
 WikiquotariansArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikiquotarians (usuários registrados)
A = Wikiquotarians que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikiquotarians que editaram pelo menos dez vezes desde que chegaram
C = Wikiquotarians que contribuíram cinco vezes ou mais este mês
D = Wikiquotarians que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  5  10  100  1  3  5  10  25  100  5  10  100  1  3  5  10  25  100  250  5  10  100 
mar 2015191274311    128731 2211076421 221
fev 201517105221     17843  111199511  11 
jan 2015219442     85       932       
dez 201418742      73311111 3         
nov 2014248721     62    111143     11 
out 201416116431     94321 11 12322211   
set 201419764211    134111 11 1132221    
ago 20142412876     72111 111104111     
jul 201417865211    811      94322     
jun 2014135422  11197521 11 102211  11 
mai 2014201194221    532      63211     
abr 201425129522212226411     124411  111
mar 2014211065421    84431    145511     
fev 201411444431    5332     7322      
jan 201422764311    821      115431     
dez 201322854422    8443     104221     
nov 201311622211    52111    133211  11 
out 20131564321     421      922       
set 201314433111 11 6211     85441     
ago 2013181186531 11 6411     622221    
jul 2013147632     43       10311      
jun 201315864   21 3        5      1  
mai 20131811841     62       82211     
abr 2013187421  11 42       10311   1  
mar 2013115211     1        10221      
fev 201395311     62    11 8321   11 
jan 2013187631  22 3     11 6      11 
jan 2015219442     85       932       
out 201416116431     94321 11 12322211   
jul 201417865211    811      94322     
abr 201425129522212226411     124411  111
jan 201422764311    821      115431     
out 20131564321     421      922       
jul 2013147632     43       10311      
abr 2013187421  11 42       10311   1  
jan 2013187631  22 3     11 6      11 
out 201214322   22 5     11 52     11 
jul 2012187641  32 7321  11 852    11 
abr 2012179652  21 41    111411    2  
jan 20122484    22 41    1115      11 
out 20111752    22171    111911    11 
jul 20111641    11 31       621    11 
abr 2011198521  11 41       621       
jan 2011241296431 33 103332    116332  1  
out 201028874   11 5111     12111      
jul 2010176541  11 4        1         
abr 2010209431  32 311      73111     
jan 2010217522  11 21       72221  1  
out 2009135422  2225221     83221     
jul 2009208643  1  322      104211     
abr 2009198642  11 532      126433  111
jan 2009136532  22 3111     104321     
out 20081710621  11 411      85411     
jul 20081711742     511      72211  11 
abr 200813975421 22 104311    84442     
jan 2008151175321 11 95521    74221     
out 200712532111 22211222     102221     
jul 200712864111    533      432111    
abr 200797442     3111     53321     
jan 200752211     3111     43221     
out 2006853211     2221     32211     
jul 20061286542     93221    933221 11 
abr 2006106222     7331     6321      
jan 200652111     3111     21111     
out 20051111               11        
jul 200521111              11111     
abr 20051111      1        21111     
jan 2005                            
out 2004                            

 

Distribuição de edições de artigos por wikiquotarians
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikiquotariansEdições total
1827100.0%28,714100.0%
331438.0%27,89997.2%
1015518.7%26,98894.0%
32526.3%25,30388.1%
100232.8%23,80782.9%
316121.5%22,01976.7%
100050.6%18,26263.6%
316220.2%13,07145.5%

 

19 wikiquotarians recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions
agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
Sonia SevillaUC1 06,85529893788set 10, 201016621,21696--
RAHA68UC3 02,269712519abr 30, 20121064743--
MahanUC14 029148814fev 16, 201440718---
CommonsDelinkerUC17+1138326-mai 13, 20072878----
MohandesWikiUC19+2133591842mar 25, 20143702---
محسن نامدارزادهUC24+59021--jun 28, 20142751---
کافر مقدسUC25-19082-ago 07, 20142352---
Erfan-93UC34...575777mar 18, 2015121616--
Amg72827UC69+372381-abr 06, 20143582---
MjbmrUC111+18142190139jan 07, 20111543----
BkouhiUC117+431452-jul 27, 20136114---
Farhad2010UC157+11912-abr 08, 20111452----
AkfossUC266...55--mar 13, 201517----
HamedvahidUC290+6441--mar 25, 2011146621--
ویرایشگر-1UC310+4704322mar 18, 201437711--
مسعود بوکانیUC314...44--mar 27, 20153----
RacconishUC526+284211-nov 14, 2014136----
YanamataUC532...22--mar 24, 20156----
احمد ادیب نیشابوریUC827...11--mar 27, 20153----

 

20 wikiquotarians recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
AmouzandehUC26,216abr 11, 20063275mai 31, 20101764
SajadUC41,824mar 26, 20053656out 29, 2014152
MardetanhaUC51,098ago 08, 20072791abr 02, 2014362
مهدیUC6706fev 05, 20092244jan 27, 2013792
JDiamondUC7662set 05, 20092032fev 01, 20111518
Jamal NazarethUC8652fev 01, 20111518abr 21, 20111439
TaranetUC9576jan 13, 20082633abr 01, 2014363
WayiranUC10445abr 24, 20082531mai 30, 20111400
BilijacksUC11396nov 16, 20063056abr 20, 2014344
SialkgraphUC12320jul 23, 2013615jul 31, 2014242
Ahura21UC13310mai 24, 20111406ago 14, 2014228
AbsdostanUC15150set 13, 20092024jan 02, 20121183
RabinsonUC16144out 11, 20082361jun 16, 20101748
ShervinafsharUC18137nov 11, 20053426dez 25, 2013460
Hard BackrestUC20132dez 31, 20082280abr 24, 2014340
SahimUC21132ago 04, 20101699jan 09, 20121176
FollowerrUC22113jan 09, 20111541mai 11, 20111419
Mahnaz92UC23108jun 12, 2013656ago 06, 2013601
ManimihanUC2682out 22, 2014159jan 28, 201561
آئیلUC2780jul 17, 2014256jul 27, 2014246

 

usuários anônimos, ordenados por número de contribuições
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
85.185.1.4160
217.219.137.1962
85.185.1.1462
129.217.132.3649
2.186.172.13939
80.71.114.3533
31.58.225.15229
80.75.8.11427
188.158.107.2626
217.219.1.926

No total 4.323 edições foram feitas por usuários anônimos, de um total de 40.101 edições ( 10e %)
  


