Estatísticas da Wikispecial wikimedia commons

Zoom           
Monthly counts & Quarterly rankings / New: Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist
 
Monthly counts & Quarterly rankings
 
DataAutoresArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
ago 2009+1% -2% +1%+14%  -8%+1%+1%+1%0%(0%)+1%+1%
jul 2009+1% -2% +1%+5%  -23%+1%+1%+1%0%(+1%)+1%+1%
jun 2009+1% -5% +1%   +24%+1%+1%+1%+1%(0%)+1%+8%
mai 2009+1% -4% +1%   -47%+1%+2%+1%+1%(-0%)+3%+2%
abr 2009+1% +5% +1%-19%  +79%+2%+2%+1%+8%(-6%)+2%+2%
mar 2009+1% +3% +1%-21%  +8%+2%+2%+2%+1%(0%)+3%+2%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
ago 20096557723611692 k2512,185413 k116 Mb12,1 M168 k741 k(20 k)4,6 k54 k
jul 20096485693691691 k2212,185014 k115 Mb11,9 M166 k738 k(20 k)4,6 k54 k
jun 20096416613781791 k2112,084519 k113 Mb11,8 M165 k735 k(19 k)4,6 k53 k
mai 20096355753961790 k1611,983915 k112 Mb11,6 M163 k728 k(19 k)4,5 k49 k
abr 20096280874111590 k2111,883128 k110 Mb11,4 M161 k722 k(19 k)4,4 k48 k
mar 20096193643902089 k2611,682316 k108 Mb11,2 M160 k669 k(21 k)4,3 k47 k
fev 20096129773791788 k3311,581615 k106 Mb11,0 M157 k665 k(21 k)4,2 k47 k
jan 20096052804271687 k2611,581118 k104 Mb10,9 M153 k661 k(21 k)4,1 k46 k
dez 20085972784382086 k3211,480230 k103 Mb10,7 M149 k655 k(24 k)3,9 k45 k
nov 20085894764042685 k3611,179419 k100 Mb10,4 M146 k614 k(24 k)3,8 k44 k
out 20085818954592884 k3511,178621 k98 Mb10,2 M142 k609 k(24 k)3,6 k43 k
set 200857231024493183 k3811,077827 k96 Mb10,0 M138 k604 k(24 k)3,6 k42 k
jul 20096485693691691 k2212,185014 k115 Mb11,9 M166 k738 k(20 k)4,6 k54 k
abr 20096280874111590 k2111,883128 k110 Mb11,4 M161 k722 k(19 k)4,4 k48 k
jan 20096052804271687 k2611,581118 k104 Mb10,9 M153 k661 k(21 k)4,1 k46 k
out 20085818954592884 k3511,178621 k98 Mb10,2 M142 k609 k(24 k)3,6 k43 k
jul 20085519974872381 k3410,676141 k92 Mb9,5 M133 k593 k(23 k)4,2 k39 k
abr 20085203975132278 k3610,074019 k84 Mb8,9 M124 k481 k(22 k)3,0 k37 k
jan 200848881105381575 k389,871625 k78 Mb8,2 M116 k462 k(20 k)2,6 k34 k
out 200745551405532869 k519,469922 k71 Mb7,5 M108 k417 k(19 k)2,3 k31 k
jul 200741211526411964 k649,267628 k64 Mb6,7 M100 k394 k(18 k)1,9 k28 k
abr 200736871526163358 k628,664824 k54 Mb5,8 M87 k250 k(16 k)1,6 k24 k
jan 200732291526102452 k578,162422 k48 Mb5,0 M77 k224 k(14 k)1,2 k21 k
out 200628221315482046 k597,758320 k40 Mb4,2 M67 k184 k(13 k)1,4 k18 k
jul 200623531515882238 k1417,458527 k33 Mb3,4 M60 k153 k(12 k)1,1 k9,7 k
abr 200618871485192430 k547,257317 k25 Mb2,6 M48 k113 k(10 k)8027,9 k
jan 200614891244852125 k536,854315 k20 Mb2,0 M41 k96 k(8,8 k)6366,4 k
out 200511951013701620 k596,351114 k16 Mb1,5 M31 k75 k(7,8 k)5955,0 k
jul 20058661013761415 k476,047812 k11 Mb1,0 M21 k55 k(8,1 k)3133,5 k
abr 200552796288229,5 k495,229512 k5,1 Mb442 k8,4 k37 k(9,9 k)2521,9 k
jan 20052747619096,2 k334,11806,3 k2,8 Mb171 k3,4 k25 k(11 k)146884
out 20042392122,5 k681,8573,4 k663 kb19 k2062,7 k(6,1 k)15125
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
 AutoresArtigosBase de dadosLigações

Counts for image links are based on keyword(s) found in the message file for this language: (Image).
Note that image links based on default keyword 'Image' and/or 'File' have been missed. This will be repaired on the next run.

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

Autores (usuários registrados)
A = Autores que editaram pelo menos dez vezes desde que chegaram (sep11: all)
B = Aumento no número de autores que editaram pelo menos dez vezes desde que chegaram
C = Autores que contribuíram cinco vezes ou mais este mês
D = Autores que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


New: Edit activity levels of registered users and bots per group of namespaces

Namespaces: Articles = 0   Talk = 1,3,5,7,9,..   Other = 2,4,6,8,..

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 5  10  25  100  250  1000  2500  5  10  100  1000  10000  5  10  25  100  250  1000  2500  10000  25000  5  10  100  1000  10000  5  10  25  100  250  1000  2500  10000  5  10  100  1000  10000  100000  1000000 
ago 200936119067164  21   584297124361721118851 7007450724679034318419240393016821
jul 200936918574165  641  5802931374212221111842 6454416422898443949528247463320115 
jun 2009378191661761 321  5932791233210211199631635140082264836387832414037291561 
mai 200939622282176  431  581301138321831119942 6277409922978484219525 3232251031 
abr 2009411225761561 7521157030314035143111101042 615939842214846375762423535301451 
mar 2009390223932061 332  577278133411621119951 60323913217678336869202303024116  
fev 200937919781177  311  58828511731122111111162 5969398022787463297920 30292573  
jan 2009427225861661 321  59227812334142111121162 5859382621307433578919 333325113  
dez 2008438225100206  5321155328812030101111101062 5481362120227723738722126262383  
nov 20084042279626111 431  53426811235132111121072 5223333218726823216017 24241974  
out 200845925710128102 641  55329213536132111121271 5450351219206873125618 29282283  
set 20084492431103191 2111 523260115321331119941 55383602199670230158121262419941 
jul 200936918574165  641  5802931374212221111842 6454416422898443949528247463320115 
abr 2009411225761561 7521157030314035143111101042 615939842214846375762423535301451 
jan 2009427225861661 321  59227812334142111121162 5859382621307433578919 333325113  
out 200845925710128102 641  55329213536132111121271 5450351219206873125618 29282283  
jul 2008487257992351 432115422741252913    131273 5502363020317082885213129271881  
abr 20085132731002271 221  50722282229    111093 5280344018785832564613 25241871  
jan 2008538302115158  3331 5062611103381   7762 489232001730578248439 23231671  
out 20075533111332810  332  475230102301332  8762 468431151674577232387 19191352  
jul 20076413601381941 4421 4452179423722  7641 4565303116365202233141181818102  
abr 2007616334140339  651  4031969127131   7643 400526061396471194285117161383  
jan 20076103391332481 2    374194841991   3332 364923681206339130153 1111105   
out 2006548303121204  22   264136561431   211  299019391052318117181 5543   
jul 2006588321128228212111 30514862194    1111 31832060108731410971 66321  
abr 2006519305128242       180793092         2404160784123983182 4421   
jan 2006485277118213       14871234          211313727081946882        
out 2005370222911641 11   9943143          14109595231384651 21     
jul 200537622194141       84321142         1253866466119341  21     
abr 200528817477225  11   8035921         86861433499343  332    
jan 20051901114992  111  39173           52736321559131  21     
out 20042113321  2221 21            3420112    2221   

 

Distribuição de edições de artigos por autores
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=AutoresEdições total
124372100.0%911683100.0%
31152847.3%89128797.8%
10670327.5%86301194.7%
32307412.6%79978087.7%
10012765.2%69931176.7%
3164762.0%56132461.6%
10001350.6%37750941.4%
3162290.1%20077222.0%
1000040.0%749198.2%

 

