Estatísticas da Wikiquote persa

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist

Metrics have been collected from a full archive dump, which contains all revisions of every article, meta data and raw content.
See also metrics definitions


 
Monthly counts & Quarterly rankings: agosto 2014
 
DataWikiquotariansArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
ago 2014+3%   +2%   -49%-1%-1%+1%+1%-2%+2%+2%
jul 2014+1%   +8%   +50%+7%+6%+4%+3%+6%+14%+9%
jun 2014+1%   0%   -46%0%0%0%0%+1%0%0%
mai 2014+2%   +13%   -62%+4%+3%+2%+2%+20%+25%+7%
abr 2014+2%   +7%   +144%+5%+8%+3%-83%+15%+14%+13%
mar 20140%   +7%   +53%+3%+3%+4%+5%+8%+8%+10%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
ago 201414448 2,5 k115226539911 Mb1,1 M20 k2,3 k1,3 k2,9 k1,4 k
jul 20141401612,5 k615,1233278011 Mb1,1 M20 k2,2 k1,3 k2,9 k1,3 k
jun 201413914 2,3 k 16237152010 Mb1,1 M19 k2,2 k1,3 k2,5 k1,2 k
mai 20141383922,3 k815,8236997010 Mb1,1 M19 k2,2 k1,3 k2,5 k1,2 k
abr 201413531122,0 k517,425962,5 k10 Mb1,0 M18 k2,1 k1,1 k2,0 k1,2 k
mar 2014132 621,9 k417,325891,0 k9,6 Mb968 k18 k13 k9121,8 k1,0 k
fev 20141322431,8 k117,926776819,3 Mb939 k17 k12 k8461,6 k928
jan 20141301611,7 k117,926998519,2 Mb930 k17 k12 k8231,5 k909
dez 20131291521,7 k117,826847528,9 Mb903 k16 k12 k8001,3 k830
nov 20131281211,6 k217,826645978,6 Mb874 k15 k11 k7491,2 k753
out 2013127 411,6 k 1828162878,8 Mb893 k15 k10 k6981,2 k618
set 20131271311,6 k11828195348,7 Mb888 k15 k9,9 k6361,1 k610
ago 20131262831,6 k317,928241,0 k8,6 Mb879 k14 k9,2 k5961,1 k601
jul 201312417 1,5 k118,329281898,5 Mb857 k14 k9,1 k529977586
jun 201312346 1,4 k 18,529532098,4 Mb849 k14 k9,1 k521953580
mai 201311938 1,4 k 18,429461238,4 Mb844 k14 k9,0 k521943580
abr 201311624 1,4 k 18,329441698,4 Mb842 k14 k9,0 k522944579
mar 201311422 1,4 k 18,429321368,3 Mb830 k14 k8,9 k520924573
fev 201311213 1,4 k 18,42905968,1 Mb818 k14 k8,9 k521912563
jan 201311126 1,4 k 18,529182538,1 Mb816 k14 k8,9 k522915563
dez 201210923 1,4 k 18,328311067,9 Mb788 k14 k8,8 k522909557
nov 2012107 1 1,4 k 18,32827747,9 Mb784 k14 k8,7 k520884556
out 201210712 1,4 k 18,328371167,9 Mb785 k14 k8,7 k522879556
set 201210611 1,4 k118,328281787,8 Mb778 k14 k8,7 k522879555
ago 201210514 1,4 k118,528551797,8 Mb773 k14 k8,7 k521873555
jul 201210416 1,4 k 18,628792837,7 Mb770 k14 k8,6 k522846552
jun 201210313 1,3 k 18,528831617,7 Mb766 k14 k8,5 k522841551
mai 201210215 1,3 k 18,629032197,6 Mb763 k13 k8,4 k522836551
abr 201210126 1,3 k118,629072667,5 Mb756 k13 k8,3 k517811551
mar 2012992311,3 k 18,629352947,5 Mb753 k13 k8,2 k515793548
fev 20129712 1,3 k 18,529521597,5 Mb756 k13 k8,2 k520794546
jan 20129624 1,3 k 18,429431487,5 Mb753 k13 k8,1 k518794545
dez 20119427 1,3 k 18,329451497,4 Mb751 k13 k8,1 k517784544
nov 20119236 1,3 k 18,228371667,2 Mb719 k13 k8,1 k515776541
out 201189 2 1,3 k 18,228012237,0 Mb706 k13 k8,0 k515767541
set 20118914 1,3 k 1827981257,0 Mb705 k13 k7,8 k514768539
ago 20118812 1,3 k 1828021337,0 Mb704 k13 k7,8 k511757538
jul 201187 1 1,3 k 17,927871537,0 Mb700 k13 k7,8 k511758537
jun 20118723 1,3 k 17,927911316,9 Mb696 k13 k7,7 k508744536
mai 20118514 1,3 k 17,927831146,9 Mb691 k13 k7,6 k513737533
abr 201184 5 1,3 k 17,827702046,8 Mb686 k13 k7,6 k512733531
mar 20118437 1,2 k 17,827645806,8 Mb680 k13 k7,5 k513725528
fev 2011813711,2 k317,527096786,6 Mb658 k13 k7,4 k469685495
jan 2011784931,2 k318,227408716,3 Mb619 k13 k7,3 k346640427
dez 201074 2 1,1 k 18,827914606,0 Mb581 k12 k7,1 k304602377
nov 20107425 1,1 k 18,527752256,0 Mb576 k12 k7,0 k302574377
out 20107237 1,1 k 18,427701775,9 Mb572 k12 k6,9 k300566367
set 20106957 1,1 k 18,227602815,9 Mb568 k12 k6,9 k298548365
ago 20106417 1,0 k 18,227427225,7 Mb559 k12 k6,8 k279521358
jul 20106345 1,0 k 17,826961785,6 Mb539 k12 k6,8 k273493351
jun 20105915 1,0 k 17,727001215,5 Mb536 k12 k6,7 k272488349
mai 20105817 1,0 k 17,826671575,4 Mb524 k12 k6,7 k272479348
abr 20105714 999 17,826692235,4 Mb519 k12 k6,7 k272425348
mar 201056 5 988 17,727162205,3 Mb523 k12 k6,6 k269412346
fev 20105647 975 17,827382265,3 Mb520 k12 k6,5 k268400345
jan 201052 5 962 17,827183445,2 Mb510 k12 k6,3 k263393339
dez 20095224 950 17,626381935,0 Mb487 k12 k6,3 k261377338
nov 20095014 943 17,526352354,9 Mb483 k12 k6,2 k260377337
out 200949 4 938117,425665154,8 Mb467 k12 k6,2 k258343328
set 20094927 922117,125092724,6 Mb449 k12 k6,0 k255316318
ago 20094717 898 17,325241,0 k4,5 Mb440 k12 k5,8 k254299310
jul 20094616 893216,224442004,4 Mb423 k12 k5,8 k251277308
jun 200945 3 830117,225891574,3 Mb416 k11 k5,8 k253261306
mai 20094524 812 17,426362624,2 Mb415 k11 k5,7 k250260302
abr 200943 6 809 17,126343004,2 Mb413 k11 k5,6 k252256297
mar 200943151802 16,926264934,2 Mb407 k11 k5,6 k252254292
fev 200942371790116,626134394,1 Mb398 k11 k5,5 k222238272
jan 20093915 775116,325942314,0 Mb388 k11 k5,4 k215214233
dez 200838141752 16,526423063,9 Mb383 k11 k5,3 k215212231
nov 200837 4 740 16,426551473,9 Mb379 k11 k5,2 k212200224
out 20083716 732 16,326461733,8 Mb374 k11 k5,1 k209193219
set 20083616 729116,226562483,8 Mb374 k11 k5,1 k208192211
ago 200835172702316,426784223,7 Mb364 k10 k4,9 k207171207
jul 200834 7 622117,929461793,6 Mb355 k9,9 k4,7 k191168189
jun 20083415 601 18,229851403,5 Mb347 k9,8 k4,6 k188162188
mai 200833271590218,329935673,5 Mb342 k9,7 k4,5 k185149183
abr 20083127253811930606473,2 Mb318 k8,7 k4,4 k169107178
mar 200829 5 514 18,630082233,0 Mb299 k7,7 k4,2 k16090169
fev 200829 41511118,330036033,0 Mb296 k7,7 k4,1 k15887165
jan 200829372489117,928898272,8 Mb273 k6,6 k4,1 k14285158
dez 200726481452 17,528224972,5 Mb246 k5,5 k3,9 k12668137
nov 200722 4 440 16,927921192,4 Mb238 k4,9 k3,8 k12167135
out 200722131434 16,828479302,4 Mb239 k4,9 k3,7 k12365134
set 200721151424 1527819322,3 Mb228 k4,2 k3,5 k10755129
ago 200720 51412 13,226356592,1 Mb210 k3,4 k2,7 k6354115
jul 200720261405111,825019112,0 Mb196 k3,1 k2,5 k5042109
jun 200718 21388 1022761851,7 Mb171 k1,6 k2,4 k3739102
mai 200718 31375 9,822471951,6 Mb164 k1,5 k2,3 k283897
abr 20071814 36919,522102761,6 Mb158 k1,4 k2,3 k273892
mar 200717 2135119,222052601,5 Mb150 k1,3 k2,2 k263189
fev 200717 1 335 8,822141201,5 Mb143 k1,2 k2,1 k273182
jan 200717 2 331 8,621751591,4 Mb139 k1,2 k2,1 k263180
dez 20061713 319 8,421231791,3 Mb131 k1,1 k2,0 k263077
nov 20061635 314 820881441,3 Mb127 k1,1 k1,9 k252974