29 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
AnankeBotUC11,350dez 18, 20082293set 16, 2013560--
TanhabotUC21,191abr 23, 20082532dez 08, 20101573--
ChtitBotUC3966set 08, 20072760fev 06, 20111513--
DexbotUC4673abr 08, 2014356abr 14, 2014350--
EleferenBotUC5464fev 13, 20101871jan 13, 2013806--
SahimrobotUC6412ago 14, 20101689ago 15, 20101688--
MohandesBotUC7372jun 02, 2014301jun 19, 2014284--
FaraBotUC8346out 11, 20072727out 11, 20072727--
KamikazeBotUC9259dez 17, 20101564dez 09, 20111207--
ArthurBotUC10157out 14, 20091993dez 02, 20091944--
MerlIwBotUC11133jul 26, 2012977jun 14, 2013654--
SamoaBotUC12125abr 09, 2014355abr 15, 2014349--
LaaknorBotUC13119out 23, 20082349jan 20, 2013799--
AvicBotUC1488ago 11, 20111327set 07, 20111300--
Idioma-botUC1582mar 02, 20111489jul 16, 2012987--
VolkovBotUC1652jun 30, 20092099abr 16, 20121078--
MjbmrbotUC1746fev 04, 20111515mar 27, 20111464--
JAnDbotUC1843ago 17, 2013590ago 28, 2013579--
CarsracBotUC1942mar 19, 20111472abr 15, 2013714--
DinybotUC2017mar 24, 20072928dez 16, 20072661--
Sir Nicholas de Lenfent BotUC2115abr 09, 20101816abr 19, 20101806--
FiriBotUC2213jan 09, 20111541jan 09, 20111541--
ChobotUC239dez 04, 2012846mar 13, 2013747--
KgsbotUC247dez 13, 20101568jan 18, 20111532--
AmolbotUC253dez 07, 20101574dez 07, 20101574--
EdwardsBotUC262jul 03, 20111366jul 03, 20111366--
RezabotUC271out 18, 20111259out 18, 20111259--
AvocatoBotUC281abr 17, 20121077abr 17, 20121077--
AbotUC291nov 28, 2013487nov 28, 2013487--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110GifJpgPngSvg
mar 20154,5 k7461,7 k1045056231730      500370301
fev 20154,3 k7401,7 k1044665991724      239370301
jan 20154,3 k7331,7 k1044655901723      134370301
dez 20144,3 k7291,7 k1044655891723      59370301
nov 20144,3 k7271,7 k1044655891723      111370301
out 20144,3 k7181,7 k1044655891723      366370301
set 20144,2 k7061,7 k1044135251710      738370301
ago 20143,9 k6911,7 k1043484951704      326370301
jul 20143,8 k6841,7 k1043474771703      746370301
jun 20143,5 k6801,7 k1043474761677      108370301
mai 20143,5 k6721,7 k1013464551676      930368291
abr 20143,2 k6701,7 k1013464551663      1685368291
mar 20142,9 k6641,7 k1013464551656      1012368291
fev 20142,7 k6581,7 k1003464551644      665367291
jan 20142,7 k6521,7 k1003464501635      789367291
dez 20132,5 k6431,7 k1003464491623      728367291
nov 20132,4 k6391,7 k1003464491617      547367291
out 20132,2 k6331,7 k1003374411591      254367291
set 20132,2 k6271,7 k1003374411589      415367291
ago 20132,2 k6081,7 k993374401573      930366291
jul 20132,1 k6021,7 k973374271470      167364291
jun 20132,1 k5921,7 k963374271470      76364281
mai 20132,1 k5881,7 k963374261470      107364281
abr 20132,1 k5831,7 k963374261470      87364281
mar 20132,1 k5761,7 k963374241466      78364281
fev 20132,1 k5651,7 k963374241464      80364281
jan 20132,0 k5581,6 k963374241461      101364281
dez 20122,0 k5551,6 k963374241461      73364281
nov 20122,0 k5461,6 k953374241461      25363281
out 20122,0 k5421,6 k953374241460      49363281
set 20122,0 k5381,6 k953374241459      62363281
ago 20122,0 k5281,6 k953374241459      87363281
jul 20122,0 k5201,6 k953374241458      104363281
jun 20122,0 k5141,6 k953374231458      77363281
mai 20121,9 k4901,6 k953374231458      134363281
abr 20121,9 k4821,6 k943374231458      164362281
mar 20121,9 k4711,6 k943374231458      164362281
fev 20121,9 k4641,6 k943374231458      42362281
jan 20121,9 k4521,6 k943374211458      64362281
dez 20111,9 k4481,6 k943374211457      97362281
nov 20111,9 k4441,6 k943374191457      106362281
out 20111,9 k4291,6 k943374181455      40362281
set 20111,9 k4191,6 k943374161455      70362281
ago 20111,9 k4051,6 k943374141454      36362281
jul 20111,9 k4001,6 k943374121454      35362281
jun 20111,9 k3911,6 k943374121450      79362281
mai 20111,8 k3831,6 k943374121450      60362281
abr 20111,8 k3711,6 k943374101450      98362281
mar 20111,8 k3601,6 k943374101450      304362281
fev 20111,8 k3521,6 k843374031448      607253281
jan 20111,6 k3161,6 k563303741431      737129251
dez 20101,5 k3081,6 k483273621396      51121251
nov 20101,5 k3041,6 k483273621396      113121251
out 20101,5 k3001,6 k483273611395      118121251
set 20101,5 k2911,6 k483273561395      204121251
ago 20101,4 k2831,6 k433273521388      204116251
jul 20101,4 k2671,6 k423272701382      105115251
jun 20101,4 k2671,6 k413272701382      58114251
mai 20101,4 k2491,6 k413262701382      110114251
abr 20101,4 k2441,6 k413262701382      106114251
mar 20101,4 k2371,5 k413262701382      63114251
fev 20101,4 k2341,5 k413252671379      118114251
jan 20101,3 k2301,5 k403252671378      11111425 
dez 20091,3 k2141,4 k403252671378      7211425 
nov 20091,3 k2071,4 k393252671378      12011325 
out 20091,3 k2051,4 k393252671378      19011325 
set 20091,3 k2001,4 k383252671374      22311324 
ago 20091,2 k1891,3 k383252651372      12611324 
jul 20091,2 k1891,3 k383252651372      17011324 
jun 20091,2 k1831,3 k383242621372      10911324 
mai 20091,1 k1811,2 k383242601372      10111324 
abr 20091,1 k1791,2 k383242601372      17811324 
mar 20091,1 k1661,2 k373242321358      43911224 
fev 20091,1 k1501,2 k333241821214      3961923 
jan 20091,0 k1411,1 k323241821145      1421823 
dez 20089881381,1 k323241801141      2061823 
nov 20089691341,1 k323241791140      971823 
out 20089561171,0 k323241741134      1121823 
set 20089431031,0 k323211741134      1521823 
ago 200891299973323211741133      3731823 
jul 200881495941303201701132      1551623 
jun 200879392911303201701130      1211623 
mai 200877685911303201701130      4671623 
abr 200872080880303151671126      5041623 
mar 200868676815293141591123      1481622 
fev 200867973785293141591123      5091622 
jan 200865067753273141591123      7111422 
dez 200759364723253141541105      4391222 
nov 200757860690243141491105      621221 
out 200757158690243101481105      3901221 
set 200755451629243101461105      7321221 
ago 200752943596243101411101      6081221 
jul 20075154056424310132196      8791221 
jun 20074913953224310130194      1651221 
mai 2007474395002329186193      1481220 
abr 2007465374472329086193      2091220 
mar 2007447354092328984187      1941220 
fev 2007436343822224974171      84 220 
jan 2007431313572224974171      113 220 
dez 2006419313102223674171      139 220 
nov 2006413302962123640136      91 120 
out 2006396272462122837135      146 120 
set 2006377272102122537135      225 120 
ago 2006352261732122137135      173 120 
jul 2006334221322121933134      497 120 
jun 200627313952118628128      172 120 
mai 200623711652118627127      143 120 
abr 20062049352118527127      103 120 
mar 20061806182118527 24      124 120 
fev 20061355162018116 14      66 119 
jan 20061105152017014 14      40 119 
dez 2005954151916711 14      29 118 
nov 200578315191629 14      73 118 
out 20056421421556 14      17 11 
set 20056221411555 14      39  1 
ago 20054821311525 14      4  1 
jul 20054621311505 14      87  1 
jun 20051821011444 4      24  1 
mai 2005821011163 2      1  1 
abr 2005711011163 2      15  1 
mar 2005419 1163 2      10    
fev 20051   116              
jan 20051   116              
dez 20041   116              
nov 20041                  
out 20041                  
set 20041                  
ago 20041                  