50 autores recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesPrimeira edição
ArtigosOutros
 posiçãoúltimos
30 dias
totaltotalúltimos
30 dias
datadias
atrás
agoraΔ
CommonsDelinker1 06592450652775552fev 11, 2007931
Orchi2 09942317221729681jan 08, 20051695
G.dallorto3 038164682012731242nov 01, 20051398
Ies4 03810773801752619out 15, 20061050
Liné16 01189780373301123out 31, 20061034
MPF9 03696020316823098out 28, 20041767
Franz_Xaver10 06354754785118dez 02, 20041732
Gryffindor12 010532752427199ago 10, 20051481
Kilom69113+1685235908977372mai 06, 20061212
Ltshears14-14522016397107mai 10, 20061208
WayneRay15 0246382250796abr 18, 20061230
Ayacop17 014465928352fev 27, 20061280
Stan_Shebs19+189407515810343out 29, 20041766
GeorgHH21 022379145694308abr 30, 20061218
Olei22+318035897981695jun 28, 20051524
Morio23-133584351565dez 22, 20051347
Man_vyi25-1243437724972796mai 22, 20051561
Mefusbren6926+321433843916283dez 17, 2008256
Kersti_Nebelsiek28-163333410381536jan 10, 2007963
Deadstar29-13317322343560out 13, 20051417
KENPEI33+13028089962301mai 30, 20051553
Denniss34-14278421793585fev 28, 20051644
Fagairolles_3437+1222712726823dez 23, 2006981
Mattes39 0202648697371301mai 10, 20051573
AndreasPraefcke41 07262367517706jan 27, 20051676
Rocket00042 0182617501971406mai 12, 20061206
Selso43+1624899289433mar 24, 20061255
Twice2545 072465811126dez 18, 20041716
Gugganij46 052382312620nov 29, 20041735
Fanghong48 022348661614nov 22, 20041742
Wsiegmund49+17923349699475set 23, 20051437
Rasbak51 0322280592963dez 27, 20041707
Winterkind52+591226011534551out 09, 2007691
Epibase53+13922453749302nov 22, 20061012
BotBln55-252232533412fev 13, 20051659
Midgrid56-1322228159021dez 07, 2006997
Maarten_Sepp57-14217839147nov 24, 2007645
Foroa61+1392053269471763fev 12, 2007930
Olivier262-13203230819714jan 17, 20061321
Havang(nl)63 0181923232873040ago 22, 2007739
Vincent_Steenberg64+52211916149761057dez 28, 2007611
Johann_Jaritz65+216819135505221jul 02, 2007790
Sailko69-14171648660920mai 20, 20061198
TeunSpaans74 031618340013set 11, 20041814
Infrogmation78 0815151048602195nov 12, 20041752
Jeffdelonge79 011505259224nov 01, 20041763
Aaker80 01215016166nov 19, 20061015
Caronna81 0114746703fev 12, 20051660
Mbdortmund82 01141837823843jul 13, 20061144
Wst85 02137458237299nov 16, 20061018

 

20 autores recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesPrimeira ediçãoúltima edição
 posiçãototaldatadias
atrás
datadias
atrás
Mac959894ago 09, 20051482ago 27, 2008368
Electionworld78937set 13, 20061082jul 22, 2007770
Emijrp87362jun 20, 20051532jul 13, 200948
Saperaud115361mar 06, 20051638jul 27, 2007765
Mutter_Erde164589ago 23, 20061103dez 21, 2008252
Sarefo184390abr 17, 20061231jul 10, 200951
Väsk204002out 07, 20041788mar 23, 2009160
Lmbuga243449set 03, 20051457jul 05, 200956
BLueFiSH.as273342abr 12, 20051601dez 23, 2008250
Kelson303088out 31, 20041764nov 22, 2008281
Schaengel89312982fev 15, 20051657jul 14, 2008412
Arne_List322870nov 12, 20041752mai 08, 2009114
JJ55352721mar 02, 2007912dez 14, 2008259
Factumquintus362715dez 15, 20041719mai 03, 2009119
Nemo5576382709abr 14, 20051599mai 22, 2009100
EugeneZelenko402627nov 13, 20041751mai 11, 2009111
JoJan442484jan 18, 20051685jun 22, 200969
BerndH472372dez 24, 20041710out 01, 2008333
Juiced_lemon502329jul 14, 20061143dez 06, 2007633
Jcornelius542242nov 20, 20041744jun 05, 200986

 

usuários anônimos, ordenados por número de contribuições
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
200.40.88.1821047
136.242.18.51663
125.2.215.21649
68.113.70.51410
65.199.61.101380
83.211.11.183350
88.73.144.187304
86.63.131.48300
24.57.196.130286
208.81.184.4280

No total 80.540 edições foram feitas por usuários anônimos, de um total de 1118.700 edições ( 7e %)
  


40 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesPrimeira ediçãoúltima edição
 posiçãototaldatadias
atrás
datadias
atrás
Emijrpbot189997ago 20, 20061106jun 21, 200970
SieBot213712dez 23, 2006981ago 31, 2009 
DavepapeBot36313fev 27, 2007915mar 27, 2008521
MakBot43658jul 10, 20061147jul 31, 20061126
Robbot52866set 16, 20041809jul 07, 2007785
タチコマ_robot62384jun 15, 2007807jul 08, 2008418
Topjabot72239out 26, 20041769out 30, 20041765
Orgullobot81030fev 17, 20061290abr 16, 2007867
EuseBot9721mai 19, 2009103jul 24, 200937
Tsca.bot10613nov 06, 20041758abr 11, 2007872
BotMultichill11301mar 06, 2008542ago 05, 200925
OdderBot12265jan 21, 2007952mar 07, 2009176
VICbot13189jun 15, 2008441ago 31, 2009 
JarektBot14171mar 19, 2009164jul 22, 200939
Polbot15158jan 15, 2008593jan 30, 2008578
Sz-iwbot16107abr 03, 2008514jun 29, 200962
KanonBot17107out 04, 2008330jan 09, 2009233
BotMultichillT1892nov 04, 2008299nov 04, 2008299
RussBot1983ago 26, 2008369ago 20, 200910
Slobot2070abr 08, 2009144abr 30, 2009122
RocketBot2159abr 12, 2008505ago 21, 2008374
O_(bot)2255abr 02, 2007881set 13, 2008351
Category-bot2336fev 13, 2007929ago 01, 200929
MarcBot2436mar 30, 2007884out 26, 2007674
Filbot2511out 17, 2007683out 19, 2007681
ABFbot2610fev 02, 2008575jan 07, 2009235
AbiBot2710fev 28, 2009183fev 28, 2009183
DschwenBot289ago 30, 2008365ago 30, 2008365
ButkoBot298out 15, 2008319nov 27, 2008276
File_Upload_Bot_(Eloquence)304mai 18, 20051565mai 20, 20051563
YonaBot312mar 25, 2007889abr 30, 2007853
Maelgwnbot322set 25, 2007705set 25, 2007705
Un1c0s_bot331mar 12, 20061267mar 12, 20061267
AdambroBot341dez 06, 2007633dez 06, 2007633
Ptbotgourou351jan 19, 2008589jan 19, 2008589
Larbot361abr 14, 2008503abr 14, 2008503
Moralists_Robot371nov 26, 2008277nov 26, 2008277
MinerBot381abr 16, 2009136abr 16, 2009136
MerlLinkBot391jun 16, 200975jun 16, 200975
BjornNbot401jul 04, 200957jul 04, 200957