out 200613 31303 7,820901991,2 Mb123 k1,1 k1,9 k242772
set 200613 51291 7,420252971,2 Mb115 k9781,8 k232269
ago 20061313128416,61729205985 kb96 k8551,6 k231961
jul 20061236226816,21555511847 kb83 k7951,5 k221661
jun 20069 2122415,11285191642 kb59 k46887618429
mai 20069121186 5,11198163544 kb43 k20883415323
abr 2006812 17614,51114129402 kb37 k18672212220
mar 2006713 15914,21051182324 kb32 k16558111 17
fev 2006612 12014131089304 kb29 k1664443 11
jan 20065 1 99 4152349290 kb28 k1654132 7
dez 20055 1 86 4176141284 kb28 k1653672 6
nov 2005523 71 4,3200887265 kb27 k1602682 4
out 20053 1 60 3,6223721248 kb25 k1572232 3
set 2005312 60 3,2221744243 kb25 k1281971 2
ago 20052   47 3,227665236 kb24 k1251521 1
jul 20052 1 4513,2288687236 kb24 k1251521 1
jun 20052 2 17 3,4737526225 kb23 k86134   
mai 20052   7 4,6176334221 kb23 k86133   
abr 20052 1 7 41762817220 kb23 k86133   
mar 2005211 4 2,81981410134 kb15 k8474   
fev 20051   1 1445 1,9 kb77 106 9 
jan 20051   1 1445 1,9 kb77 106 9 
dez 20041   1 1445 1,9 kb77 106 9 
nov 20041   1 1445 1,9 kb77 106 9 
out 20041   1 1445 1,9 kb77 106 9 
set 20041   1 1445 1,9 kb77 106 9 
ago 200411  1 144511,9 kb77 106 9 
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
The following table ranks this project in relation to projects in other languages with 1000+ articles
jul 20141313119183141061111141591048
abr 201413687193129811111417101348
jan 2014131412122012109911121418111548
out 201313161272214981511121421131748
jul 201313131092211761511121525172148
abr 2013131012122212761711121525172048
jan 2013131213172115762511121525171948
out 2012131726162118762911121423161948
jul 2012131712142115761911131423151948
abr 2012131014142112761811131423151748
jan 201213914112011761811121223151748
out 2011142124132012762611131223151748
jul 2011142028132014762511131220141748
abr 2011142115102012862011121220141648
jan 20111578521476712121219171647
out 20101671282114661712131220171647
jul 201017713132114762112131220161747
abr 201017171313211121211412131020161847
jan 201018201312211521211312131020161847
out 200917211619211019191813151020161847
jul 20091716101120518181513151020161947
abr 200918201214201718181612151019161947
jan 200918191412201318181712151019151847
out 200818141311211318181912151019151947
jul 200817241314241418181912151020151947
abr 20081812126241117171113151020152347
jan 2008199117241515151114151220152647
out 20072020191124181515814151420142547
jul 20072012131524141515713151422182747
abr 200720151416241614141615171719242647
jan 200719252513221813132115151816232447
out 200621201812221813131715151716202147
jul 200621101111221612121216171817182647
abr 200622122111241512121819212525194147
jan 2006282529172420992821212123254647
out 2005251917102013772416171719214347
jul 2005251719102011551514141719194147
abr 200522161572111441913121516133947
jan 20052814165339333037352617121545
out 200424201952682231282723108838
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100ediçõesbytes
 WikiquotariansArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikiquotarians (usuários registrados)
A = Wikiquotarians que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikiquotarians que editaram pelo menos dez vezes desde que chegaram
C = Wikiquotarians que contribuíram cinco vezes ou mais este mês
D = Wikiquotarians que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  5  10  100  1  3  5  10  25  5  10  100  1  3  5  10  25  100  250  5  10  100 
Monthly counts for recent history of wiki
ago 20142412876     72111111104211  11 
jul 201418865211    811     126432  1  
jun 2014145422  1119752111 113322  11 
mai 2014211194221    532     63211     
abr 2014291511622212228511    155411  111
mar 2014211065421    94431   156511     
fev 201411444431    5332    9422      
jan 201423764311    821     125431     
dez 201322854422    8443    144221     
nov 201311622211    52111   153211  11 
out 20131774321     521     1022       
set 201314433111 11 6211    95441     
ago 2013191186531 11 6411    622221    
jul 2013158732     43      10311      
jun 201315864   21 3       5      1  
mai 20131811841     62      92211     
abr 2013187421  11 42      10311   1  
mar 2013115211     1       10221      
fev 201395311     62   11 9321   11 
jan 2013187631  22 3    11 8      11 
dez 2012156311  1  2    2  92        
nov 20121331    11      11 4         
out 201214322   22 5    11 7311   11 
set 2012113111  21 21   1  722    11 
ago 2012166431  11 41   11 722       
jul 2012187641  32 7321 11 952    11 
jun 2012186321  11 5    11 52211     
mai 2012189532  11 842  11 9421   1  
abr 2012179652  21 41   111411    2  
mar 20122273311  22 811  11110522   1  
fev 20121662    22 3111 11 1032    32 
jan 20122484    22 41   1115      11 
Quarterly counts for entire history of wiki
jul 201418865211    811     126432  1  
abr 2014291511622212228511    155411  111
jan 201423764311    821     125431     
out 20131774321     521     1022       
jul 2013158732     43      10311      
abr 2013187421  11 42      10311   1  
jan 2013187631  22 3    11 8      11 
out 201214322   22 5    11 7311   11 
jul 2012187641  32 7321 11 952    11 
abr 2012179652  21 41   111411    2  
jan 20122484    22 41   1115      11 
out 20111752    22171   111921    11 
jul 20111641    11 31      722    11 
abr 2011198521  11 41      6211      
jan 2011241296431 33 103332   116332  1  
out 201028874   11 5111    12111      
jul 2010176541  11 4       1         
abr 2010209431  32 311     84111     
jan 2010217522  11 21      72221  1  
out 2009135422  2225221    83221     
jul 2009208643  1  322     104311     
abr 2009198642  11 532     126533  111
jan 2009136532  22 3111    104321     
out 20081710621  11 411     85411     
jul 20081711742     511     72211  11 
abr 200813975421 22 104311   84442     
jan 2008151175321 11 95521   74221     
out 200712532111 22211222    112221     
jul 200712864111    533     432111    
abr 200797442     3111    53322     
jan 200752211     3111    43222     
out 2006853211     2221    32222     
jul 20061286542     93221   933221 11 
abr 2006106222     7331    6321      
jan 200652111     3111    211111 11 
out 20051111              11        
jul 200521111             11111  11 
abr 20051111      1       211111    
jan 2005                           
out 2004                           