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

ago 2004: 1 1 Main Page

mar 2005: 1 1 ضرب‌المثل‌های عربی

abr 2005: 1 1 آدولف هیتلر

mai 2005: 1 1 ضرب‌المثل‌های فارسی

jun 2005: 1 2 آقامحمدخان قاجار , 2 2 عزیز نسین , 3 2 صفحهٔ اصلی , 4 1 محمود احمدی‌نژاد

jul 2005: 1 2 ناشناس , 2 1 ویلیام فالکنر

ago 2005: 1 2 صفحهٔ اصلی , 2 1 فهرست بر اساس فيلم‌ها

set 2005: 1 3 صفحهٔ اصلی , 2 2 علی بن ابی‌طالب , 3 2 ناشناس , 4 1 ارنستو چه گوارا

out 2005: 1 1 فهرست افراد براساس نام

nov 2005: 1 2 کورش مدرسی , 2 2 منصور حکمت , 3 2 حمید تقوایی , 4 2 محمود احمدی‌نژاد , 5 1 دوگ لارسون

dez 2005: 1 1 امبرتو اکو

jan 2006: 1 2 اپیکور , 2 2 ارنستو چه گوارا , 3 1 کانت

fev 2006: 1 2 آلبر کامو , 2 2 زیلاکس , 3 1 محمدتقی مصباح یزدی

mar 2006: 1 2 توماس جفرسون , 2 2 ماتریکس , 3 2 فهرست آثار ادبی , 4 2 فهرست افراد بر اساس نام , 5 2 صفحهٔ اصلی , 6 1 کارلوس کاستاندا

abr 2006: 1 4 صفحهٔ اصلی , 2 3 هرمان هسه , 3 2 مارتین لوتر , 4 2 ضرب‌المثل‌های هلندی , 5 2 استانیسلاو لم , 6 2 ارنست همینگوی , 7 2 مایکل جکسون , 8 2 آلبرت اینشتین

mai 2006: 1 2 رابرت آنسون هاین‌لاین , 2 2 رفیق شامی , 3 2 جلال‌الدین محمد بلخی , 4 2 داگلاس آدامز , 5 2 فرانسوا لارشفوکو , 6 2 ضرب‌المثل‌های لاتینی , 7 2 واشنگتن ایروینگ , 8 2 توماس جفرسون , 9 1 محمد خیابانی

jun 2006: 1 2 فرانسوا فنلون , 2 2 ژان دو لافونتن , 3 2 وینستون چرچیل , 4 2 فهرست افراد بر اساس نام , 5 2 صفحهٔ اصلی , 6 1 رنه دکارت

jul 2006: 1 3 هلن کلر , 2 3 آیان حرصی علی , 3 3 آرزو , 4 3 آندره ژید , 5 3 آرتور شوپنهاور , 6 2 سید مرتضی آوینی , 7 2 الویس پریسلی , 8 2 مسیر سبز , 9 2 کازابلانکا , 10 2 رستگاری در شاوشنک , 11 2 ژولیا کریستوا , 12 2 محمود فلکی , 13 2 منوچهر آتشی , 14 2 جنگ عراق , 15 2 باباطاهر , 16 2 ویلیام سارویان , 17 2 کارل سندبرگ , 18 2 اقبال لاهوری , 19 2 فدریکو فلینی , 20 2 فریدریش شیلر , 21 2 رنه دکارت , 22 2 امیرخسرو دهلوی , 23 2 علی‌اکبر دهخدا , 24 2 کندورسه , 25 2 افلاطون

ago 2006: 1 3 ضرب‌المثل‌های آذربایجانی , 2 3 صفحهٔ اصلی , 3 2 صادق هدایت , 4 2 سووشون , 5 2 شازده کوچولو , 6 1 محمدحسین شهریار

set 2006: 1 4 صفحهٔ اصلی , 2 3 فهرست افراد بر اساس نام , 3 2 بيل گيتس , 4 2 ضرب‌المثل‌های آذربایجانی , 5 2 عمر خیام , 6 2 حافظ , 7 2 میکل‌ آنژ , 8 2 محمود احمدی‌نژاد , 9 1 شهریار

out 2006: 1 2 ژان پل , 2 2 حسن تقی‌زاده , 3 2 ضرب‌المثل‌های آذربایجانی , 4 2 حافظ , 5 2 وودی آلن , 6 2 سعدی , 7 2 فهرست افراد بر اساس نام , 8 1 فرانکا ماگنانی

nov 2006: 1 2 باران کوثری , 2 2 کارل گوستاو یونگ , 3 2 برتولت برشت , 4 2 فهرست افراد بر اساس نام , 5 2 صفحهٔ اصلی , 6 1 محمدرضا شفیعی کدکنی

dez 2006: 1 2 غلامرضا روحانی , 2 2 باران کوثری , 3 2 دنیای سوفی , 4 2 جنگ , 5 2 آلبرت اینشتین , 6 2 فهرست آثار ادبی , 7 1 ریچارد رورتی

jan 2007: 1 3 پدرخوانده , 2 2 ریچارد نیکسون , 3 2 نیکوس کازانتزاکیس , 4 2 ری بردبری , 5 2 محمد زکریای رازی , 6 2 محمود احمدی‌نژاد , 7 2 صفحهٔ اصلی , 8 1 ضرب‌المثل‌های اندونزیایی

fev 2007: 1 2 قیصر , 2 2 صفحهٔ اصلی , 3 1 انجیل متی

mar 2007: 1 3 لودویگ فان بتهوون , 2 3 فریدریش نیچه , 3 2 رمکو کامپرت , 4 2 محمدرضا شفیعی کدکنی , 5 2 کلیم کاشانی , 6 2 بایگانی نقل‌قول روز , 7 2 سعدی , 8 2 صفحهٔ اصلی , 9 1 وگ:وگ

abr 2007: 1 3 فریدریش نیچه , 2 2 داستان یک سیندرلا , 3 2 کما , 4 2 تقاطع , 5 2 مهمان (فیلم) , 6 2 اخراجی‌ها , 7 2 فریدون جنیدی , 8 2 ابوریحان بیرونی , 9 2 وحید قزوینی , 10 2 عمر خیام , 11 2 فردوسی , 12 2 جلال‌الدین محمد بلخی , 13 2 مارتین لوتر