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110DjvuGifJogJpgKmlMidOggOgvPdfPgPngSvgSxcSxdSxiSxwTestTifTiffXcf
ago 2009146 k67 k63 k5,0 M13 k65 k109709 k3,6 k     99%4,8 k98 k24,0 M831,2 k105 k5737,8 k1524 k274 k12552321732110143
jul 2009145 k65 k61 k4,8 M13 k62 k106682 k3,6 k     99%4,6 k96 k23,8 M831,2 k102 k5127,1 k1508 k267 k1255232156992140
jun 2009144 k64 k59 k4,7 M13 k59 k105653 k3,5 k     99%4,3 k94 k23,7 M831,1 k101 k4457,0 k1488 k260 k1255232145077135
mai 2009139 k61 k57 k4,5 M13 k58 k97623 k3,5 k     99%3,8 k93 k23,6 M831,1 k100 k3546,8 k 456 k255 k1255232137044131
abr 2009138 k60 k54 k4,4 M13 k56 k93593 k3,4 k     99%3,6 k92 k23,5 M821,1 k98 k2956,7 k 447 k249 k1255232126724127
mar 2009136 k58 k51 k4,2 M13 k55 k87568 k3,3 k     99%3,2 k90 k23,3 M761,1 k97 k2736,4 k 439 k244 k1255232113413123
jul 2009145 k65 k61 k4,8 M13 k62 k106682 k3,6 k     99%4,6 k96 k23,8 M831,2 k102 k5127,1 k1508 k267 k1255232156992140
abr 2009138 k60 k54 k4,4 M13 k56 k93593 k3,4 k     99%3,6 k92 k23,5 M821,1 k98 k2956,7 k 447 k249 k1255232126724127
jan 2009133 k56 k47 k3,8 M12 k52 k80504 k3,2 k     99%2,8 k86 k13,0 M691,1 k95 k1426,0 k 421 k217 k12552321  111
out 2008127 k51 k40 k3,4 M11 k48 k74422 k3,0 k     99%2,1 k81 k12,6 M631,0 k93 k372,5 k 396 k201 k12552321  101
jul 2008121 k46 k34 k3,0 M11 k43 k68350 k2,8 k     99%1,7 k74 k12,3 M2493166 k 1,9 k 373 k184 k12552321  83
abr 2008115 k42 k28 k2,7 M3,7 k39 k61297 k2,7 k     99%1,0 k67 k 2,0 M1888764 k 1,7 k 343 k167 k12552321  70
jan 2008109 k37 k23 k2,3 M3,3 k36 k52248 k2,5 k     99%91947 k 1,8 M1886661 k 1,3 k 315 k144 k12552321  57
out 2007100 k33 k18 k2,0 M3,1 k32 k45206 k2,3 k     99%72936 k 1,5 M1783343 k 1,1 k 291 k125 k1149231   55
jul 200792 k28 k14 k1,6 M2,8 k29 k42165 k2,1 k     99%14232 k 1,2 M678637 k 934 265 k97 k1047122   54
abr 200783 k24 k11 k1,3 M2,5 k26 k40123 k1,9 k     99%9328 k 963 k 74929 k 721 221 k82 k939119   52
jan 200773 k20 k7,9 k1,0 M1,5 k22 k3296 k1,8 k     98%4921 k 745 k 68924 k 478 182 k67 k831116   47
out 200665 k16 k5,5 k854 k1,5 k19 k2872 k1,7 k     98%318 k 608 k 55122 k 337 154 k51 k730113   39
jul 200648 k13 k3,4 k640 k1,1 k17 k2753 k1,7 k     98%113 k 447 k 33519 k 244 126 k34 k527110   35
abr 200638 k9,9 k2,4 k471 k89613 k2536 k1,6 k     97% 9,4 k 322 k 29118 k 184 101 k20 k52619   32
jan 200632 k7,4 k1,9 k334 k74711 k2526 k1,4 k     97% 5,6 k 234 k 18814 k 121 74 k5,6 k42614   27
out 200525 k5,4 k1,5 k239 k6858,1 k2218 k1,3 k     97% 3,6 k 168 k 10413 k 77 53 k1,7 k32414   24
jul 200518 k3,7 k1,0 k142 k6235,6 k1812 k1,2 k     97% 2,3 k 101 k 9111 k 47 27 k 217 1   13
abr 200511 k2,2 k49569 k4873,3 k67,0 k      96% 1,1 k 46 k 697,2 k 21 14 k 214     6
jan 20057,1 k1,1 k23027 k2481,6 k43,6 k      93% 286 20 k 122,1 k 6 4,9 k 114     4
out 20042,6 k119265,8 k2382386      77% 8 5,6 k  112   106         

 

50 most edited articles (> 25 edits)  More..
 

EdiçõesUnique usersArtigosArchived
TotalReg.Reg.Unreg.
4182499%762122Commons:Quality images candidates/candidate list1895.5 Mb  
3858696%2695903Commons:Village pump5997.0 Mb  
22017100%165 User:CommonsDelinker/commands30.9 Mb  
1966896%1679427Commons:Deletion requests/Current requests4057.1 Mb  
18376100%101Template:Toolserver46.9 Mb  
1166397%1846229Commons:Featured picture candidates/candidate list56.2 Mb  
1106494%2128461Commons:Help desk544.5 Mb  
985698%893134Commons:Administrators' noticeboard795.3 Mb  
831793%1013383Commons:Undeletion requests/Current requests526.4 Mb  
771898%933111Commons talk:Licensing606.0 Mb  
708996%549161Commons:Forum445.3 Mb  
6587100%2 User:Lar/CategoryWatch1300.7 Mb  
609198%1219103User talk:Siebrand211.1 Mb  
602798%62981Commons:Bistro425.7 Mb  
5537100%5 Commons:Discussion index142.9 Mb  
5335100%111User:Sz-iwbot/tineye120.2 Mb  
499097%42747Commons:Administrators' noticeboard/User problems243.7 Mb  
4814100%5 Commons:Administrators' discussion index108.1 Mb  
381195%860152Commons:Café301.6 Mb  
368298%80257Commons:Changing username/Current requests24.1 Mb  
3602100%102User:Filbot/Report37.3 Mb  
3588100%121User:Bayo/Newpages CVG Commons48.0 Mb  
351699%21824User talk:CommonsDelinker/commands12.5 Mb  
342695%50178Commons:Administrators' noticeboard/Attention146.7 Mb  
312999%13420Commons:Quality images candidates71.3 Mb  
3046100%3 User:Giggy/CatWatch20.6 Mb  
2897100%2 User:Bryan/DiscussionIndex45.7 Mb  
282198%66955User talk:EugeneZelenko148.2 Mb  
2802100%3 User:Herbythyme/Talk stuff100.1 Mb  
264299%23924User talk:Lupo198.7 Mb  
2623100%475Commons:Quality images/Recently promoted3.7 Mb  
262099%52128User talk:Multichill103.1 Mb  
260899%26414User talk:Rocket000176.8 Mb  
2543100%3 User:GeorgHH/CategoryWatch/Dupes21.8 Mb  
252099%21820Commons talk:Featured picture candidates239.1 Mb  
245896%57864User talk:Bryan30.5 Mb  
244098%26846User talk:File Upload Bot (Magnus Manske)133.3 Mb  
241496%16764Commons:Featured pictures, list11.9 Mb  
234698%31734User talk:MichaelMaggs85.9 Mb  
224597%39953User talk:Polarlys28.9 Mb  
2178100%5 User:FlickreviewR/Images never editted by their reviewer-1411.9 Mb  
215594%341101Commons:Bar italiano87.0 Mb  
211095%37067User talk:Herbythyme44.9 Mb  
210195%32467User talk:PatríciaR38.4 Mb  
203299%20313User talk:Dschwen116.3 Mb  
200997%33940Commons:Deletion requests57.0 Mb  
1934100%1947Commons:Valued image candidates/candidate list3.5 Mb  
192298%39324User talk:Pfctdayelise56.7 Mb  
189299%50515Commons:Requests and votes4.8 Mb  
1851100%48 User:Orgullobot/commands2.3 Mb  

 

ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

set 2004: 1 16 Main Page , 2 4 Strona główna , 3 4 Railway station , 4 3 メインページ , 5 3 Rulers of Poland , 6 3 Rhine , 7 3 Windmill , 8 3 Cyprinus carpio , 9 3 Lighthouse , 10 3 Beach , 11 3 Butterfly , 12 3 Sushi , 13 3 Vulpes vulpes , 14 3 Maps of the Netherlands , 15 3 Ovis aries , 16 3 Bangkok subway system , 17 3 Groningen , 18 3 Callipepla gambelii , 19 2 Larus , 20 2 Castle , 21 2 Church , 22 2 Buurser zand , 23 2 Malbork , 24 2 Lønstrup , 25 2 Border

out 2004: 1 8 Main Page , 2 5 Accueil , 3 3 Aesculus hippocastanum , 4 3 Coffee , 5 3 Lund , 6 3 Huvudsida , 7 3 メインページ , 8 3 Strona główna , 9 3 Gentiana , 10 3 Ovis aries , 11 2 中国 , 12 2 Aptenia cordifolia , 13 2 Pierre Méchain , 14 2 Zollikon , 15 2 Ioannes Paulus II , 16 2 Калининград , 17 2 Chinese dragon , 18 2 Silene flos-cuculi , 19 2 Ulmus minor , 20 2 Celtis australis , 21 2 Atropa belladonna , 22 2 Rosa cultivars , 23 2 Nice , 24 2 Roquebillière , 25 2 Tourrettes-sur-Loup

nov 2004: 1 26 Main Page , 2 12 Hauptseite , 3 12 Church , 4 10 Castle , 5 8 National insignia , 6 8 Frankfurt am Main , 7 8 Wikimedia , 8 8 Trichechus , 9 8 Vincent van Gogh , 10 7 Accueil , 11 7 Tree , 12 7 København , 13 7 Strona główna , 14 6 World War II , 15 6 Forside , 16 6 San Francisco , 17 6 Заглавная страница , 18 6 Lisboa , 19 6 Portada , 20 6 Paris , 21 6 Signs , 22 6 Felis silvestris catus , 23 6 Elephas , 24 6 Україна , 25 5 Temple