 

Distribuição de edições de artigos por wikiquotarians
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikiquotariansEdições total
1775100.0%26,648100.0%
329538.1%25,88697.1%
1014719.0%25,03393.9%
32496.3%23,45088.0%
100222.8%22,17283.2%
316121.5%20,53777.1%
100050.6%16,78063.0%
316220.3%11,92044.7%

 

23 wikiquotarians recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions
agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
Sonia SevillaUC2 05,704816886set 10, 2010145081826--
SajadUC4 01,82023,1783mar 26, 20053444120---
Ahura21UC13+1312362242mai 24, 201111945613--
CommonsDelinkerUC20+31204024-mai 13, 20072666----
MohandesWikiUC27+106221262152mar 25, 20141581---
MRG90UC34-147162ago 12, 2013383101--
کافر مقدسUC36...4242--ago 07, 20142311--
BbadreeUC39+1623933--mar 30, 200823442---
EllhaamUC43...3636--ago 14, 201416----
Gire 3pich2005UC45-13516-mai 01, 201015822---
SicaspiUC102+1171592-dez 05, 201326842--
ChikagoUC114+6131--fev 18, 2013558----
دالباUC117+2013210-ago 17, 2013378----
Mohsen97UC170...88--ago 05, 20142511--
RotlinkUC293+44043--nov 01, 2013302----
HamedvahidUC340+9631--mar 25, 201112541---
MeisamUC359+108313-jan 04, 2013603----
AviowUC373...33--ago 13, 20141711--
AhmadalliUC374...33--ago 23, 20147----
HamzealhnUC498...22--ago 24, 20146----
2دانگهUC773...11--ago 07, 201423----
ShahramshUC774...11--ago 26, 20144----
Hasti10UC775...11--ago 30, 2014 ----

 

20 wikiquotarians recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
AmouzandehUC16,216abr 11, 20063063mai 31, 20101552
RAHA68UC31,942abr 30, 2012852jul 30, 201431
MardetanhaUC51,098ago 08, 20072579abr 02, 2014150
مهدیUC6706fev 05, 20092032jan 27, 2013580
JDiamondUC7662set 05, 20091820fev 01, 20111306
Jamal NazarethUC8652fev 01, 20111306abr 21, 20111227
TaranetUC9576jan 13, 20082421abr 01, 2014151
WayiranUC10445abr 24, 20082319mai 30, 20111188
BilijacksUC11396nov 16, 20062844abr 20, 2014132
SialkgraphUC12320jul 23, 2013403jul 31, 201430
MahanUC14287fev 16, 2014195jul 19, 201442
AbsdostanUC15150set 13, 20091812jan 02, 2012971
RabinsonUC16144out 11, 20082149jun 16, 20101536
ShervinafsharUC17137nov 11, 20053214dez 25, 2013248
Hard BackrestUC18132dez 31, 20082068abr 24, 2014128
SahimUC19132ago 04, 20101487jan 09, 2012964
FollowerrUC21113jan 09, 20111329mai 11, 20111207
Mahnaz92UC22108jun 12, 2013444ago 06, 2013389
آئیلUC2383jul 17, 201444jul 27, 201434
Sahand AceUC2473dez 09, 2013264jan 05, 2014237

 

usuários anônimos, ordenados por número de contribuições
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
85.185.1.4160
85.185.1.1462
217.219.137.1962
129.217.132.3646
2.186.172.13939
80.71.114.3533
31.58.225.15229
80.75.8.11427
217.219.12.13126
188.158.107.2626

No total 4.196 edições foram feitas por usuários anônimos, de um total de 37.914 edições ( 11e %)
  


29 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
AnankeBotUC11,350dez 18, 20082081set 16, 2013348--
TanhabotUC21,191abr 23, 20082320dez 08, 20101361--
ChtitBotUC3966set 08, 20072548fev 06, 20111301--
DexbotUC4673abr 08, 2014144abr 14, 2014138--
EleferenBotUC5464fev 13, 20101659jan 13, 2013594--
SahimrobotUC6412ago 14, 20101477ago 15, 20101476--
MohandesBotUC7381jun 02, 201489jun 19, 201472--
FaraBotUC8346out 11, 20072515out 11, 20072515--
KamikazeBotUC9259dez 17, 20101352dez 09, 2011995--
ArthurBotUC10157out 14, 20091781dez 02, 20091732--
MerlIwBotUC11133jul 26, 2012765jun 14, 2013442--
SamoaBotUC12125abr 09, 2014143abr 15, 2014137--
LaaknorBotUC13119out 23, 20082137jan 20, 2013587--
AvicBotUC1488ago 11, 20111115set 07, 20111088--
Idioma-botUC1582mar 02, 20111277jul 16, 2012775--
VolkovBotUC1652jun 30, 20091887abr 16, 2012866--
MjbmrbotUC1746fev 04, 20111303mar 27, 20111252--
JAnDbotUC1843ago 17, 2013378ago 28, 2013367--
CarsracBotUC1942mar 19, 20111260abr 15, 2013502--
DinybotUC2017mar 24, 20072716dez 16, 20072449--
Sir Nicholas de Lenfent BotUC2115abr 09, 20101604abr 19, 20101594--
FiriBotUC2213jan 09, 20111329jan 09, 20111329--
ChobotUC239dez 04, 2012634mar 13, 2013535--
KgsbotUC247dez 13, 20101356jan 18, 20111320--
AmolbotUC253dez 07, 20101362dez 07, 20101362--
EdwardsBotUC262jul 03, 20111154jul 03, 20111154--
RezabotUC271out 18, 20111047out 18, 20111047--
AvocatoBotUC281abr 17, 2012865abr 17, 2012865--
AbotUC291nov 28, 2013275nov 28, 2013275--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110GifJpgPngSvg
ago 20143,9 k7861,7 k1041,4 k4971706      330370301
jul 20143,8 k7751,7 k1041,4 k4771705      762370301
jun 20143,5 k7661,7 k1041,4 k4761679      115370301
mai 20143,5 k7551,7 k1011,4 k4551678      932368291
abr 20143,2 k7531,7 k1011,4 k4551665      1708368291
mar 20142,9 k7441,7 k1011,4 k4551658      1012368291
fev 20142,7 k7351,7 k1001,4 k4551646      665367291
jan 20142,7 k7261,7 k1001,4 k4501637      790367291
dez 20132,5 k7151,7 k1001,4 k4491625      728367291
nov 20132,4 k7101,7 k1001,4 k4491619      551367291
out 20132,2 k7011,7 k1001,4 k4411593      264367291
set 20132,2 k6941,7 k1001,4 k4411591      419367291
ago 20132,2 k6711,7 k991,4 k4401575      933366291
jul 20132,1 k6651,7 k971,4 k4271472      173364291
jun 20132,1 k6551,7 k961,4 k4271472      76364281
mai 20132,1 k6511,7 k961,4 k4261472      107364281
abr 20132,1 k6451,7 k961,4 k4261472      87364281
mar 20132,1 k6381,7 k961,4 k4241468      78364281
fev 20132,1 k6271,7 k961,4 k4241466      80364281
jan 20132,0 k6201,6 k961,4 k4241463      101364281
dez 20122,0 k6151,6 k961,4 k4241463      73364281
nov 20122,0 k6051,6 k951,4 k4241463      25363281
out 20122,0 k6011,6 k951,4 k4241462      49363281
set 20122,0 k5951,6 k951,4 k4241461      62363281
ago 20122,0 k5841,6 k951,4 k4241461      87363281
jul 20122,0 k5751,6 k951,4 k4241460      104363281
jun 20122,0 k5681,6 k951,4 k4231460      77363281
mai 20121,9 k5421,6 k951,4 k4231460      134363281
abr 20121,9 k5331,6 k941,4 k4231460      164362281
mar 20121,9 k5211,6 k941,4 k4231460      164362281
fev 20121,9 k5141,6 k941,4 k4231460      42362281
jan 20121,9 k4981,6 k941,4 k4211460      64362281
dez 20111,9 k4941,6 k941,4 k4211459      97362281
nov 20111,9 k4891,6 k941,4 k4191459      106362281
out 20111,9 k4731,6 k941,4 k4181457      40362281
set 20111,9 k4621,6 k941,4 k4161457      70362281
ago 20111,9 k4471,6 k941,4 k4141456      36362281
jul 20111,9 k4401,6 k941,4 k4121456      35362281
jun 20111,9 k4261,6 k941,4 k4121452      79362281
mai 20111,8 k4161,6 k941,4 k4121452      60362281
abr 20111,8 k4001,6 k941,4 k4101452      98362281
mar 20111,8 k3881,6 k941,4 k4101452      304362281
fev 20111,8 k3801,6 k841,4 k4031450      607253281
jan 20111,6 k3421,6 k561,4 k3741433      737129251
dez 20101,5 k3341,6 k481,4 k3621397      51121251
nov 20101,5 k3301,6 k481,4 k3621397      113121251
out 20101,5 k3251,6 k481,4 k3611396      118121251
set 20101,5 k3161,6 k481,4 k3561396      204121251
ago 20101,4 k3081,6 k431,4 k3521389      204116251
jul 20101,4 k2891,6 k421,4 k2701383      105115251
jun 20101,4 k2891,6 k411,4 k2701383      58114251
mai 20101,4 k2621,6 k411,4 k2701383      110114251
abr 20101,4 k2561,6 k411,4 k2701383      106114251
mar 20101,4 k2461,5 k411,4 k2701383      63114251
fev 20101,4 k2431,5 k411,4 k2671380      118114251
jan 20101,3 k2391,5 k401,4 k2671379      11111425 
dez 20091,3 k2211,4 k401,4 k2671379      7211425 
nov 20091,3 k2141,4 k391,4 k2671379      12011325 
out 20091,3 k2121,4 k391,4 k2671379      19011325 
set 20091,3 k2071,4 k381,4 k2671375      22311324 
ago 20091,2 k1941,3 k381,4 k2651373      12611324 
jul 20091,2 k1941,3 k381,4 k2651373      17011324 
jun 20091,2 k1881,3 k381,4 k2621373      10911324 
mai 20091,1 k1861,2 k381,4 k2601373      10111324 
abr 20091,1 k1841,2 k381,4 k2601373      17811324 
mar 20091,1 k1711,2 k371,4 k2321359      43911224 
fev 20091,1 k1551,2 k331,4 k1821215      3961923 
jan 20091,0 k1461,1 k321,4 k1821146      1421823 
dez 20089881431,1 k321,4 k1801142      2061823 
nov 20089691391,1 k321,4 k1791141      971823 
out 20089561191,0 k321,4 k1741135      1121823 
set 20089431051,0 k321,4 k1741135      1521823 
ago 2008912101973321,4 k1741134      3731823 
jul 200881497941301,4 k1701133      1551623 
jun 200879394911301,4 k1701131      1211623 
mai 200877687911301,4 k1701131      4671623 
abr 200872082880301,4 k1671127      5041623 
mar 200868678815291,4 k1591124      1481622 
fev 200867974785291,4 k1591124      5091622 
jan 200865068753271,4 k1591124      7111422 
dez 200759365723251,4 k1541105      4391222 
nov 200757861690241,4 k1491105      621221 
out 200757159690241,3 k1481105      3901221 
set 200755451629241,3 k1461105      7321221 
ago 200752943596241,3 k1411101      6081221 
jul 200751540564241,3 k132196      8791221 
jun 200749139532241,3 k130194      1651221 
mai 200747439500231,3 k86193      1481220 
abr 200746537447231,3 k86193      2091220 
mar 200744735409231,2 k84187      1941220 
fev 2007436343822276174171      84 220 
jan 2007431313572276174171      113 220 
dez 2006419313102272274171      139 220 
nov 2006413302962172240136      91 120 
out 2006396272462170337135      146 120 
set 2006377272102169237135      225 120 
ago 2006352261732166837135      173 120 
jul 2006334221322166333134      497 120 
jun 200627313952159228128      172 120 
mai 200623711652159227127      143 120 
abr 20062049352158027127      103 120 
mar 20061806182158027 24      124 120 
fev 20061355162056816 14      66 119 
jan 20061105152054514 14      40 119 
dez 2005954151953711 14      29 118 
nov 200578315195209 14      73 118 
out 20056421424936 14      17 11 
set 20056221414935 14      39  1 
ago 20054821314735 14      4  1 
jul 20054621314675 14      87  1 
jun 20051821014504 4      24  1 
mai 2005821013563 2      1  1 
abr 2005711013563 2      15  1 
mar 2005419 3563 2      10    
fev 20051   356              
jan 20051   356              
dez 20041   356              
nov 20041                  
out 20041                  
set 20041                  
ago 20041                  