mai 2007: 1 2 راه بی‌پایان , 2 2 تله , 3 2 میم مثل مادر , 4 2 هنر , 5 2 جورج برنارد شاو , 6 2 فهرست آثار ادبی , 7 2 ناشناس , 8 1 اسدی طوسی

jun 2007: 1 2 جان رید , 2 2 مائو تسه تونگ , 3 2 باران کوثری , 4 2 محمد خیابانی , 5 2 عشق , 6 1 سرمایه‌داری

jul 2007: 1 2 سگ , 2 2 گربه , 3 2 عباس کیارستمی , 4 2 نیکلا سارکوزی , 5 2 روز سوم , 6 2 فریدریش انگلس , 7 2 مائو تسه تونگ , 8 2 فریدون جنیدی , 9 2 کارل مارکس , 10 2 سیسرو , 11 2 ضرب‌المثل‌های آلمانی , 12 2 علی شریعتی , 13 2 عشق , 14 1 کد داوینچی

ago 2007: 1 3 سیاست , 2 3 ضرب‌المثل‌های فارسی , 3 2 کریستین بویین , 4 2 سید روح‌الله خمینی , 5 2 ازدواج , 6 2 آزادی , 7 2 ولادیمیر لنین , 8 2 کارل مارکس , 9 2 علویه خانم , 10 2 ضرب‌المثل‌های اسپانیایی , 11 2 سید مرتضی آوینی , 12 2 داگلاس آدامز , 13 2 هنر , 14 2 دانش , 15 2 دوستی , 16 2 جنگ , 17 1 سنگسار

set 2007: 1 3 لئون تروتسکی , 2 3 محمود احمدی‌نژاد , 3 2 شتر , 4 2 مزرعه حیوانات , 5 2 ۱۹۸۴ , 6 2 ملالی جویا , 7 2 سید روح‌الله خمینی , 8 2 فاطمه زهرا/گفتار هایی از فاطمه زهرا , 9 2 فاطمه زهرا/اشعاری از شعرای کهن پیرامون فاطمه زهرا , 10 2 فاطمه زهرا/فاطمه زهرا در نگاه امامان شیعه , 11 2 ولادیمیر لنین , 12 2 ایرج‌میرزا , 13 2 اهلی شیرازی , 14 2 نقل‌قول روز , 15 2 باران کوثری , 16 2 ضرب‌المثل‌های ارمنی , 17 2 ضرب‌المثل‌های ایتالیایی , 18 2 افلاطون , 19 2 دانش , 20 2 آندره ژید , 21 2 جرج هربرت , 22 2 موریس مترلینک , 23 2 فهرست فیلم‌ها , 24 2 لئو بوسکالیا , 25 2 سورن کی‌یر کگارد

out 2007: 1 3 ژان دلا برویر , 2 2 آندری تارکوفسکی , 3 2 جان لاک , 4 2 شتر , 5 2 کارل مارکس , 6 2 باران کوثری , 7 2 ضرب‌المثل‌های ارمنی , 8 2 صادق هدایت , 9 2 ضرب‌المثل‌های آذربایجانی , 10 2 سنایی , 11 2 رقص , 12 2 فهرست فیلم‌ها , 13 1 مرکز موسیقی بتهوون

nov 2007: 1 3 علی بن ابی‌طالب , 2 2 داوید آلفارو سی‌که‌ایروس , 3 2 جیمز ناکس پولک , 4 2 ضرب‌المثل‌های آذربایجانی , 5 2 فیلم , 6 1 انقلاب

dez 2007: 1 5 فهرست افراد بر اساس نام , 2 4 دیوارنوشته , 3 4 ویلیام شکسپیر , 4 3 جلیل ضیاءپور , 5 3 خانه‌ای بر روی آب , 6 3 صلح , 7 3 فریدریش نیچه , 8 3 صفحهٔ اصلی , 9 2 ماهی , 10 2 انقلاب , 11 2 جورج دبلیو بوش , 12 2 محمدحسین شهریار , 13 2 ضرب‌المثل‌های آذربایجانی , 14 2 ضرب‌المثل‌های اسپانیایی , 15 2 فهرست نمایش‌های تلویزیونی , 16 2 ابن سینا , 17 2 عشق , 18 2 فهرست فیلم‌ها

jan 2008: 1 5 لوئیس بونوئل , 2 4 فهرست افراد بر اساس نام , 3 4 ضرب‌المثل‌های فارسی , 4 3 جنون , 5 3 محمدحسین شهریار , 6 3 ژان دارک , 7 3 محمود احمدی‌نژاد , 8 2 طبیعت , 9 2 جورج اورول , 10 2 مجنون , 11 2 زنبور , 12 2 مرگ , 13 2 خنده , 14 2 مکس پین , 15 2 کودک , 16 2 خوب، بد، زشت , 17 2 رومن رولان , 18 2 سیمین دانشور , 19 2 مادر , 20 2 فروغ فرخزاد , 21 2 کتاب , 22 2 عطار نیشابوری , 23 2 نیشابور , 24 2 جورج دبلیو بوش , 25 2 دنیای سوفی

fev 2008: 1 3 روشنفکر , 2 2 گل , 3 2 شراب , 4 2 سیمون دو بووار , 5 2 مرگ , 6 2 منیرو روانی‌پور , 7 2 فروغ فرخزاد , 8 2 کتاب , 9 2 تاریخ , 10 2 نقل‌قول روز , 11 2 نیکوس کازانتزاکیس , 12 2 ضرب‌المثل‌های ترکی , 13 2 ضرب‌المثل‌های آذربایجانی , 14 2 هنر , 15 2 عشق , 16 1 عارف قزوینی

mar 2008: 1 3 اورسن ولز , 2 3 فهرست افراد بر اساس نام , 3 2 مائو تسه‌دون , 4 2 سنگسار , 5 2 عشق , 6 2 کارلایل

abr 2008: 1 3 سید علی خامنه‌ای , 2 3 ژیل دلوز , 3 3 فهرست افراد بر اساس نام , 4 3 ناپلئون بناپارت , 5 3 صفحهٔ اصلی , 6 2 سید جمال‌الدین اسدآبادی , 7 2 محمد فضولی , 8 2 چنین گفت زرتشت , 9 2 تقی ارانی , 10 2 شارلوت برونته , 11 2 شیون فومنی , 12 2 فردریک هگل , 13 2 لوچیو کولتی , 14 2 هربرت مارکوزه , 15 2 نیکوس پولانزاس , 16 2 باروخ اسپینوزا , 17 2 گئورگ ویلهلم فریدریش هگل , 18 2 مگس , 19 2 جلیل ضیاءپور , 20 1 سید جمال الدین اسدآبادی