dez 2004: 1 18 Main Page , 2 17 2004 Indian Ocean earthquake , 3 13 Christmas , 4 9 National insignia , 5 9 Venezia , 6 9 日本 , 7 9 Bridge , 8 9 Railway station , 9 7 France , 10 7 Hauptseite , 11 7 Accueil , 12 6 Beer , 13 6 Maps of Germany , 14 6 Wikimedia , 15 6 Maps of Korea , 16 6 Castle , 17 6 Paris , 18 6 Lighthouse , 19 5 Rio de Janeiro , 20 5 Locomotive , 21 5 Página principal , 22 5 Euphorbia pulcherrima , 23 5 名古屋 , 24 5 Pisa , 25 5 Magdeburg

jan 2005: 1 14 Main Page , 2 12 Praha , 3 12 Roma , 4 11 Railway station , 5 9 2004 Indian Ocean earthquake , 6 9 Wikimedia , 7 9 Berlin , 8 8 Ship , 9 7 Alexander the Great , 10 7 Página principal , 11 7 Maps of Germany , 12 7 Church , 13 7 Tram , 14 7 Cologne , 15 6 Madrid , 16 6 Dresden , 17 6 Automobile , 18 6 Paris , 19 6 Bridge , 20 5 Museo del Prado , 21 5 Roller coaster , 22 5 Bicycle , 23 5 Motorcycle , 24 5 Oslo , 25 5 Temple

fev 2005: 1 10 Main Page , 2 9 National insignia , 3 9 Wikimedia , 4 8 Berlin , 5 7 World War II , 6 7 Castle , 7 6 Praha , 8 6 Frankfurt am Main , 9 6 Automobile , 10 6 Cologne , 11 6 Beach , 12 6 Bridge , 13 5 Wind generator , 14 5 Bicycle , 15 5 Traffic sign , 16 5 Pagina principale , 17 5 Coffee , 18 5 Paris , 19 5 京都市 , 20 4 Yellowstone National Park , 21 4 Rammstein , 22 4 Knossos , 23 4 New York City Subway , 24 4 Johannes Vermeer , 25 4 Versailles

mar 2005: 1 18 Main Page , 2 10 Tank , 3 10 Castle , 4 10 Paris , 5 9 National insignia , 6 9 Automobile , 7 7 Berlin , 8 6 Lyon , 9 6 香港 , 10 6 Praha , 11 6 Frankfurt am Main , 12 6 New York City , 13 6 Cologne , 14 5 Yellowstone National Park , 15 5 Library , 16 5 Chicago , 17 5 Ireland - Éire , 18 5 Wikimedia , 19 5 Coffee , 20 5 Cheese , 21 5 Rapid transit , 22 5 Church , 23 4 Somateria mollissima , 24 4 Nicaragua , 25 4 Mainz

abr 2005: 1 29 Ioannes Paulus II , 2 23 Benedictus XVI , 3 16 National insignia , 4 16 Main Page , 5 11 Automobile , 6 11 Bridge , 7 9 World War II , 8 9 Tank , 9 9 Church , 10 9 Berlin , 11 8 Stockholm , 12 8 Louvre , 13 8 Castle , 14 7 Erwin Rommel , 15 7 Euro , 16 7 Сергей Михайлович Прокудин-Горский , 17 7 Cathédrale Notre-Dame de Paris , 18 7 Praha , 19 7 Scavi archeologici di Pompei , 20 7 Paris , 21 7 Buddha , 22 7 Current events/2005 , 23 7 London , 24 6 Gian Lorenzo Bernini , 25 6 Airbus A380

mai 2005: 1 20 Main Page , 2 12 Berlin , 3 10 Automobile , 4 9 Albrecht Dürer , 5 9 Tokyo , 6 9 Felis silvestris catus , 7 9 Bridge , 8 8 Praha , 9 8 Wikimedia , 10 8 New York City , 11 8 Taraxacum , 12 8 Church , 13 8 Tram , 14 8 London , 15 7 Benedictus XVI , 16 7 Wien , 17 7 National insignia , 18 7 Tree , 19 6 Jean Auguste Dominique Ingres , 20 6 Valladolid , 21 6 France , 22 6 Frankfurt am Main , 23 6 San Francisco , 24 6 Anemone nemorosa , 25 6 Water

jun 2005: 1 27 Main Page , 2 12 National insignia , 3 11 Castle , 4 10 Church , 5 10 Current events/2005 , 6 10 Berlin , 7 9 Bridge , 8 8 Boeing 737 , 9 8 Budapest , 10 8 Wikimedia , 11 8 Automobile , 12 8 Rapid transit , 13 8 Butterfly , 14 8 London , 15 7 Stockholm , 16 7 日本 , 17 6 Berlin 05 , 18 6 毛泽东 , 19 6 Wien , 20 6 Araneae , 21 6 MTR Hong Kong , 22 6 Helsinki , 23 6 Wrocław , 24 6 Warszawa , 25 6 Flaggen Deutschlands

jul 2005: 1 12 George W. Bush , 2 10 Deep Impact (space mission) , 3 10 London , 4 9 Churches in Europe , 5 9 Tram - Europe , 6 8 Praha , 7 8 Bridge , 8 7 Dresden , 9 7 National insignia , 10 7 Frankfurt am Main , 11 7 Panthera tigris , 12 6 Hot air balloon , 13 6 Araneae , 14 6 Selected Swedish churches , 15 6 London Underground , 16 6 Canis lupus , 17 6 Wikimedia , 18 6 Lance Armstrong , 19 6 Castle , 20 6 Cloud , 21 6 Berlin , 22 6 Napoléon Bonaparte , 23 6 Railway station , 24 5 Penis , 25 5 Tour de France

ago 2005: 1 10 Wikimania 2005 Presentations , 2 10 Tram - Europe , 3 9 Владимир Ильич Ленин , 4 9 Frankfurt am Main , 5 9 Railway station , 6 8 Churches in Europe , 7 7 All religious buildings in Denmark , 8 7 Wien , 9 7 Fire engine , 10 7 Adolf Hitler , 11 7 Europe - Europa , 12 7 中国 , 13 7 Anisoptera , 14 7 Cologne , 15 7 Bridge , 16 7 London , 17 7 Berlin , 18 6 Wikimania 2005 Impressions , 19 6 Theatre buildings , 20 6 Venezia , 21 6 Москва , 22 6 Castle , 23 5 Vincenz Statz , 24 5 Little Boy , 25 5 Gymnogyps californianus

set 2005: 1 11 Paris , 2 9 Felis silvestris catus , 3 8 London , 4 7 Frankfurt am Main , 5 7 Berlin , 6 6 Tag des offenen Denkmals 2005 , 7 6 All religious buildings in Denmark , 8 6 Dresden , 9 6 Roma , 10 5 Penis , 11 5 Train/Poland , 12 5 Tram - Europe , 13 5 Colosseum , 14 5 Berlin-Mitte , 15 5 Madrid , 16 5 France , 17 5 Helsinki , 18 5 Praha , 19 5 National insignia , 20 5 Tank , 21 5 Beach , 22 5 Butterfly , 23 5 Main Page , 24 4 Mosquito , 25 4 Albinism

out 2005: 1 12 National insignia , 2 11 London , 3 8 Tram - Europe , 4 7 Valencia (capital) , 5 7 Canis lupus , 6 7 Bridge , 7 7 Berlin , 8 6 Chiese di Roma , 9 6 Озеро Байкал , 10 6 Churches in Europe , 11 6 Forum Romanum , 12 6 Wrocław , 13 5 2005 Atlantic hurricane season , 14 5 London Underground , 15 5 Türkiye , 16 5 Praha , 17 5 Roma , 18 5 Venezia , 19 5 Tank , 20 5 Helianthus annuus , 21 5 Elections , 22 5 Napoléon Bonaparte , 23 4 Penis , 24 4 Uma Thurman , 25 4 Calliteara pudibunda

nov 2005: 1 11 Paris suburb riots , 2 9 National insignia , 3 8 Penis , 4 6 Chiese di Roma , 5 6 México , 6 6 Rapid transit , 7 5 Castel Sant'Angelo (Rome) , 8 5 Tram - Europe , 9 5 Boeing 777 , 10 5 Australia , 11 5 Frankfurt am Main , 12 5 Hauptseite , 13 5 Paris , 14 5 Felis silvestris catus , 15 5 George W. Bush , 16 5 Moon , 17 5 Bus , 18 4 Il Gesù (Roma) , 19 4 Fountains of Rome , 20 4 Santiago Metro , 21 4 Gian Lorenzo Bernini , 22 4 Epipactis palustris , 23 4 Valencia (capital) , 24 4 Sunset , 25 4 Adolf Hitler