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

ago 2004: 1 1 Main Page

mar 2005: 1 1 ضرب‌المثل‌های عربی

abr 2005: 1 1 آدولف هیتلر

mai 2005: 1 1 ضرب‌المثل‌های فارسی

jun 2005: 1 2 آقامحمدخان قاجار , 2 2 عزیز نسین , 3 2 صفحهٔ اصلی , 4 1 محمود احمدی‌نژاد

jul 2005: 1 2 ناشناس , 2 1 ویلیام فالکنر

ago 2005: 1 2 صفحهٔ اصلی , 2 1 فهرست بر اساس فيلم‌ها

set 2005: 1 3 صفحهٔ اصلی , 2 2 علی بن ابی‌طالب , 3 2 ناشناس , 4 1 ارنستو چه گوارا

out 2005: 1 1 فهرست افراد براساس نام

nov 2005: 1 2 کورش مدرسی , 2 2 منصور حکمت , 3 2 حمید تقوایی , 4 2 محمود احمدی‌نژاد , 5 1 دوگ لارسون

dez 2005: 1 1 امبرتو اکو

jan 2006: 1 2 اپیکور , 2 2 ارنستو چه گوارا , 3 1 کانت

fev 2006: 1 2 آلبر کامو , 2 2 زیلاکس , 3 1 محمدتقی مصباح یزدی

mar 2006: 1 2 توماس جفرسون , 2 2 ماتریکس , 3 2 فهرست آثار ادبی , 4 2 فهرست افراد بر اساس نام , 5 2 صفحهٔ اصلی , 6 1 کارلوس کاستاندا

abr 2006: 1 4 صفحهٔ اصلی , 2 3 هرمان هسه , 3 2 مارتین لوتر , 4 2 ضرب‌المثل‌های هلندی , 5 2 استانیسلاو لم , 6 2 ارنست همینگوی , 7 2 مایکل جکسون , 8 2 آلبرت اینشتین

mai 2006: 1 2 رابرت آنسون هاین‌لاین , 2 2 رفیق شامی , 3 2 جلال‌الدین محمد بلخی , 4 2 داگلاس آدامز , 5 2 فرانسوا لارشفوکو , 6 2 ضرب‌المثل‌های لاتینی , 7 2 واشنگتن ایروینگ , 8 2 توماس جفرسون , 9 1 محمد خیابانی

jun 2006: 1 2 فرانسوا فنلون , 2 2 ژان دو لافونتن , 3 2 وینستون چرچیل , 4 2 فهرست افراد بر اساس نام , 5 2 صفحهٔ اصلی , 6 1 رنه دکارت

jul 2006: 1 3 هلن کلر , 2 3 آیان حرصی علی , 3 3 آرزو , 4 3 آندره ژید , 5 3 آرتور شوپنهاور , 6 2 سید مرتضی آوینی , 7 2 الویس پریسلی , 8 2 مسیر سبز , 9 2 کازابلانکا , 10 2 رستگاری در شاوشنک , 11 2 ژولیا کریستوا , 12 2 محمود فلکی , 13 2 منوچهر آتشی , 14 2 جنگ عراق , 15 2 باباطاهر , 16 2 ویلیام سارویان , 17 2 کارل سندبرگ , 18 2 اقبال لاهوری , 19 2 فدریکو فلینی , 20 2 فریدریش شیلر , 21 2 رنه دکارت , 22 2 امیرخسرو دهلوی , 23 2 علی‌اکبر دهخدا , 24 2 کندورسه , 25 2 افلاطون

ago 2006: 1 3 ضرب‌المثل‌های آذربایجانی , 2 3 صفحهٔ اصلی , 3 2 صادق هدایت , 4 2 سووشون , 5 2 شازده کوچولو , 6 1 محمدحسین شهریار

set 2006: 1 4 صفحهٔ اصلی , 2 3 فهرست افراد بر اساس نام , 3 2 بيل گيتس , 4 2 ضرب‌المثل‌های آذربایجانی , 5 2 عمر خیام , 6 2 حافظ , 7 2 میکل‌ آنژ , 8 2 محمود احمدی‌نژاد , 9 1 شهریار

out 2006: 1 2 ژان پل , 2 2 حسن تقی‌زاده , 3 2 ضرب‌المثل‌های آذربایجانی , 4 2 حافظ , 5 2 وودی آلن , 6 2 سعدی , 7 2 فهرست افراد بر اساس نام , 8 1 فرانکا ماگنانی

nov 2006: 1 2 باران کوثری , 2 2 کارل گوستاو یونگ , 3 2 برتولت برشت , 4 2 فهرست افراد بر اساس نام , 5 2 صفحهٔ اصلی , 6 1 محمدرضا شفیعی کدکنی