mai 2008: 1 6 فهرست افراد بر اساس نام , 2 3 حسین پناهی , 3 3 عشق , 4 3 صفحهٔ اصلی , 5 2 پروانه , 6 2 جورج گوردون بایرون , 7 2 پاپلی یزدی , 8 2 بلبل , 9 2 هانا آرنت , 10 2 دایره زنگی , 11 2 عارف قزوینی , 12 2 امیلی برونته , 13 2 دانش , 14 2 آرزو , 15 2 موریس مترلینک , 16 1 کسایی مروزی

jun 2008: 1 2 هنری دیوید تورو , 2 2 لنگستون هیوز , 3 2 ستارخان , 4 2 شراب , 5 2 سنگسار , 6 2 بزرگمهر , 7 1 مجوز مستندات آزاد گنو

jul 2008: 1 4 طاهره قرةالعین , 2 3 گوساله , 3 3 عباس کیارستمی , 4 3 فهرست افراد بر اساس نام , 5 2 مرد سوم , 6 2 نیمتاج سلماسی , 7 2 هوشنگ گلشیری , 8 2 نقش رستم , 9 2 تخت جمشید , 10 2 سید محمد طباطبائی , 11 2 رشحه , 12 2 حسین پناهی , 13 2 اورسن ولز

ago 2008: 1 3 بوسه , 2 2 داستان دو شهر , 3 2 سکوت , 4 2 ۱۷ فوریه , 5 2 گراهام گرین , 6 2 هانیبال الخاص , 7 2 شیخ فضل‌الله نوری , 8 2 صائب تبریزی , 9 2 آندری تارکوفسکی , 10 2 لودویگ فان بتهوون , 11 2 مارتین لوتر کینگ جونیور , 12 2 عشق , 13 2 آلبرت اینشتین , 14 2 محمود احمدی‌نژاد , 15 1 اریش فروم

set 2008: 1 3 گربه روی شیروانی داغ (نمایشنامه) , 2 2 امیر نادری , 3 2 محمدحسین پاپلی یزدی , 4 2 تنسی ویلیامز , 5 2 دیپاک چوپرا , 6 2 پاپلی یزدی , 7 1 ۲ مه

out 2008: 1 2 حسام‌الدین خویی , 2 2 میرزا علی‌اکبر صابر , 3 2 امام محمد غزالی , 4 2 علی اکبر دهخدا , 5 1 حسام الدین خویی

nov 2008: 1 4 فهرست افراد بر اساس نام , 2 2 باراک اوباما , 3 1 ژان سیبلیوس

dez 2008: 1 2 گروچو مارکس , 2 2 فردوسی

jan 2009: 1 3 محمد بن عبدالله , 2 2 امیلی دیکنسن , 3 2 گلادیاتور , 4 1 ۱۴ ژانویه

fev 2009: 1 3 زنان , 2 3 محمد علی کلی , 3 2 ماهواره امید , 4 2 حسن طبری آملی , 5 2 سید محمد‌کاظم شریعتمداری , 6 2 ولایت فقیه , 7 2 خلفای راشدین , 8 2 اردبیل , 9 2 شاهین نجفی , 10 2 دایره زنگی , 11 2 وحشی بافقی , 12 2 خیلی دور، خیلی نزدیک , 13 2 قیصر , 14 2 آلفونس کار , 15 2 پائولو کوئیلو , 16 1 محیط طباطبائی

mar 2009: 1 2 علی اکبر شیرودی , 2 2 بهارانه , 3 2 حسن لاهوتی اشکوری , 4 2 حسن طبری آملی , 5 2 شارلوت برونته , 6 2 حسین بن علی , 7 2 هاینریش هاینه , 8 2 گابریل گارسیا مارکز , 9 2 رنه دکارت , 10 2 ژان دو لافونتن , 11 2 رودکی , 12 2 ابن سینا , 13 2 عمر خیام , 14 2 استانیسلاو لم , 15 2 آلبر کامو , 16 2 تالس , 17 2 آلبرت اینشتین , 18 2 جورج برنارد شاو , 19 2 مارشال مک‌لوهان , 20 1 علی صیاد شیرازی

abr 2009: 1 4 فهرست افراد بر اساس نام , 2 3 حسین منصور حلاج , 3 2 ریچارد براتیگان , 4 2 آنا آخماتووا , 5 2 فروغ فرخزاد , 6 2 عطار نیشابوری , 7 2 سعدی , 8 2 یوهان ولفگانگ گوته , 9 2 آلبرت اینشتین , 10 2 منصور حکمت , 11 1 مهدی رجب بیگی

mai 2009: 1 5 فهرست افراد بر اساس نام , 2 2 عماد مغنیه , 3 2 صلح , 4 2 سید روح‌الله خمینی , 5 2 فردوسی

jun 2009: 1 2 تبریز , 2 2 جرج برناردشاو , 3 2 لئوناردو داوینچی , 4 2 دار و دسته‌های نیویورکی , 5 1 لئونارد داوینچی

jul 2009: 1 4 علی بن ابی‌طالب , 2 2 زنان , 3 2 استیون واینبرگ , 4 1 توماس هنری هاکسلی

ago 2009: 1 3 احمد مفتی‌زاده , 2 3 شعارهای مردم در اعتراض به نتیجه انتخابات ریاست جمهوری , 3 3 ضرب‌المثل‌های چینی , 4 2 گیتی نوین , 5 2 میرحسین موسوی , 6 2 آبراهام لینکلن , 7 1 یوسف صانعی

set 2009: 1 3 سید محمد خاتمی , 2 3 علی شریعتی , 3 3 فهرست افراد بر اساس نام , 4 2 در بروژ , 5 2 احمد مفتی‌زاده , 6 2 شعارهای مردم در اعتراض به نتیجه انتخابات ریاست جمهوری , 7 2 میرحسین موسوی , 8 2 دزدان دریایی کارائیب: صندوق مرد مرده , 9 2 حسین پناهی , 10 2 سید علی خامنه‌ای , 11 1 پیامک

out 2009: 1 2 خواب , 2 2 بهلول , 3 2 امام محمد باقر , 4 2 جعفر صادق , 5 2 میرحسین موسوی , 6 2 دنیای سوفی , 7 1 عبدالکریم سروش

nov 2009: 1 4 محمود احمدی‌نژاد , 2 2 ژان پل سارتر , 3 1 چه‌گوارا

dez 2009: 1 1 سید احمد علم‌الهدی

jan 2010: 1 2 ریاضی , 2 2 محمدرضا شجریان , 3 2 سید احمد علم‌الهدی , 4 2 اسفندیار رحیم‌مشایی , 5 2 میرحسین موسوی , 6 1 بیماری

fev 2010: 1 3 جنبش سبز , 2 2 علی رضا بدیع , 3 2 لئوناردو داوینچی , 4 2 فهرست فیلم‌ها , 5 1 پل ورلن

mar 2010: 1 2 شعارهای مردم در اعتراض به نتیجه انتخابات ریاست جمهوری , 2 2 فهرست افراد بر اساس نام , 3 1 کورش کوچک

abr 2010: 1 4 بهاءالله , 2 3 محمود احمدی‌نژاد , 3 2 هرات , 4 2 سید حسن فیروزآبادی , 5 2 میرحسین موسوی , 6 2 سید علی خامنه‌ای , 7 2 وینستون چرچیل , 8 1 پیامک