dez 2005: 1 17 National insignia , 2 15 Christmas , 3 9 Christmas tree , 4 9 Berlin-Mitte , 5 8 Frankfurt am Main , 6 8 Felis silvestris catus , 7 8 Berlin , 8 7 Penis , 9 7 Sunset , 10 7 Roma , 11 6 Polish Wikimedia Meetup - December 2005 , 12 6 Maps of Berlin , 13 6 Chiese di Roma , 14 6 Tram - Europe , 15 6 Fire engine , 16 6 München , 17 6 Cathedrals , 18 6 Tokyo , 19 6 Venezia , 20 6 Florence , 21 6 Lighthouse , 22 6 Beach , 23 6 Bridge , 24 5 WTO Ministerial Conference of 2005 , 25 5 Amalfi

jan 2006: 1 11 Berlin , 2 9 Penis , 3 8 Roma , 4 8 Felis silvestris catus , 5 7 Churches in Europe , 6 7 Berlin-Mitte , 7 7 Traffic sign , 8 7 National insignia , 9 7 Fire , 10 7 Ísland , 11 7 Rapid transit , 12 6 Landwehrkanal , 13 6 Forum Romanum , 14 6 Basilica di San Pietro , 15 6 Helsinki , 16 6 Tour Eiffel , 17 6 Frankfurt am Main , 18 6 New York City , 19 6 Gdańsk , 20 6 George W. Bush , 21 5 Luisenstädtischer Kanal , 22 5 Coldplay , 23 5 Verwaltungsgliederung Deutschlands , 24 5 Chiese di Roma , 25 5 Budapest Metro

fev 2006: 1 13 National insignia , 2 10 2006 Winter Olympics , 3 8 Bridge , 4 7 Adolf Hitler , 5 7 Castle , 6 6 School , 7 6 Angelina Jolie , 8 6 Buenos Aires , 9 6 Wrocław , 10 6 Main Page , 11 5 Anacyclus clavatus , 12 5 H5N1 , 13 5 FIFA World Cup Germany 2006 , 14 5 Unter den Linden , 15 5 Etna , 16 5 Turin , 17 5 Tram - Europe , 18 5 City hall , 19 5 颐和园 , 20 5 Swastika , 21 5 上海 , 22 5 Maps of Hong Kong , 23 5 Dortmund , 24 5 Kyiv , 25 5 Milano

mar 2006: 1 10 Dresden , 2 9 Penis , 3 9 Venezia , 4 9 Berlin , 5 9 Napoléon Bonaparte , 6 8 Unter den Linden , 7 8 National insignia , 8 8 World War II , 9 7 Tram - Europe , 10 7 Reichstagsgebäude , 11 7 Praha , 12 7 Bridge , 13 6 Pronunciation of Dutch municipality names , 14 6 Landwehrkanal , 15 6 Theatre buildings , 16 6 Plants misidentified , 17 6 Adolf Hitler , 18 6 Dolmen , 19 5 Berliner Dom , 20 5 محمد بن عبد الله , 21 5 Michelle Bachelet , 22 5 Barnstar , 23 5 Allium cepa , 24 5 Homosexuality , 25 5 Berlin-Kreuzberg

abr 2006: 1 8 Beer , 2 8 Boeing 737 , 3 8 Anemone nemorosa , 4 7 Tram - Europe , 5 7 Bicycle , 6 7 Venezia , 7 7 Accueil , 8 7 Rapid transit , 9 6 Easter , 10 6 Stuttgart , 11 6 Anas platyrhynchos , 12 6 Roma , 13 6 Florence , 14 6 Lamium purpureum , 15 5 Maps of Berlin , 16 5 Veronica persica , 17 5 Churches in Europe , 18 5 Genova , 19 5 Perú , 20 5 Danube , 21 5 Basilica di San Pietro , 22 5 Brandenburger Tor , 23 5 Italia , 24 5 Milano , 25 5 Leipzig

mai 2006: 1 12 FIFA World Cup Germany 2006 , 2 9 Berlin Hauptbahnhof , 3 8 Lordi , 4 8 Benedictus XVI , 5 8 National insignia , 6 8 Primula veris , 7 8 Fagus sylvatica , 8 7 Airbus A380 , 9 7 Boeing 737 , 10 7 Turdus merula , 11 7 Taraxacum sect. Ruderalia , 12 7 Felis silvestris catus , 13 6 Penis , 14 6 Wikiraduno Bologna 2006 , 15 6 Црна Гора / Crna Gora , 16 6 Rzeszów , 17 6 Parus major , 18 6 Tulipa cultivars , 19 6 Roma , 20 6 Москва , 21 6 Wikipedia , 22 6 Tank , 23 6 Ioannes Paulus II , 24 6 Pyrus communis , 25 6 Cannabis sativa

jun 2006: 1 23 FIFA World Cup Germany 2006 , 2 14 FIFA World Cup Germany 2006 matches , 3 10 National insignia , 4 7 Mars , 5 7 Roma , 6 6 Olympiastadion Berlin , 7 6 Armillary sphere , 8 6 T-34 , 9 6 Hamburg , 10 6 İstanbul , 11 6 Boeing 737 , 12 6 München , 13 6 Flaggen Deutschlands , 14 6 Praha , 15 6 Florence , 16 6 Wikipedia , 17 6 Ioannes Paulus II , 18 6 Accueil , 19 6 Rapid transit , 20 6 Bridge , 21 5 Kärnten - Koróška , 22 5 Plough , 23 5 Crystal Clear , 24 5 Santa Maria del Fiore (Florence) , 25 5 Ponte Vecchio

jul 2006: 1 11 All religious buildings in Denmark , 2 10 National insignia , 3 9 FIFA World Cup Germany 2006 , 4 7 Penis , 5 7 STS-121 , 6 7 Tram - Europe , 7 7 Water tower , 8 6 Turin , 9 6 Chiese di Roma , 10 6 Alcea rosea , 11 6 Türkiye , 12 6 Italia , 13 6 Adolf Hitler , 14 6 Scavi archeologici di Pompei , 15 6 Fagus sylvatica , 16 6 Rapid transit , 17 6 Cologne , 18 6 Moon , 19 5 Rīga , 20 5 Ubuntu (operating system) , 21 5 Aeshna cyanea , 22 5 Aglais urticae , 23 5 Polygonia c-album , 24 5 H-3 Sea King , 25 5 Aphidoidea

ago 2006: 1 9 2006 Israel-Lebanon conflict , 2 8 F/A-18 Hornet , 3 7 STS-115 , 4 7 Ubuntu (operating system) , 5 7 Wien , 6 6 Chiese di Roma , 7 6 Caterpillar , 8 6 Macroglossum stellatarum , 9 6 Perú , 10 6 Blasons de France , 11 6 Lilium , 12 6 Tour Eiffel , 13 6 Praha , 14 6 Roma , 15 6 National insignia , 16 6 Centaurea cyanus , 17 6 Albert Einstein , 18 6 Rainbow , 19 5 5,56x45mm , 20 5 Velociraptor , 21 5 Zodiac , 22 5 School , 23 5 Tram - Europe , 24 5 Marie Antoinette von Habsburg-Lothringen , 25 5 Assisi

set 2006: 1 12 Steve Irwin , 2 9 Penis , 3 9 Roma , 4 8 STS-115 , 5 8 Polska , 6 7 Türkiye , 7 7 Wolfgang Amadeus Mozart , 8 7 Madrid , 9 6 Talitrus saltator , 10 6 All religious buildings in Denmark , 11 6 Wien , 12 6 Boeing 777 , 13 6 Dublin - Baile Átha Cliath , 14 6 Warszawa , 15 6 Cathedrals , 16 6 Venezia , 17 5 5th birthday of Polish Wikipedia , 18 5 Tag des offenen Denkmals 2006 , 19 5 2006 Israel-Lebanon conflict , 20 5 Haliaeetus pelagicus , 21 5 Police cars by country , 22 5 Ponte Vecchio , 23 5 Zeughaus (Berlin) , 24 5 Chiese di Roma , 25 5 Macrolepiota procera

out 2006: 1 20 Wikimedia logo mosaic , 2 14 Wikimedia logo mosaic/ConstructionNotes , 3 8 George W. Bush , 4 8 Equus caballus , 5 7 Hungarian Revolution of 1956 , 6 7 Panthera leo , 7 6 Warszawa , 8 6 Praha , 9 6 Christopher Columbus , 10 6 メインページ , 11 5 Metallica , 12 5 2006 North Korean nuclear test , 13 5 Tram – types , 14 5 All religious buildings in Denmark , 15 5 Inachis io , 16 5 Coprinus comatus , 17 5 Florence , 18 5 Polska , 19 5 Rapid transit , 20 4 Audrey Hepburn , 21 4 Kaniska canace , 22 4 Christina Aguilera , 23 4 Eye of Providence , 24 4 Kölner Dom , 25 4 Perugia