dez 2006: 1 2 غلامرضا روحانی , 2 2 باران کوثری , 3 2 دنیای سوفی , 4 2 جنگ , 5 2 آلبرت اینشتین , 6 2 فهرست آثار ادبی , 7 1 ریچارد رورتی

jan 2007: 1 3 پدرخوانده , 2 2 ریچارد نیکسون , 3 2 نیکوس کازانتزاکیس , 4 2 ری بردبری , 5 2 محمد زکریای رازی , 6 2 محمود احمدی‌نژاد , 7 2 صفحهٔ اصلی , 8 1 ضرب‌المثل‌های اندونزیایی

fev 2007: 1 2 قیصر , 2 2 صفحهٔ اصلی , 3 1 انجیل متی

mar 2007: 1 3 لودویگ وان بتهوون , 2 3 فریدریش نیچه , 3 2 رمکو کامپرت , 4 2 محمدرضا شفیعی کدکنی , 5 2 کلیم کاشانی , 6 2 بایگانی نقل‌قول روز , 7 2 سعدی , 8 2 صفحهٔ اصلی , 9 1 وگ:وگ

abr 2007: 1 3 فریدریش نیچه , 2 2 داستان یک سیندرلا , 3 2 کما , 4 2 تقاطع , 5 2 مهمان (فیلم) , 6 2 اخراجی‌ها , 7 2 فریدون جنیدی , 8 2 ابوریحان بیرونی , 9 2 وحید قزوینی , 10 2 عمر خیام , 11 2 فردوسی , 12 2 جلال‌الدین محمد بلخی , 13 2 مارتین لوتر

mai 2007: 1 2 راه بی‌پایان , 2 2 تله , 3 2 میم مثل مادر , 4 2 هنر , 5 2 جورج برنارد شاو , 6 2 فهرست آثار ادبی , 7 2 ناشناس , 8 1 اسدی طوسی

jun 2007: 1 2 جان رید , 2 2 مائو تسه تونگ , 3 2 باران کوثری , 4 2 محمد خیابانی , 5 2 عشق , 6 1 سرمایه‌داری

jul 2007: 1 2 سگ , 2 2 گربه , 3 2 عباس کیارستمی , 4 2 نیکلا سارکوزی , 5 2 روز سوم , 6 2 فریدریش انگلس , 7 2 مائو تسه تونگ , 8 2 فریدون جنیدی , 9 2 کارل مارکس , 10 2 سیسرو , 11 2 ضرب‌المثل‌های آلمانی , 12 2 علی شریعتی , 13 2 عشق , 14 1 کد داوینچی

ago 2007: 1 3 سیاست , 2 3 ضرب‌المثل‌های فارسی , 3 2 کریستین بویین , 4 2 سید روح‌الله خمینی , 5 2 ازدواج , 6 2 آزادی , 7 2 ولادیمیر لنین , 8 2 کارل مارکس , 9 2 علویه خانم , 10 2 ضرب‌المثل‌های اسپانیایی , 11 2 سید مرتضی آوینی , 12 2 داگلاس آدامز , 13 2 هنر , 14 2 دانش , 15 2 دوستی , 16 2 جنگ , 17 1 سنگسار

set 2007: 1 3 لئون تروتسکی , 2 3 محمود احمدی‌نژاد , 3 2 شتر , 4 2 مزرعه حیوانات , 5 2 ۱۹۸۴ , 6 2 ملالی جویا , 7 2 سید روح‌الله خمینی , 8 2 فاطمه زهرا/گفتار هایی از فاطمه زهرا , 9 2 فاطمه زهرا/اشعاری از شعرای کهن پیرامون فاطمه زهرا , 10 2 فاطمه زهرا/فاطمه زهرا در نگاه امامان شیعه , 11 2 ولادیمیر لنین , 12 2 ایرج‌میرزا , 13 2 اهلی شیرازی , 14 2 نقل‌قول روز , 15 2 باران کوثری , 16 2 ضرب‌المثل‌های ارمنی , 17 2 ضرب‌المثل‌های ایتالیایی , 18 2 افلاطون , 19 2 دانش , 20 2 آندره ژید , 21 2 جرج هربرت , 22 2 موریس مترلینک , 23 2 فهرست فیلم‌ها , 24 2 لئو بوسکالیا , 25 2 سورن کی‌یر کگارد

out 2007: 1 3 ژان دلا برویر , 2 2 آندری تارکوفسکی , 3 2 جان لاک , 4 2 شتر , 5 2 کارل مارکس , 6 2 باران کوثری , 7 2 ضرب‌المثل‌های ارمنی , 8 2 صادق هدایت , 9 2 ضرب‌المثل‌های آذربایجانی , 10 2 سنایی , 11 2 رقص , 12 2 فهرست فیلم‌ها , 13 1 مرکز موسیقی بتهوون

nov 2007: 1 3 علی بن ابی‌طالب , 2 2 داوید آلفارو سی‌که‌ایروس , 3 2 جیمز ناکس پولک , 4 2 ضرب‌المثل‌های آذربایجانی , 5 2 فیلم , 6 1 انقلاب

dez 2007: 1 5 فهرست افراد بر اساس نام , 2 4 دیوارنوشته , 3 4 ویلیام شکسپیر , 4 3 جلیل ضیاءپور , 5 3 خانه‌ای بر روی آب , 6 3 صلح , 7 3 فریدریش نیچه , 8 3 صفحهٔ اصلی , 9 2 ماهی , 10 2 انقلاب , 11 2 جورج دبلیو بوش , 12 2 محمدحسین شهریار , 13 2 ضرب‌المثل‌های آذربایجانی , 14 2 ضرب‌المثل‌های اسپانیایی , 15 2 فهرست نمایش‌های تلویزیونی , 16 2 ابن سینا , 17 2 عشق , 18 2 فهرست فیلم‌ها

jan 2008: 1 5 لوئیس بونوئل , 2 4 فهرست افراد بر اساس نام , 3 4 ضرب‌المثل‌های فارسی , 4 3 جنون , 5 3 محمدحسین شهریار , 6 3 ژان دارک , 7 3 محمود احمدی‌نژاد , 8 2 طبیعت , 9 2 جورج اورول , 10 2 مجنون , 11 2 زنبور , 12 2 مرگ , 13 2 خنده , 14 2 مکس پین , 15 2 کودک , 16 2 خوب، بد، زشت , 17 2 رومن رولان , 18 2 سیمین دانشور , 19 2 مادر , 20 2 فروغ فرخزاد , 21 2 کتاب , 22 2 عطار نیشابوری , 23 2 نیشابور , 24 2 جورج دبلیو بوش , 25 2 دنیای سوفی

fev 2008: 1 3 روشنفکر , 2 2 گل , 3 2 شراب , 4 2 سیمون دوبوار , 5 2 مرگ , 6 2 منیرو روانی‌پور , 7 2 فروغ فرخزاد , 8 2 کتاب , 9 2 تاریخ , 10 2 نقل‌قول روز , 11 2 نیکوس کازانتزاکیس , 12 2 ضرب‌المثل‌های ترکی , 13 2 ضرب‌المثل‌های آذربایجانی , 14 2 هنر , 15 2 عشق , 16 1 عارف قزوینی

mar 2008: 1 3 اورسن ولز , 2 3 فهرست افراد بر اساس نام , 3 2 مائو تسه‌دون , 4 2 سنگسار , 5 2 عشق , 6 2 کارلایل

abr 2008: 1 3 سید علی خامنه‌ای , 2 3 ژیل دلوز , 3 3 فهرست افراد بر اساس نام , 4 3 ناپلئون بناپارت , 5 3 صفحهٔ اصلی , 6 2 سید جمال‌الدین اسدآبادی , 7 2 محمد فضولی , 8 2 چنین گفت زرتشت , 9 2 تقی ارانی , 10 2 شارلوت برونته , 11 2 شیون فومنی , 12 2 فردریک هگل , 13 2 لوچیو کولتی , 14 2 هربرت مارکوزه , 15 2 نیکوس پولانزاس , 16 2 باروخ اسپینوزا , 17 2 گئورگ ویلهلم فریدریش هگل , 18 2 مگس , 19 2 جلیل ضیاءپور , 20 1 سید جمال الدین اسدآبادی

mai 2008: 1 6 فهرست افراد بر اساس نام , 2 3 حسین پناهی , 3 3 عشق , 4 3 صفحهٔ اصلی , 5 2 پروانه , 6 2 جورج گوردون بایرون , 7 2 پاپلی یزدی , 8 2 بلبل , 9 2 هانا آرنت , 10 2 دایره زنگی , 11 2 عارف قزوینی , 12 2 امیلی برونته , 13 2 دانش , 14 2 آرزو , 15 2 موریس مترلینک , 16 1 کسایی مروزی