mai 2010: 1 2 بهاءالله , 2 2 محمدرضا شجریان , 3 2 فردوسی , 4 1 سلام

jun 2010: 1 3 سید روح‌الله خمینی , 2 2 کاظم صدیقی , 3 2 سید علی خامنه‌ای , 4 2 فهرست افراد بر اساس نام , 5 1 حاتم طایی

jul 2010: 1 2 خوزستان , 2 2 بدبیاری‌ها , 3 2 آین رند , 4 2 حسین الهی قمشه‌ای , 5 2 ضرب‌المثل‌های فارسی , 6 1 عین القضاة همدانی

ago 2010: 1 3 محمود احمدی‌نژاد , 2 2 آیزاک آسیموف , 3 2 چای , 4 2 دخانیات , 5 2 خلیج فارس , 6 2 خوزستان , 7 2 علی‌رضا بدیع , 8 2 آمریکا , 9 2 سید علی‌محمد دستغیب , 10 2 نیشابور , 11 2 محمدحسین شهریار , 12 2 امیرخسرو دهلوی , 13 1 پیامک

set 2010: 1 4 علی بن ابی‌طالب , 2 4 فهرست افراد بر اساس نام , 3 3 عمرو عاص , 4 3 باراک اوباما , 5 3 حسین بن علی , 6 2 جلال‌الدین فارسی , 7 2 ابوالحسن بنی‌صدر , 8 2 معاویه پسر ابی‌سفیان , 9 2 سهیل پسر عمرو , 10 2 میدان نقش جهان , 11 2 دمشق , 12 1 پیامک

out 2010: 1 2 قهوه تلخ , 2 2 عبدالجواد غرويان , 3 2 آنتون چخوف , 4 2 علی بن ابی‌طالب , 5 2 جکسون براون , 6 1 قهوه تلخ (سریال)

nov 2010: 1 3 قهوه تلخ , 2 3 جورج برنارد شاو , 3 2 غلامحسین ساعدی , 4 2 غلامعلی بسکی , 5 2 محسن قرائتی , 6 1 هارون‌الرشید

dez 2010: 1 2 سنگسار در اسلام , 2 2 وحشی بافقی , 3 2 فروغ فرخزاد , 4 2 علی بن ابی‌طالب , 5 1 لویی فردینان سلین

jan 2011: 1 3 علی‌رضا افتخاری , 2 3 فهرست فیلم‌ها , 3 3 علی بن ابی‌طالب , 4 3 محمود احمدی‌نژاد , 5 2 پیامک , 6 2 مهدی , 7 2 توبه , 8 2 رضی‌الدین نیشابوری , 9 2 ابرهه , 10 2 قاسم بن محمد , 11 2 عبدالله بن شبرمه , 12 2 شطرنج , 13 2 ابی بن کعب , 14 2 عایشه , 15 2 محمدجواد عزتی , 16 2 ابن عباس , 17 2 ابن قیم الجوزیه , 18 2 حسن بصری , 19 2 زین‌العابدین مراغه‌ای , 20 2 مصر , 21 2 خراسان , 22 2 زین‌العابدین بن علی , 23 2 سبزوار , 24 2 ضرب‌المثل‌های خراسانی , 25 2 شب‌های روشن

fev 2011: 1 3 خلیج فارس , 2 3 ایران , 3 2 معمر قذافی , 4 2 مأمون , 5 2 مشورت , 6 2 مدینه , 7 2 نام‌گذاری فرزند , 8 2 عمر بن خطاب , 9 2 ابوبکر , 10 2 عزت‌الله سحابی , 11 2 عبدالکریم سروش , 12 2 میرحسین موسوی , 13 2 محمدحسین پاپلی یزدی , 14 2 آنتون چخوف , 15 2 منوچهر آتشی , 16 2 عمر خیام , 17 1 شعارهای مردم لیبی در اعتراضات سال ۲۰۱۱

mar 2011: 1 4 علی بن ابی‌طالب , 2 3 محمدجواد عزتی , 3 3 عمر بن خطاب , 4 3 ابوبکر , 5 3 نیشابور , 6 3 آدولف هیتلر , 7 2 کیم وو چونگ , 8 2 طاهر بن حسین , 9 2 فاروق , 10 2 ابوعثمان سعید مغربی , 11 2 سید حسن مدرس , 12 2 نجم‌الدین اربکان , 13 2 روژه گارودی , 14 2 معمر قذافی , 15 2 قدس , 16 2 ادیب نیشابوری , 17 2 زبان عربی , 18 2 زبان فارسی , 19 1 ابو حفص حداد

abr 2011: 1 2 ابوسعید ابوالخیر , 2 2 ضرب‌المثل‌های خراسانی , 3 1 لودویک زامنهوف

mai 2011: 1 2 جفرسون دیویس , 2 2 خواجه عبدالله انصاری , 3 2 علویه خانم , 4 1 ناصر حجازی

jun 2011: 1 2 ابوبکر , 2 2 ایران , 3 1 آشنایی با مادر

jul 2011: 1 1 علی بن ابیطالب

ago 2011: 1 3 عمر بن خطاب , 2 2 کورش بزرگ , 3 1 میرزا حسین‌علی نوری

set 2011: 1 3 فهرست آثار ادبی , 2 2 جرم (فیلم) , 3 2 فرینج , 4 2 نیشابور , 5 2 کازابلانکا , 6 2 فهرست فیلم‌ها , 7 1 هوشنگ ایرانی

out 2011: 1 2 جدایی نادر از سیمین , 2 2 نیشابور , 3 1 اینشتین

nov 2011: 1 4 ازدواج , 2 3 مبارزه متعالی , 3 2 شعور خلاق , 4 2 کلام خلاق , 5 2 قضاوت , 6 1 یوحنای مجنون

dez 2011: 1 3 ایلیا میم , 2 2 پیمان فتاحی , 3 2 هامون , 4 2 محمدرضا پهلوی , 5 2 محمد مصدق , 6 2 مایکل جکسون , 7 1 مصطفی چمران

jan 2012: 1 3 ضرب‌المثل‌های فارسی , 2 2 علاءالدین ملماسی , 3 2 سید روح‌الله خمینی , 4 2 فریدون جنیدی , 5 2 فهرست فیلم‌ها , 6 1 هوپ‌هوپ‌نامه

fev 2012: 1 2 آمل , 2 1 طالب آملی

mar 2012: 1 2 پیمان فتاحی , 2 2 جلال‌الدین محمد بلخی , 3 2 مریلین منسون , 4 2 فهرست آثار ادبی , 5 2 فهرست افراد بر اساس نام , 6 1 اریک کانتونا

abr 2012: 1 5 ماهواره امید , 2 3 فهرست افراد بر اساس نام , 3 2 سکسوالیته , 4 2 بایزید بسطامی , 5 2 جانی دپ , 6 2 مذهب , 7 2 علی شریعتی , 8 1 شادی

mai 2012: 1 3 مارک تواین , 2 2 پرویز شهریاری , 3 2 شاهین نجفی , 4 2 جورج برنارد شاو , 5 2 فهرست افراد بر اساس نام , 6 1 کارل سیگن