nov 2006: 1 32 Wikimedia logo mosaic , 2 22 Wikimedia logo mosaic/ConstructionNotes , 3 11 Adolf Hitler , 4 9 Main Page , 5 8 Venezia , 6 7 Ciconia ciconia , 7 7 Roma , 8 6 Greg Williams , 9 6 Police cars by country , 10 6 Genova , 11 6 Felis silvestris catus , 12 5 Penis , 13 5 Nancy Pelosi , 14 5 Aeshna juncea , 15 5 Diospyros kaki , 16 5 Villa Adriana , 17 5 Tram - Europe , 18 5 Wikistress , 19 5 Karlův most , 20 5 Delta (rocket) , 21 5 Bucureşti , 22 5 Praha , 23 5 Scavi archeologici di Pompei , 24 5 Acer japonicum , 25 5 London

dez 2006: 1 11 STS-116 , 2 8 Polish Wikimedia Meetup - December 2006 , 3 8 صدام حسين , 4 7 List of dog breeds , 5 7 Deutscher Schäferhund , 6 7 Praha , 7 7 International Space Station , 8 7 Christmas , 9 6 Prague Metro , 10 5 Wikimedia logo mosaic/ConstructionNotes , 11 5 Police cars by country , 12 5 Icicle , 13 5 Churches in Europe , 14 5 KC-135 Stratotanker , 15 5 Genova , 16 5 Hamburg , 17 5 Blasons de France , 18 5 Wrocław , 19 5 Venezia , 20 5 Felis silvestris catus , 21 4 Somali Civil War , 22 4 Poděbrady , 23 4 Stylidium , 24 4 Atlas of Somalia , 25 4 Atlas of Germany

jan 2007: 1 7 Valencia (capital) , 2 6 Messina , 3 6 Pope , 4 6 European Union , 5 6 National insignia , 6 6 Bridge , 7 6 George W. Bush , 8 5 Churches in Europe , 9 5 C-47 Skytrain , 10 5 F-86 Sabre , 11 5 Abraham Lincoln , 12 5 Canis lupus , 13 5 Snow , 14 5 Ice , 15 5 Confoederatio Helvetica , 16 5 Praha , 17 5 Traffic sign , 18 5 Canada , 19 5 Graz , 20 5 Cygnus olor , 21 5 Equus caballus , 22 4 List of dog breeds , 23 4 Chlamydoselachus anguineus , 24 4 Anti , 25 4 Fallopia sachalinensis

fev 2007: 1 14 Main Page , 2 6 Atlas of Poland , 3 6 Berliner Gedenktafel , 4 6 Messina , 5 6 São Paulo (city) , 6 6 Página principal , 7 6 National insignia , 8 6 Polska , 9 6 Pinus sylvestris , 10 6 Paris , 11 5 Anti logos , 12 5 Atlas of Ukraine , 13 5 Catania , 14 5 Zinc , 15 5 Walt Disney , 16 5 Ischnura elegans , 17 5 Pyrrhosoma nymphula , 18 5 Tram - Europe , 19 5 Michelle Bachelet , 20 5 B-2 Spirit , 21 5 Formula One , 22 5 Milano , 23 5 Praha , 24 5 Venezia , 25 5 Unidentified Opuntia

mar 2007: 1 13 Main Page , 2 9 Albert Einstein , 3 9 Felis silvestris catus , 4 8 Euro , 5 7 Anti logos , 6 7 Asteroid symbols , 7 7 Venezia , 8 7 Accueil , 9 6 Barnstar/Barnstars of National Merit , 10 6 Canis lupus , 11 6 Hoofdpagina , 12 6 Boeing 737 , 13 5 Atlas of Israel , 14 5 Atlas of Germany , 15 5 Berliner Gedenktafel , 16 5 François Bayrou , 17 5 Verwaltungsgliederung Deutschlands , 18 5 Chelus fimbriatus , 19 5 OpenOffice.org , 20 5 Thai Airways International , 21 5 Anthropoides virgo , 22 5 Flos , 23 5 UH-1 Huey , 24 5 Salamandra salamandra , 25 5 T-34

abr 2007: 1 10 Atlas , 2 10 Crystal Clear , 3 9 Taraxacum sect. Ruderalia , 4 8 List of 600px association football flags , 5 7 Tulipa , 6 7 Allium ursinum , 7 6 All religious buildings in Denmark , 8 6 Pisa , 9 6 F-16 Fighting Falcon , 10 6 Nicolas Sarkozy , 11 6 Venezia , 12 6 Main Page , 13 5 Arlette Laguiller , 14 5 SuperTux , 15 5 Galleria orobica , 16 5 Pica pica , 17 5 Yorkshire terrier , 18 5 Napoli , 19 5 Virginia Polytechnic Institute and State University , 20 5 José Bové , 21 5 Boeing 777 , 22 5 F-15 Eagle , 23 5 Turdus merula , 24 5 National insignia , 25 5 Ségolène Royal

mai 2007: 1 14 Polish Wikimedia Meetup - Konferencja Wikimedia Polska 2007 , 2 11 List of 600px association football flags , 3 8 List of dog breeds , 4 8 Sasha Grey , 5 6 Coats of arms of Swedish municipalities , 6 6 Pidgin (instant messaging client) , 7 6 Madrid , 8 6 Nicolas Sarkozy , 9 6 Convallaria majalis , 10 6 Lighthouse , 11 6 London , 12 5 Eurovision Song Contest 2007 , 13 5 50 Cent , 14 5 Miranda IM , 15 5 Libellula quadrimaculata , 16 5 Brassica napus , 17 5 All religious buildings in Denmark , 18 5 Churches in Europe , 19 5 City hall , 20 5 Franklin Delano Roosevelt , 21 5 Hamburg , 22 5 Airbus A380 , 23 5 Formula One , 24 5 Brugge , 25 5 Boeing 737

jun 2007: 1 10 STS-117 , 2 8 Hydrangea macrophylla , 3 7 List of 600px association football flags , 4 7 Köln , 5 7 Flos , 6 7 Papaver rhoeas , 7 6 City hall , 8 6 Berlin , 9 5 Do not enter sign , 10 5 SNCB Ligne 37 , 11 5 Stop sign , 12 5 Brie-Comte-Robert , 13 5 Verwaltungsgliederung Deutschlands , 14 5 Churches in Europe , 15 5 Bellis perennis , 16 5 Valladolid , 17 5 Wolfgang Amadeus Mozart , 18 5 Página principal , 19 5 Adolf Hitler , 20 5 Hippopotamus amphibius , 21 5 Wikimedia , 22 5 Fagus sylvatica , 23 5 Ginkgo biloba , 24 5 United States , 25 4 SNCB Reihe 62-79

jul 2007: 1 8 Ferrol , 2 7 List of 600px association football flags , 3 7 Inachis io , 4 7 España , 5 7 Buddleja davidii , 6 6 Crystal Clear , 7 5 Political flags , 8 5 Sasha Grey , 9 5 Atlas of Palestine and Palestinian territories , 10 5 MediaWiki edit toolbar , 11 5 Museum für Naturkunde (Berlin) , 12 5 Ubuntu (operating system) , 13 5 A Coruña , 14 5 Barnstar , 15 5 Taunus , 16 5 Solanum tuberosum , 17 5 Página principal , 18 5 ישראל - إسرائيل , 19 5 Hydrangea macrophylla , 20 5 Giraffa camelopardalis , 21 4 Flags of active autonomist and secessionist movements , 22 4 Moncton , 23 4 Rappenlochschlucht , 24 4 Abdullah of Saudi Arabia , 25 4 James Sowerby

ago 2007: 1 10 STS-118 , 2 9 Kaaba , 3 8 حجر أسود , 4 8 List of 600px association football flags , 5 8 Churches in Europe , 6 8 Página principal , 7 7 محمد بن عبد الله , 8 6 Crystal Clear , 9 6 Robert Baden-Powell , 10 6 Brasil , 11 6 Helianthus annuus , 12 5 Jessica Cutler , 13 5 Barnstar/Barnstars of National Merit , 14 5 Gwen Stefani , 15 5 McLaren , 16 5 International Space Station , 17 5 Fountain , 18 5 Giraffa camelopardalis , 19 5 Forest , 20 5 Airport , 21 5 Main Page , 22 4 Palazzata di Messina (Camillo Autore, Raffaele Leone, Giuseppe Samonà, Guido Viola) , 23 4 Andy Murray , 24 4 High School Musical , 25 4 Formula One car