jun 2008: 1 2 هنری دیوید تورو , 2 2 لنگستون هیوز , 3 2 ستارخان , 4 2 شراب , 5 2 سنگسار , 6 2 بزرگمهر , 7 1 مجوز مستندات آزاد گنو

jul 2008: 1 4 طاهره قرةالعین , 2 3 گوساله , 3 3 عباس کیارستمی , 4 3 فهرست افراد بر اساس نام , 5 2 مرد سوم , 6 2 نیمتاج سلماسی , 7 2 هوشنگ گلشیری , 8 2 نقش رستم , 9 2 تخت جمشید , 10 2 سید محمد طباطبائی , 11 2 رشحه , 12 2 حسین پناهی , 13 2 اورسن ولز

ago 2008: 1 3 بوسه , 2 2 داستان دو شهر , 3 2 سکوت , 4 2 ۱۷ فوریه , 5 2 گراهام گرین , 6 2 هانیبال الخاص , 7 2 شیخ فضل‌الله نوری , 8 2 صائب تبریزی , 9 2 آندری تارکوفسکی , 10 2 لودویگ وان بتهوون , 11 2 مارتین لوتر کینگ جونیور , 12 2 عشق , 13 2 آلبرت اینشتین , 14 2 محمود احمدی‌نژاد , 15 1 اریش فروم

set 2008: 1 3 گربه روی شیروانی داغ (نمایشنامه) , 2 2 امیر نادری , 3 2 محمدحسین پاپلی یزدی , 4 2 تنسی ویلیامز , 5 2 دیپاک چوپرا , 6 2 پاپلی یزدی , 7 1 ۲ مه

out 2008: 1 2 حسام‌الدین خویی , 2 2 میرزا علی‌اکبر صابر , 3 2 امام محمد غزالی , 4 2 علی اکبر دهخدا , 5 1 حسام الدین خویی

nov 2008: 1 4 فهرست افراد بر اساس نام , 2 2 باراک اوباما , 3 1 ژان سیبلیوس

dez 2008: 1 2 گروچو مارکس , 2 2 فردوسی

jan 2009: 1 3 محمد بن عبدالله , 2 2 امیلی دیکنسن , 3 2 گلادیاتور , 4 1 ۱۴ ژانویه

fev 2009: 1 3 زنان , 2 3 محمد علی کلی , 3 2 ماهواره امید , 4 2 حسن طبری آملی , 5 2 سید محمد‌کاظم شریعتمداری , 6 2 ولایت فقیه , 7 2 خلفای راشدین , 8 2 اردبیل , 9 2 شاهین نجفی , 10 2 دایره زنگی , 11 2 وحشی بافقی , 12 2 خیلی دور، خیلی نزدیک , 13 2 قیصر , 14 2 آلفونس کار , 15 2 پائولو کوئیلو , 16 1 محیط طباطبائی

mar 2009: 1 2 علی اکبر شیرودی , 2 2 بهارانه , 3 2 حسن لاهوتی اشکوری , 4 2 حسن طبری آملی , 5 2 شارلوت برونته , 6 2 حسین بن علی , 7 2 هاینریش هاینه , 8 2 گابریل گارسیا مارکز , 9 2 رنه دکارت , 10 2 ژان دو لافونتن , 11 2 رودکی , 12 2 ابن سینا , 13 2 عمر خیام , 14 2 استانیسلاو لم , 15 2 آلبر کامو , 16 2 تالس , 17 2 آلبرت اینشتین , 18 2 جورج برنارد شاو , 19 2 مارشال مک‌لوهان , 20 1 علی صیاد شیرازی

abr 2009: 1 4 فهرست افراد بر اساس نام , 2 3 حسین منصور حلاج , 3 2 ریچارد براتیگان , 4 2 آنا آخماتووا , 5 2 فروغ فرخزاد , 6 2 عطار نیشابوری , 7 2 سعدی , 8 2 یوهان ولفگانگ گوته , 9 2 آلبرت اینشتین , 10 2 منصور حکمت , 11 1 مهدی رجب بیگی

mai 2009: 1 5 فهرست افراد بر اساس نام , 2 2 عماد مغنیه , 3 2 صلح , 4 2 سید روح‌الله خمینی , 5 2 فردوسی

jun 2009: 1 2 تبریز , 2 2 جرج برناردشاو , 3 2 لئوناردو داوینچی , 4 2 دار و دسته‌های نیویورکی , 5 1 لئونارد داوینچی

jul 2009: 1 4 علی بن ابی‌طالب , 2 2 زنان , 3 2 استیون واینبرگ , 4 1 توماس هنری هاکسلی

ago 2009: 1 3 احمد مفتی‌زاده , 2 3 شعارهای مردم در اعتراض به نتیجه انتخابات ریاست جمهوری , 3 3 ضرب‌المثل‌های چینی , 4 2 گیتی نوین , 5 2 میرحسین موسوی , 6 2 آبراهام لینکلن , 7 1 یوسف صانعی

set 2009: 1 3 سید محمد خاتمی , 2 3 علی شریعتی , 3 3 فهرست افراد بر اساس نام , 4 2 در بروژ , 5 2 احمد مفتی‌زاده , 6 2 شعارهای مردم در اعتراض به نتیجه انتخابات ریاست جمهوری , 7 2 میرحسین موسوی , 8 2 دزدان دریایی کارائیب: صندوق مرد مرده , 9 2 حسین پناهی , 10 2 سید علی خامنه‌ای , 11 1 پیامک

out 2009: 1 2 خواب , 2 2 بهلول , 3 2 امام محمد باقر , 4 2 جعفر صادق , 5 2 میرحسین موسوی , 6 2 دنیای سوفی , 7 1 عبدالکریم سروش

nov 2009: 1 4 محمود احمدی‌نژاد , 2 2 ژان پل سارتر , 3 1 چه‌گوارا

dez 2009: 1 1 سید احمد علم‌الهدی

jan 2010: 1 2 ریاضی , 2 2 محمدرضا شجریان , 3 2 سید احمد علم‌الهدی , 4 2 اسفندیار رحیم‌مشایی , 5 2 میرحسین موسوی , 6 1 بیماری

fev 2010: 1 3 جنبش سبز , 2 2 علی رضا بدیع , 3 2 لئوناردو داوینچی , 4 2 فهرست فیلم‌ها , 5 1 پل ورلن

mar 2010: 1 2 شعارهای مردم در اعتراض به نتیجه انتخابات ریاست جمهوری , 2 2 فهرست افراد بر اساس نام , 3 1 کورش کوچک

abr 2010: 1 4 بهاءالله , 2 3 محمود احمدی‌نژاد , 3 2 هرات , 4 2 سید حسن فیروزآبادی , 5 2 میرحسین موسوی , 6 2 سید علی خامنه‌ای , 7 2 وینستون چرچیل , 8 1 پیامک

mai 2010: 1 2 بهاءالله , 2 2 محمدرضا شجریان , 3 2 فردوسی , 4 1 سلام

jun 2010: 1 3 سید روح‌الله خمینی , 2 2 کاظم صدیقی , 3 2 سید علی خامنه‌ای , 4 2 فهرست افراد بر اساس نام , 5 1 حاتم طایی

jul 2010: 1 2 خوزستان , 2 2 بدبیاری‌ها , 3 2 آین رند , 4 2 حسین الهی قمشه‌ای , 5 2 ضرب‌المثل‌های فارسی , 6 1 عین القضاة همدانی

ago 2010: 1 3 محمود احمدی‌نژاد , 2 2 آیزاک آسیموف , 3 2 چای , 4 2 دخانیات , 5 2 خلیج فارس , 6 2 خوزستان , 7 2 علی‌رضا بدیع , 8 2 آمریکا , 9 2 سید علی‌محمد دستغیب , 10 2 نیشابور , 11 2 محمدحسین شهریار , 12 2 امیرخسرو دهلوی , 13 1 پیامک

set 2010: 1 4 علی بن ابی‌طالب , 2 4 فهرست افراد بر اساس نام , 3 3 عمرو عاص , 4 3 باراک اوباما , 5 3 حسین بن علی , 6 2 جلال‌الدین فارسی , 7 2 ابوالحسن بنی‌صدر , 8 2 معاویه پسر ابی‌سفیان , 9 2 سهیل پسر عمرو , 10 2 میدان نقش جهان , 11 2 دمشق , 12 1 پیامک