jun 2012: 1 2 سیروان خسروی , 2 1 بابک خرمدین

jul 2012: 1 3 رضا پهلوی , 2 2 ارباب کمان نقره‌ای , 3 2 جورج برنارد شاو , 4 2 مارک تواین , 5 1 اتاقی از آن خود

ago 2012: 1 3 فهرست فیلم‌ها , 2 2 دیوانه‌ای از قفس پرید , 3 2 سفر به انتهای شب , 4 2 عمر بن خطاب , 5 2 هانا آرنت , 6 2 صادق هدایت , 7 2 ایمانوئل کانت , 8 1 زیستن چون پروانه

set 2012: 1 1 بهار ۶۳

out 2012: 1 1 ضرب‌المثل‌های کردی

nov 2012: 1 5 فهرست افراد بر اساس نام , 2 2 عمر بن خطاب , 3 1 محمود کریمی حکاک

dez 2012: 1 2 مصطفی دلشاد تهرانی , 2 2 فهرست افراد بر اساس نام , 3 1 امیر قلعه نویی

jan 2013: 1 3 عمر بن خطاب , 2 2 جورج اورول , 3 2 عشق , 4 2 فهرست افراد بر اساس نام , 5 1 لیلا صادقی

fev 2013: 1 2 ناجی العلی , 2 2 آسیا عبدالله

mar 2013: 1 2 سید علی خامنه‌ای , 2 1 انیو موریکونه

abr 2013: 1 3 ماکسیمیلیان روبسپیر , 2 3 سن ژوست , 3 3 انیو موریکونه , 4 3 مختارنامه (مجموعه تلویزیونی) , 5 2 حرفه‌ای , 6 2 سید محمد‌کاظم شریعتمداری , 7 2 علی شریعتی , 8 1 عماد خراسانی

mai 2013: 1 4 دینو بوتزاتی , 2 4 آزادی , 3 3 عماد خراسانی , 4 3 ضرب‌المثل‌های بختیاری , 5 3 فریدون مشیری , 6 1 ماکسیم گورکی

jun 2013: 1 2 مالکوم لطیف شباز , 2 2 حسن روحانی , 3 1 آبراهام مازلو

jul 2013: 1 2 ایندیرا گاندی , 2 1 100 گفتار

ago 2013: 1 3 حسن روحانی , 2 3 عمر بن خطاب , 3 3 ابوبکر , 4 2 محمد بن موسی خوارزمی , 5 2 داوید هیلبرت , 6 2 محمدعلی جمال‌زاده , 7 2 پینوکیو (فیلم) , 8 2 ناخدا خورشید , 9 2 باغ‌های کندلوس , 10 2 لودویگ ویتگنشتاین , 11 2 والتر اسکات , 12 2 راینر ماریا ریلکه , 13 2 کاشان , 14 2 توماس هاکسلی , 15 2 البرت هوبارد , 16 2 ایندیرا گاندی , 17 2 دوایت آیزنهاور , 18 2 فرانک تایگر , 19 2 آلیس واکر , 20 2 پایتخت , 21 2 داریوش بزرگ , 22 2 گشت ارشاد , 23 2 شیخ بهائی , 24 2 دیوانه‌ای از قفس پرید , 25 2 سعادت‌آباد

set 2013: 1 3 فهرست افراد بر اساس نام , 2 2 شمع , 3 2 زیرپوست شهر , 4 2 جیمز جویس , 5 2 گی دو موپاسان , 6 2 جان استاینبک , 7 2 ابوبکر کرجی , 8 2 آنه فرانک , 9 2 پینوکیو (فیلم) , 10 1 پاتریس لومومبا

out 2013: 1 2 نورعلی الهی , 2 2 پینوکیو (فیلم) , 3 2 ایرانی , 4 2 سید محمد خاتمی , 5 2 فهرست فیلم‌ها , 6 2 علی بن ابی‌طالب , 7 1 شمس تبریزی

nov 2013: 1 2 محمدجواد ظریف , 2 2 نورعلی الهی , 3 2 لودویگ ویتگنشتاین , 4 2 شطرنج , 5 2 عشق , 6 2 علی بن ابی‌طالب , 7 1 علی زین العابدین

dez 2013: 1 4 دانش , 2 3 جینا جیمسون , 3 3 ارتداد در اسلام , 4 3 سنگسار در اسلام , 5 3 جورج واشنگتن , 6 3 کورش بزرگ , 7 2 سفارت , 8 2 فریدریش هایک , 9 2 خرما , 10 2 نهنگ , 11 2 جوزف کمبل , 12 2 لوئیزا می آلکوت , 13 2 هشت صبح , 14 2 سید علی‌اصغر دستغیب , 15 2 نلسون ماندلا , 16 2 مبارزه متعالی , 17 2 بخشندگی , 18 2 ابوسعید ابوالخیر , 19 2 زکات , 20 2 شطرنج , 21 2 ناصر مکارم شیرازی , 22 2 میرزا کوچک خان جنگلی , 23 2 نماز (اسلام) , 24 2 زنان , 25 2 سکوت

jan 2014: 1 3 شاه اسماعیل دوم , 2 3 آلبرت اشپر , 3 3 علی‌رضا , 4 2 یاس (خواننده) , 5 2 آل کاپون , 6 2 پول , 7 2 اخلاق , 8 2 اراده , 9 2 جوانی , 10 2 حسادت , 11 2 تجربه , 12 2 طمع , 13 2 استبداد , 14 2 جهان , 15 2 بیابان , 16 2 حسن روحانی , 17 2 اندیشیدن , 18 2 عمر بن خطاب , 19 2 زیبایی آمریکایی , 20 2 انسان , 21 2 حسن بن علی , 22 2 زنان , 23 2 بوسه , 24 2 کودک , 25 2 آزادی

fev 2014: 1 3 ژوزه ساراماگو , 2 3 کورش بزرگ , 3 2 تحقیر , 4 2 کورت وانگات , 5 2 علی کریمی , 6 2 آلکساندر سولژنیتسین , 7 2 شمس تبریزی , 8 2 ملاله یوسف‌زی , 9 2 جان استاینبک , 10 2 صدام حسین , 11 2 گهواره گربه , 12 2 شوالیه تاریکی , 13 2 بغداد , 14 2 معمر قذافی , 15 2 حج , 16 2 ابوبکر , 17 2 حامد کرزی , 18 2 سجاد , 19 2 جعفر صادق , 20 2 ایران , 21 2 تهران , 22 2 محمدرضا پهلوی , 23 2 حسین بن علی , 24 2 مخمصه , 25 2 رستگاری در شاوشنک

mar 2014: 1 4 زندگی , 2 3 حسن روحانی , 3 3 عمر مختار , 4 3 انسان , 5 2 پریکلس , 6 2 مجید مجیدی , 7 2 بیل برایسون , 8 2 استیو مارابولی , 9 2 توپاک شکور , 10 2 کریستوفر مارلو , 11 2 ادگار واتسون هاو , 12 2 ساموئل جانسون , 13 2 کلارنس دارو , 14 2 سو تاونسند , 15 2 والتر رالی , 16 2 جان ماری گیبون , 17 2 جان هیت استابز , 18 2 رالف ریچاردسون , 19 2 اشرف ریفی , 20 2 حکومت , 21 2 سال بلو , 22 2 آرت بوخوالد , 23 2 سیلماریلیون , 24 2 دایدو , 25 2 اسلام