set 2007: 1 12 List of 600px association football flags , 2 11 Main Page , 3 9 2007 Burmese anti-government protests , 4 7 Helianthus annuus , 5 6 SS-Aufseherin , 6 6 Western Australia , 7 6 Palazzata di Messina (Camillo Autore, Raffaele Leone, Giuseppe Samonà, Guido Viola) , 8 6 Tyler Faith , 9 5 Vincenz Statz , 10 5 Batya Gur , 11 5 Katharina Szelinski-Singer , 12 5 Palazzo dell'INA(Giuseppe Samonà) , 13 5 Atlas of Germany , 14 5 Araneus diadematus , 15 5 Gran Canaria , 16 5 Hawker Hunter , 17 5 Sunset , 18 5 Pinus sylvestris , 19 4 Fratelli Calvi , 20 4 Military coats of arms of the Italian Air Force , 21 4 La nuova cortina del porto di Messina (Luigi Borzì) , 22 4 Kelly Madison , 23 4 Beyoncé Knowles , 24 4 Flags of extinct states , 25 4 Flags of active autonomist and secessionist movements

out 2007: 1 9 California wildfires of October 2007 , 2 6 List of 600px association football flags , 3 6 STS-120 , 4 6 Falco peregrinus , 5 6 Castanea sativa , 6 5 Warsaw Uprising Insurgents , 7 5 City flags , 8 5 Crystal Clear , 9 5 Child , 10 5 National insignia , 11 5 Bondage , 12 5 Fagus sylvatica , 13 4 Lion of Palatinate in heraldry , 14 4 Гербы городов Донецкой области , 15 4 Sydney Architecture , 16 4 Atlas of Palestine , 17 4 Sasha Grey , 18 4 Ibi , 19 4 Strelasundquerung (Stralsund) , 20 4 Atlas of Europe , 21 4 Atlas of Africa , 22 4 Köln , 23 4 Cristina Fernández de Kirchner , 24 4 Galleria orobica/Mountains , 25 4 Coats of arms of Swedish municipalities

nov 2007: 1 9 National insignia , 2 8 España , 3 8 Fagus sylvatica , 4 7 Ginkgo biloba , 5 7 Felis silvestris catus , 6 6 List of 600px association football flags , 7 6 Carlos Latuff , 8 6 Crystal Clear , 9 5 Chrzest równikowy , 10 5 Linkin Park , 11 5 Sasha Grey , 12 5 Lewis Hamilton , 13 5 Star symbol , 14 5 Glock , 15 5 Paris Hilton , 16 5 Tram - Europe , 17 5 World War I , 18 5 Cygnus olor , 19 5 Moon , 20 4 ZBD97 , 21 4 Freiburg Tramway , 22 4 Пассажирский паровоз С.68 , 23 4 Porcupine Tree , 24 4 Opuntia monacantha , 25 4 Shiraz

dez 2007: 1 10 List of 600px association football flags , 2 6 Benazir Bhutto , 3 5 Flags of prefectures of Japan , 4 5 محمد بن عبد الله , 5 5 Euro , 6 5 Cathedrals , 7 5 Deutschland , 8 5 Venezia , 9 5 Felis silvestris catus , 10 5 Christmas , 11 5 Main Page , 12 4 Tajiks , 13 4 Ramon Cabrera , 14 4 Герби областей України , 15 4 Briana Banks , 16 4 Persons on German stamps , 17 4 Bolesławiec , 18 4 Johnny Depp , 19 4 Atlas of Poland , 20 4 Project Constellation , 21 4 Galleria orobica , 22 4 Siberian Husky , 23 4 London Underground stations M-Z , 24 4 Christmas tree , 25 4 Mantova

jan 2008: 1 11 Main Page , 2 9 Heath Ledger , 3 8 Página principal , 4 7 Atlas , 5 7 Buteo jamaicensis , 6 6 Brenda Song , 7 6 Harry Potter , 8 6 Fire engine , 9 5 List of 600px association football flags , 10 5 Brandenburger Tor , 11 5 Cathedrals , 12 5 Venezia , 13 5 Wikimedia , 14 5 Glacier , 15 5 Quercus robur , 16 5 Accueil , 17 5 Cygnus olor , 18 4 Vincenz Statz , 19 4 Tajiks , 20 4 Прапори областей України , 21 4 Pashtuns , 22 4 Formula One car , 23 4 City flags , 24 4 Horse breeds , 25 4 Nancy Reagan

fev 2008: 1 10 Main Page , 2 9 Kosova - Косово и Метохија , 3 7 List of 600px association football flags , 4 7 Србија , 5 7 National insignia , 6 6 Flags with animals , 7 6 Wikimedia logo mosaic , 8 6 STS-122 , 9 6 Citrus fruits , 10 6 Harry Potter , 11 5 Alte Synagoge (Marienburg) , 12 5 Alte Synagoge (Malbork) , 13 5 Geographical flags , 14 5 Página principal , 15 5 España , 16 5 Venezia , 17 5 Berlin Wall , 18 4 Eva Green , 19 4 Berlinale , 20 4 Burg Mägdeberg , 21 4 Constance Zimmer , 22 4 Franz Hanfstängl , 23 4 Katarina Witt , 24 4 Synagoge (Racibórz) , 25 4 Neue Synagoge (Ostrów Wielkopolski)

mar 2008: 1 10 Main Page , 2 9 Brenda Song , 3 7 Felis silvestris catus , 4 6 Kosova - Косово и Метохија , 5 6 Дмитрий Анатольевич Медведев , 6 6 Passport , 7 6 Carlos Latuff , 8 6 STS-123 , 9 6 Police cars by country , 10 6 Barnstar , 11 6 National insignia , 12 6 Ariel Sharon , 13 5 Lucy Lawless , 14 5 Србија , 15 5 Colosseum , 16 5 Mainz , 17 5 中国 , 18 4 Frank Schulenburg , 19 4 Egenbüttel , 20 4 Chimayo, New Mexico , 21 4 Puhl & Wagner , 22 4 Churches in Bavaria , 23 4 List of dog breeds , 24 4 Lit.Cologne , 25 4 List of 600px association football flags

abr 2008: 1 9 List of 600px association football flags , 2 7 Nudity , 3 6 Wikipedia , 4 6 Main Page , 5 5 Fernando Lugo , 6 5 Lucy Lawless , 7 5 Illustrated atlas of French and English heraldic terms , 8 5 Atlas , 9 5 Wikimedia logo mosaic , 10 5 Sunset , 11 5 Mars , 12 5 Tussilago farfara , 13 5 Fritillaria meleagris , 14 5 Felis silvestris catus , 15 4 Kosova - Косово и Метохија , 16 4 SV Dynamo , 17 4 Flags with stars , 18 4 Persons on German stamps , 19 4 Brenda Song , 20 4 Märkischer Kreis , 21 4 Protea cynaroides , 22 4 DTM , 23 4 Barnstar , 24 4 Benedictus XVI , 25 4 Mandelbrot set

mai 2008: 1 8 Wikipedia , 2 6 Maker Faire , 3 5 Eurovision Song Contest 2008 , 4 5 SV Dynamo , 5 5 City flags , 6 5 Haflinger , 7 5 Barack Obama , 8 5 Matthäus Merian , 9 5 Flos , 10 5 Tram - Europe , 11 5 Cistus salviifolius , 12 5 Ludwig van Beethoven , 13 5 European Union , 14 5 Cathedrals , 15 5 Dresden , 16 5 Paris , 17 4 Colegio Bosques de Gaia , 18 4 Allium paradoxum , 19 4 Skylines , 20 4 Human Imprint , 21 4 Renee O'Connor , 22 4 Geltow , 23 4 Time-related icons , 24 4 Illustrated atlas of French and English heraldic terms , 25 4 Homberg (Efze)

jun 2008: 1 6 List of 600px association football flags , 2 6 Mozilla Firefox , 3 6 España , 4 5 Salix sepulcralis , 5 5 Xena: Warrior Princess , 6 5 Margret Hofheinz-Döring , 7 5 Andy Lau , 8 5 Iris (Iridaceae) , 9 5 Trieste , 10 5 Parus caeruleus , 11 5 Procyon lotor , 12 5 Digitalis purpurea , 13 4 Robert Wilson Shufeldt , 14 4 Wikipedia Academy Berlin 2008 , 15 4 Krzysztof Kozłowski , 16 4 TCAR , 17 4 Shanghai (architecture images) , 18 4 Akihabara massacre , 19 4 Josef Pröll , 20 4 Memmingen , 21 4 Panthera pardus fusca , 22 4 Renee O'Connor , 23 4 Scheibler Armorial , 24 4 Sébastien Bourdais , 25 4 Lucy Lawless