out 2010: 1 2 قهوه تلخ , 2 2 عبدالجواد غرويان , 3 2 آنتون چخوف , 4 2 علی بن ابی‌طالب , 5 2 جکسون براون , 6 1 قهوه تلخ (سریال)

nov 2010: 1 3 قهوه تلخ , 2 3 جورج برنارد شاو , 3 2 غلامحسین ساعدی , 4 2 غلامعلی بسکی , 5 2 محسن قرائتی , 6 1 هارون‌الرشید

dez 2010: 1 2 سنگسار در اسلام , 2 2 وحشی بافقی , 3 2 فروغ فرخزاد , 4 2 علی بن ابی‌طالب , 5 1 لویی فردینان سلین

jan 2011: 1 3 علی‌رضا افتخاری , 2 3 فهرست فیلم‌ها , 3 3 علی بن ابی‌طالب , 4 3 محمود احمدی‌نژاد , 5 2 پیامک , 6 2 مهدی , 7 2 توبه , 8 2 رضی‌الدین نیشابوری , 9 2 ابرهه , 10 2 قاسم بن محمد , 11 2 عبدالله بن شبرمه , 12 2 شطرنج , 13 2 ابی بن کعب , 14 2 عایشه , 15 2 محمدجواد عزتی , 16 2 ابن عباس , 17 2 ابن قیم الجوزیه , 18 2 حسن بصری , 19 2 زین‌العابدین مراغه‌ای , 20 2 مصر , 21 2 خراسان , 22 2 زین‌العابدین بن علی , 23 2 سبزوار , 24 2 ضرب‌المثل‌های خراسانی , 25 2 شب‌های روشن

fev 2011: 1 3 خلیج فارس , 2 3 ایران , 3 2 معمر قذافی , 4 2 مأمون , 5 2 مشورت , 6 2 مدینه , 7 2 نام‌گذاری فرزند , 8 2 عمر بن خطاب , 9 2 ابوبکر , 10 2 عزت‌الله سحابی , 11 2 عبدالکریم سروش , 12 2 میرحسین موسوی , 13 2 محمدحسین پاپلی یزدی , 14 2 آنتون چخوف , 15 2 منوچهر آتشی , 16 2 عمر خیام , 17 1 شعارهای مردم لیبی در اعتراضات سال ۲۰۱۱

mar 2011: 1 4 علی بن ابی‌طالب , 2 3 محمدجواد عزتی , 3 3 عمر بن خطاب , 4 3 ابوبکر , 5 3 نیشابور , 6 3 آدولف هیتلر , 7 2 کیم وو چونگ , 8 2 طاهر بن حسین , 9 2 فاروق , 10 2 ابوعثمان سعید مغربی , 11 2 سید حسن مدرس , 12 2 نجم‌الدین اربکان , 13 2 روژه گارودی , 14 2 معمر قذافی , 15 2 قدس , 16 2 ادیب نیشابوری , 17 2 زبان عربی , 18 2 زبان فارسی , 19 1 ابو حفص حداد

abr 2011: 1 2 ابوسعید ابوالخیر , 2 2 ضرب‌المثل‌های خراسانی , 3 1 لودویک زامنهوف

mai 2011: 1 2 جفرسون دیویس , 2 2 خواجه عبدالله انصاری , 3 2 علویه خانم , 4 1 ناصر حجازی

jun 2011: 1 2 ابوبکر , 2 2 ایران , 3 1 آشنایی با مادر

jul 2011: 1 1 علی بن ابیطالب

ago 2011: 1 3 عمر بن خطاب , 2 2 کورش بزرگ , 3 1 میرزا حسین‌علی نوری

set 2011: 1 3 فهرست آثار ادبی , 2 2 جرم (فیلم) , 3 2 فرینج , 4 2 نیشابور , 5 2 کازابلانکا , 6 2 فهرست فیلم‌ها , 7 1 هوشنگ ایرانی

out 2011: 1 2 جدایی نادر از سیمین , 2 2 نیشابور , 3 1 اینشتین

nov 2011: 1 4 ازدواج , 2 3 مبارزه متعالی , 3 2 شعور خلاق , 4 2 کلام خلاق , 5 2 قضاوت , 6 1 یوحنای مجنون

dez 2011: 1 3 ایلیا میم , 2 2 پیمان فتاحی , 3 2 هامون , 4 2 محمدرضا پهلوی , 5 2 محمد مصدق , 6 2 مایکل جکسون , 7 1 مصطفی چمران

jan 2012: 1 3 ضرب‌المثل‌های فارسی , 2 2 علاءالدین ملماسی , 3 2 سید روح‌الله خمینی , 4 2 فریدون جنیدی , 5 2 فهرست فیلم‌ها , 6 1 هوپ‌هوپ‌نامه

fev 2012: 1 2 آمل , 2 1 طالب آملی

mar 2012: 1 2 پیمان فتاحی , 2 2 جلال‌الدین محمد بلخی , 3 2 مریلین منسون , 4 2 فهرست آثار ادبی , 5 2 فهرست افراد بر اساس نام , 6 1 اریک کانتونا

abr 2012: 1 5 ماهواره امید , 2 3 فهرست افراد بر اساس نام , 3 2 سکسوالیته , 4 2 بایزید بسطامی , 5 2 جانی دپ , 6 2 مذهب , 7 2 علی شریعتی , 8 1 شادی

mai 2012: 1 3 مارک تواین , 2 2 پرویز شهریاری , 3 2 شاهین نجفی , 4 2 جورج برنارد شاو , 5 2 فهرست افراد بر اساس نام , 6 1 کارل سیگن

jun 2012: 1 2 سیروان خسروی , 2 1 بابک خرمدین

jul 2012: 1 3 رضا پهلوی , 2 2 ارباب کمان نقره‌ای , 3 2 جورج برنارد شاو , 4 2 مارک تواین , 5 1 اتاقی از آن خود

ago 2012: 1 3 فهرست فیلم‌ها , 2 2 دیوانه‌ای از قفس پرید , 3 2 سفر به انتهای شب , 4 2 عمر بن خطاب , 5 2 هانا آرنت , 6 2 صادق هدایت , 7 2 ایمانوئل کانت , 8 1 زیستن چون پروانه

set 2012: 1 1 بهار ۶۳

out 2012: 1 1 ضرب‌المثل‌های کردی

nov 2012: 1 5 فهرست افراد بر اساس نام , 2 2 عمر بن خطاب , 3 1 محمود کریمی حکاک

dez 2012: 1 2 مصطفی دلشاد تهرانی , 2 2 فهرست افراد بر اساس نام , 3 1 امیر قلعه نویی

jan 2013: 1 3 عمر بن خطاب , 2 2 جورج اورول , 3 2 عشق , 4 2 فهرست افراد بر اساس نام , 5 1 لیلا صادقی

fev 2013: 1 2 ناجی علی , 2 2 آسیا عبدالله

mar 2013: 1 2 سید علی خامنه‌ای , 2 1 انیو موریکونه

abr 2013: 1 3 ماکسیمیلیان روبسپیر , 2 3 سن ژوست , 3 3 انیو موریکونه , 4 3 مختارنامه (مجموعه تلویزیونی) , 5 2 حرفه‌ای , 6 2 سید محمد‌کاظم شریعتمداری , 7 2 علی شریعتی , 8 1 عماد خراسانی

mai 2013: 1 4 دینو بوتزاتی , 2 4 آزادی , 3 3 عماد خراسانی , 4 3 ضرب‌المثل‌های بختیاری , 5 3 فریدون مشیری , 6 1 ماکسیم گورکی

jun 2013: 1 2 مالکوم لطیف شباز , 2 2 حسن روحانی , 3 1 آبراهام مازلو

jul 2013: 1 2 ایندیرا گاندی , 2 1 100 گفتار

ago 2013: 1 3 حسن روحانی , 2 3 عمر بن خطاب , 3 3 ابوبکر , 4 2 محمد بن موسی خوارزمی , 5 2 داوید هیلبرت , 6 2 محمدعلی جمال‌زاده , 7 2 پینوکیو (فیلم) , 8 2 ناخدا خورشید , 9 2 باغ‌های کندلوس , 10 2 لودویگ ویتگنشتاین , 11 2 والتر اسکات , 12 2 راینر ماریا ریلکه , 13 2 نورعلی الهی , 14 2 کاشان , 15 2 توماس هاکسلی , 16 2 البرت هوبارد , 17 2 ایندیرا گاندی , 18 2 دوایت آیزنهاور , 19 2 فرانک تایگر , 20 2 آلیس واکر , 21 2 پایتخت , 22 2 داریوش بزرگ , 23 2 گشت ارشاد , 24 2 شیخ بهائی , 25 2 دیوانه‌ای از قفس پرید