abr 2014: 1 3 فاطمه زهرا , 2 2 محدث نوری , 3 2 هریت بیچر استو , 4 2 مارکی دوساد , 5 2 راشل کارسون , 6 2 پسرعمه زا , 7 2 احمد مسجدجامعی , 8 2 چارلز مک‌کارتی , 9 2 جورج کارلین , 10 2 رضا نظری , 11 2 فضل‌الله زاهدی , 12 2 رجب طیب اردوغان , 13 2 عبدالله بن عبدالعزیز , 14 2 محسن موسوی تبریزی , 15 2 عبدالرحمن اوزاعی , 16 2 نادانی , 17 2 آب , 18 2 لوئیزا می آلکوت , 19 2 غیرت , 20 2 صادق زیباکلام , 21 2 رزا لوکزامبورگ , 22 2 محمدعلی جمال‌زاده , 23 2 کاشان , 24 2 والتر گروپیوس , 25 2 ویل راجرز

mai 2014: 1 3 رضا داوری اردکانی , 2 3 مریم طاهری مجد , 3 3 کامبیز درم‌بخش , 4 3 لودویگ ویتگنشتاین , 5 2 ارومیه , 6 2 ایوان تورگنیف , 7 2 نیکلای گوگول , 8 2 مصطفی ملکیان , 9 2 احسان نراقی , 10 2 لیلا حاتمی , 11 2 غلامحسین ابراهیمی دینانی , 12 2 ناتاشا امیری , 13 2 مهشید امیرشاهی , 14 2 فرخنده آقایی , 15 2 شیرین نشاط , 16 2 پگاه احمدی , 17 2 بهاره رهنما , 18 2 ابوتراب خسروی , 19 2 مهدی یزدانی‌خرم , 20 2 حمیدرضا صدر , 21 2 محمد بساطی , 22 2 خیری شلبی , 23 2 علاء الاسوانی , 24 2 ابراهیم اصلان , 25 2 ادوار خراط

jun 2014: 1 2 آنتیستینس , 2 2 اخراجی ها ٢ , 3 2 پیامک , 4 1 ویلیام سامرست موآم

jul 2014: 1 3 اروین د. یالوم , 2 3 گراتزیا دلدا , 3 2 جیم موران , 4 2 نوری مالکی , 5 2 جی.کی. رولینگ , 6 2 دولت اسلامی عراق و شام , 7 2 خسرو شکیبایی , 8 2 حماس , 9 2 پیروز مجتهدزاده , 10 2 سید محمود هاشمی شاهرودی , 11 2 سیما تیرانداز , 12 2 محمدباقر نجفی اصفهانی , 13 2 حسن قزوینی , 14 2 تروریسم , 15 2 ابوبکر کرجی , 16 2 سجاد , 17 2 روز قدس , 18 2 هوشنگ ابتهاج , 19 2 مهدی اخوان ثالث , 20 2 کورش بزرگ , 21 2 حافظ , 22 1 تغار

ago 2014: 1 3 فریدون فرخزاد , 2 3 شیخ فضل‌الله نوری , 3 2 یزدگرد سوم , 4 2 وضعیت سفید , 5 2 علی دیواندری , 6 2 ایران , 7 2 گربه , 8 2 صادق هدایت , 9 2 فهرست افراد بر اساس نام , 10 1 مسیحیت

set 2014: 1 2 مسعود جعفری جوزانی , 2 2 غلامرضا اعوانی , 3 2 محمدامین قانعی‌راد , 4 2 سید جواد طباطبایی , 5 2 هوگو چاوز , 6 2 ماکسیم رودینسون , 7 2 برنارد کوشنر , 8 2 جان راسکین , 9 2 دایدو , 10 2 بدیع‌الزمان همدانی , 11 2 رضا کیانیان , 12 2 حامد کرزی , 13 2 عادل فردوسی‌پور , 14 2 ایران , 15 2 تهران , 16 2 گربه , 17 1 ابن قتیبه دینوری

out 2014: 1 3 حسین شهابی , 2 2 محمد نوریزاد , 3 2 منجمد (فیلم ۲۰۱۳) , 4 2 رسول یونان , 5 2 محمدکریم پیرنیا , 6 2 فریدون آدمیت , 7 2 عبدالسلام عظیمی , 8 2 بن افلک , 9 2 استاد الهی , 10 2 نعمت‌الله فاضلی

nov 2014: 1 4 حسین شهابی , 2 3 جک هندی , 3 2 غلامحسین ابراهیمی دینانی , 4 2 ارتداد در اسلام , 5 1 لودویگ وان بتهوون

dez 2014: 1 2 حسین شهابی , 2 2 هوپ‌هوپ‌نامه , 3 2 جلال‌الدین فارسی , 4 2 حسن رحیم‌پور ازغدی , 5 2 بروس لی , 6 1 علی زعیم

jan 2015: 1 2 زندگی در پیش رو , 2 2 ناجی العلی , 3 2 سهراب سپهری , 4 2 فردوسی , 5 1 میرزا سروش لهراسب

fev 2015: 1 3 ویلیام فاکنر , 2 2 بازاریابی شبکه‌ای , 3 2 تئو درات , 4 2 برایان کرنیگان , 5 2 جامیکا کینکید , 6 2 استیون اسپندر , 7 2 مارگارت تاچر , 8 2 دنیس ریچی , 9 2 انجمن حجتیه , 10 2 ایران , 11 2 تهران , 12 2 خواجه عبدالله انصاری , 13 2 اوشو , 14 2 باباطاهر , 15 2 حافظ , 16 2 داگلاس آدامز , 17 2 عشق , 18 2 فرانسیس بیکن

mar 2015: 1 3 پل اردیش , 2 3 ریاضیدان , 3 2 لینوس توروالدز , 4 2 بازاریابی شبکه‌ای , 5 2 برهان غلیون , 6 2 فریدون فرخزاد , 7 2 دولت اسلامی عراق و شام , 8 2 عبدالسلام , 9 2 آدولف اوکس , 10 2 هانس کریستیان آندرسن , 11 2 کن تامسون , 12 2 ایران , 13 2 ونسان ون گوگ , 14 2 فردریک هگل , 15 2 قرآن , 16 2 ابن سینا , 17 2 سعدی , 18 2 ویرجینیا وولف , 19 1 سحر جعفری جوزانی

No data on this page have been normalized to 30 day months (as WMF does on certain traffic reports).
Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Quinta-feira, 7 de maio 2015 19:38

Dump file fawikiquote-20150407-pages-meta-history.xml.7z (full dump), size 9.3 Mb as 7z -> 670 Mb
Dump processed till Mar 31, 2015, on server stat1002, ready at Tue-07/04/2015-14:36 after 1 min, 46 sec.

Versão do script:2.6
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.