set 2013: 1 3 فهرست افراد بر اساس نام , 2 2 شمع , 3 2 زیرپوست شهر , 4 2 جیمز جویس , 5 2 گی دو موپاسان , 6 2 جان استاینبک , 7 2 ابوبکر کرجی , 8 2 آنه فرانک , 9 2 پینوکیو (فیلم) , 10 1 پاتریس لومومبا

out 2013: 1 2 استاد الهی , 2 2 پینوکیو (فیلم) , 3 2 نورعلی الهی , 4 2 ایرانی , 5 2 سید محمد خاتمی , 6 2 فهرست فیلم‌ها , 7 2 علی بن ابی‌طالب , 8 1 شمس تبریزی

nov 2013: 1 2 محمدجواد ظریف , 2 2 استاد الهی , 3 2 لودویگ ویتگنشتاین , 4 2 نورعلی الهی , 5 2 شطرنج , 6 2 عشق , 7 1 علی زین العابدین

dez 2013: 1 4 دانش , 2 3 جینا جیمسون , 3 3 ارتداد در اسلام , 4 3 سنگسار در اسلام , 5 3 جورج واشنگتن , 6 3 کورش بزرگ , 7 2 سفارت , 8 2 فریدریش هایک , 9 2 خرما , 10 2 نهنگ , 11 2 جوزف کمبل , 12 2 لوئیزا می آلکوت , 13 2 هشت صبح , 14 2 سید علی‌اصغر دستغیب , 15 2 نلسون ماندلا , 16 2 مبارزه متعالی , 17 2 بخشندگی , 18 2 ابوسعید ابوالخیر , 19 2 زکات , 20 2 شطرنج , 21 2 ناصر مکارم شیرازی , 22 2 میرزا کوچک خان جنگلی , 23 2 نماز (اسلام) , 24 2 زنان , 25 2 سکوت

jan 2014: 1 3 شاه اسماعیل دوم , 2 3 آلبرت اشپر , 3 3 علی‌رضا , 4 2 یاس (خواننده) , 5 2 آل کاپون , 6 2 پول , 7 2 اخلاق , 8 2 اراده , 9 2 جوانی , 10 2 حسادت , 11 2 تجربه , 12 2 طمع , 13 2 استبداد , 14 2 جهان , 15 2 بیابان , 16 2 حسن روحانی , 17 2 اندیشیدن , 18 2 عمر بن خطاب , 19 2 زیبایی آمریکایی , 20 2 انسان , 21 2 حسن بن علی , 22 2 زنان , 23 2 بوسه , 24 2 کودک , 25 2 آزادی

fev 2014: 1 3 ژوزه ساراماگو , 2 3 کورش بزرگ , 3 2 تحقیر , 4 2 کورت وانگات , 5 2 علی کریمی , 6 2 آلکساندر سولژنیتسین , 7 2 شمس تبریزی , 8 2 ملاله یوسف‌زی , 9 2 جان استاینبک , 10 2 صدام حسین , 11 2 گهواره گربه , 12 2 شوالیه تاریکی , 13 2 بغداد , 14 2 معمر قذافی , 15 2 حج , 16 2 ابوبکر , 17 2 حامد کرزی , 18 2 سجاد , 19 2 جعفر صادق , 20 2 ایران , 21 2 تهران , 22 2 محمدرضا پهلوی , 23 2 حسین بن علی , 24 2 مخمصه , 25 2 رستگاری در شاوشنک

mar 2014: 1 4 زندگی , 2 3 حسن روحانی , 3 3 عمر مختار , 4 3 انسان , 5 2 پریکلس , 6 2 مجید مجیدی , 7 2 بیل برایسون , 8 2 استیو مارابولی , 9 2 توپاک شکور , 10 2 کریستوفر مارلو , 11 2 ادگار واتسون هاو , 12 2 ساموئل جانسون , 13 2 کلارنس دارو , 14 2 سو تاونسند , 15 2 والتر رالی , 16 2 جان ماری گیبون , 17 2 جان هیت استابز , 18 2 رالف ریچاردسون , 19 2 اشرف ریفی , 20 2 حکومت , 21 2 سال بلو , 22 2 آرت بوخوالد , 23 2 سیلماریلیون , 24 2 دایدو , 25 2 اسلام

abr 2014: 1 6 سید محمد باقر پوسایی , 2 3 فاطمه زهرا , 3 2 محدث نوری , 4 2 هریت بیچر استو , 5 2 مارکی دوساد , 6 2 راشل کارسون , 7 2 پسرعمه زا , 8 2 احمد مسجدجامعی , 9 2 چارلز مک‌کارتی , 10 2 جورج کارلین , 11 2 رضا نظری , 12 2 فضل‌الله زاهدی , 13 2 رجب طیب اردوغان , 14 2 عبدالله بن عبدالعزیز , 15 2 محسن موسوی تبریزی , 16 2 عبدالرحمن اوزاعی , 17 2 نادانی , 18 2 آب , 19 2 لوئیزا می آلکوت , 20 2 غیرت , 21 2 صادق زیباکلام , 22 2 رزا لوکزامبورگ , 23 2 محمدعلی جمال‌زاده , 24 2 کاشان , 25 2 والتر گروپیوس

mai 2014: 1 3 رضا داوری اردکانی , 2 3 مریم طاهری مجد , 3 3 کامبیز درم‌بخش , 4 3 لودویگ ویتگنشتاین , 5 2 ارومیه , 6 2 ایوان تورگنیف , 7 2 نیکلای گوگول , 8 2 مصطفی ملکیان , 9 2 احسان نراقی , 10 2 لیلا حاتمی , 11 2 غلامحسین ابراهیمی دینانی , 12 2 ناتاشا امیری , 13 2 مهشید امیرشاهی , 14 2 فرخنده آقایی , 15 2 شیرین نشاط , 16 2 پگاه احمدی , 17 2 بهاره رهنما , 18 2 ابوتراب خسروی , 19 2 مهدی یزدانی‌خرم , 20 2 حمیدرضا صدر , 21 2 محمد بساطی , 22 2 خیری شلبی , 23 2 علاء الاسوانی , 24 2 ابراهیم اصلان , 25 2 ادوار خراط

jun 2014: 1 2 آنتیستینس , 2 2 اخراجی ها ٢ , 3 2 پیامک , 4 1 ویلیام سامرست موآم

jul 2014: 1 3 اروین د. یالوم , 2 3 گراتزیا دلدا , 3 2 جیم موران , 4 2 نوری مالکی , 5 2 جی.کی. رولینگ , 6 2 دولت اسلامی عراق و شام , 7 2 جنیفر لوپز , 8 2 خسرو شکیبایی , 9 2 ابراهیم فقی , 10 2 حماس , 11 2 پیروز مجتهدزاده , 12 2 سید محمود هاشمی شاهرودی , 13 2 سیما تیرانداز , 14 2 محمدباقر نجفی اصفهانی , 15 2 حسن قزوینی , 16 2 تروریسم , 17 2 ابوبکر کرجی , 18 2 سجاد , 19 2 روز قدس , 20 2 هوشنگ ابتهاج , 21 2 مهدی اخوان ثالث , 22 2 کورش بزرگ , 23 2 حافظ , 24 1 تغار

ago 2014: 1 3 فریدون فرخزاد , 2 3 شیخ فضل‌الله نوری , 3 2 یزدگرد سوم , 4 2 وضعیت سفید , 5 2 علی دیواندری , 6 2 ایران , 7 2 گربه , 8 2 صادق هدایت , 9 2 فهرست افراد بر اساس نام , 10 1 مسیحیت

No data on this page have been normalized to 30 day months (as WMF does on certain traffic reports).
Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Domingo, 28 de setembro 2014 22:44

Dump file fawikiquote-20140904-pages-meta-history.xml.7z (full dump), size 8.4 Mb as 7z -> 582 Mb
Dump processed till Aug 31, 2014, on server stat1002, ready at Tue-09/09/2014-01:48 after 1 min, 49 sec.

Versão do script:2.6
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.