jul 2008: 1 7 Genova , 2 6 Íngrid Betancourt , 3 5 Passport , 4 5 Flaggen Nazi-Deutschlands , 5 5 Ludwig van Beethoven , 6 5 Wrocław , 7 5 Wikipedia , 8 5 中国 , 9 4 Alexander-Newski-Gedächtniskirche , 10 4 Temple of Zeus in Olympia , 11 4 Miejski Dom Kultury w Zgorzelcu , 12 4 Brigitta Bulgari , 13 4 Brachychiton populneus , 14 4 Formula One car , 15 4 Naresuan University , 16 4 Lilium pyrenaicum , 17 4 List of 600px association football flags , 18 4 Berliner Gedenktafel , 19 4 Sori , 20 4 Dawn Princess , 21 4 Nico Rosberg , 22 4 Harmonia axyridis , 23 4 City hall , 24 4 Harry Potter , 25 4 Blasons de France

ago 2008: 1 7 National insignia , 2 6 2008 Summer Olympics , 3 5 Galerie de roses , 4 5 Barack Obama , 5 5 Argiope bruennichi , 6 5 Fire engine , 7 5 Venezia , 8 5 Arnica montana , 9 4 Crassula coccinea , 10 4 Falkoniergasse , 11 4 Giancarlo Martini , 12 4 Professional sumo , 13 4 Emma Watson , 14 4 South Ossetia , 15 4 Stamps of the United States , 16 4 Paronychia argentea , 17 4 País Valencià , 18 4 المغرب , 19 4 Flos , 20 4 Spheniscidae , 21 4 Geranium robertianum , 22 4 City hall , 23 4 Blasons de France , 24 4 Αθήνα , 25 4 საქართველო

set 2008: 1 7 2008 Summer Olympics Australian athletes , 2 6 Tag des offenen Denkmals 2008 , 3 6 Sarah Palin , 4 5 List of Euphorbiaceae genera , 5 5 Founding Fathers of the United States , 6 5 Large Hadron Collider , 7 5 Melanerpes erythrocephalus , 8 5 Wikimedia , 9 4 XXXIII Festiwal Polskich Filmów Fabularnych , 10 4 Klosterkirche St. Verena (Rot an der Rot) , 11 4 Alfred Gellhorn , 12 4 Veľká Studená dolina , 13 4 California State Route 14 , 14 4 Memmingen , 15 4 Pruno (Cilento) , 16 4 City flags , 17 4 Albuquerque, New Mexico , 18 4 List of 600px association football flags , 19 4 Pokémon , 20 4 Mountains , 21 4 Galleria orobica , 22 4 Phlox subulata , 23 4 ประเทศไทย , 24 4 Trolleybuses , 25 4 Knautia arvensis

out 2008: 1 6 City flags , 2 5 Pelota , 3 5 Flaggen Nazi-Deutschlands , 4 5 Castle , 5 4 RusskiyToy , 6 4 Ole von Beust , 7 4 Fuenlabrada de los Montes , 8 4 30 Seconds to Mars , 9 4 Větřkovice , 10 4 Asciano , 11 4 Satyrium ilicis , 12 4 Szczecin , 13 4 Kraków , 14 3 Igor Kufayev , 15 3 Spalax microphthalmus , 16 3 Griffon Nivernais , 17 3 Grand anglo-français tricolore , 18 3 Pilea rotundinucula , 19 3 Leonardo Da Vinci , 20 3 Stiftskirche Notre-Dame du Port , 21 3 Wölfnitz (Klagenfurt am Wörthersee) , 22 3 Castles in England , 23 3 Hylurgops glabratus , 24 3 Phyllobius , 25 3 Mącznik (województwo pomorskie)

nov 2008: 1 15 Barack Obama , 2 5 Zygmunt II August , 3 5 Corpus Inscriptionum Latinarum , 4 5 STS-126 , 5 5 List of dog breeds , 6 5 Força Expedicionária Brasileira , 7 5 Museo del Prado , 8 4 Buffalo Zoo , 9 4 Juan De La Corte , 10 4 Avigliano , 11 4 Down town Anchorage , 12 4 Memmingen , 13 4 Maritime flags , 14 4 Србија , 15 4 Alcelaphus buselaphus , 16 4 Helsinki , 17 4 National insignia , 18 4 Wikipedia , 19 4 United States , 20 4 Railway station , 21 3 Espresso machine , 22 3 Església arxiprestal de Sant Mateu , 23 3 KZ Hinzert , 24 3 Gunnar Möller , 25 3 Villa romana de Almenara

dez 2008: 1 10 Carlos Latuff , 2 6 Euro , 3 6 Hauptseite , 4 5 Nudity , 5 5 Adolf Hitler , 6 5 Vincent van Gogh , 7 5 Accueil , 8 5 Railway station , 9 4 Valdecañas de Cerrato (Palencia - España) , 10 4 Kino Babylon , 11 4 Akutan Zero , 12 4 St. Blasiuskirche (Balve) , 13 4 2006 photos of Japan , 14 4 Formula One car , 15 4 Illustrated atlas of French and English heraldic terms , 16 4 152 , 17 4 Measured seeds , 18 4 Gerd von Rundstedt , 19 4 Abies concolor , 20 4 Deutschland (1931) , 21 4 Adolf Eichmann , 22 4 Mass Rapid Transit (Singapore) , 23 4 Parus caeruleus , 24 4 Reichstagsgebäude , 25 4 National insignia

jan 2009: 1 15 Barack Obama , 2 10 Adolf Hitler , 3 9 Carlos Latuff , 4 5 Giurtelecu Şimleului , 5 5 List of 600px association football flags , 6 5 Toronto , 7 5 France , 8 5 Anas platyrhynchos , 9 5 Fire , 10 5 George W. Bush , 11 4 Info:Eddie Rickenbacker , 12 4 Hernando de Soto Bridge , 13 4 Toosa , 14 4 BVG-Stadion , 15 4 Une vie de Vincent van Gogh par l'image , 16 4 Knut (polar bear) , 17 4 Illustrated atlas of French and English heraldic terms , 18 4 Harry Potter , 19 4 Scotland , 20 4 Poznań , 21 4 Accueil , 22 3 Info:Arto Paasilinna , 23 3 Christian Renatus von Zinzendorf , 24 3 Adams' Grammar School , 25 3 Bocşa, Sălaj

fev 2009: 1 6 Fila Brasileiro , 2 5 Nudity , 3 4 Hatvan–Somoskőújfalu vasútvonal , 4 4 Glacial erratic on Wolności square in Racibórz , 5 4 Illustrated atlas of French and English heraldic terms , 6 4 Cúcuta , 7 4 Slovenija , 8 4 Barack Obama , 9 4 Colombia , 10 4 Tour Eiffel , 11 4 National insignia , 12 4 World War II , 13 4 京都市 , 14 3 Shamian , 15 3 Charmosyna papou , 16 3 Leimbach , 17 3 Xanthocryptus sp. , 18 3 Presidents of Washington & Jefferson College , 19 3 Amy Studt , 20 3 Apostroph , 21 3 Karersee , 22 3 Niceteria macrocosma , 23 3 Epidesmia perfabricata , 24 3 Crocanthes glycina , 25 3 Kouros of Tenea

mar 2009: 1 8 STS-119 , 2 7 Carlos Latuff , 3 6 Britney Spears , 4 6 Ariel Sharon , 5 5 Mandelbrot set , 6 5 Harry Potter , 7 5 日本 , 8 4 Das Areal , 9 4 Caricatures of Ariel Sharon by Carlos Latuff , 10 4 Gutenswegen , 11 4 Stadtkirche St. Marien , 12 4 List of 600px association football flags , 13 4 Hasan Sami Bolak , 14 4 Sukhoi Su-17 , 15 4 Winston Churchill , 16 4 Euro , 17 4 France , 18 4 Sunset , 19 4 European Union , 20 4 Venezia , 21 4 Corylus avellana , 22 4 Paris , 23 4 Felis silvestris catus , 24 4 Railway station , 25 3 Malu Mader

abr 2009: 1 6 Barack Obama , 2 6 Hepatica nobilis , 3 5 AC/DC , 4 5 France , 5 5 National insignia , 6 5 Anemone nemorosa , 7 4 Urmia , 8 4 Burg Falkenstein (Höllental) , 9 4 Park Moczydło w Warszawie , 10 4 Renault Mégane , 11 4 Idina Menzel , 12 4 Flags with animals , 13 4 Illustrated atlas of French and English heraldic terms , 14 4 List of dog breeds , 15 4 Tulipa , 16 4 Penis , 17 4 Easter , 18 4 Bullmastiff , 19 4 Banksia , 20 4 Србија , 21 4 Mass Rapid Transit (Singapore) , 22 4 Narcissus , 23 4 Ara ararauna , 24 4 V-2 , 25 4 Euro

mai 2009: 1 10 STS-125 , 2 6 Hermaville , 3 6 Guitar , 4 5 黄现璠 , 5 4 Alexander Rybak , 6 4 Koroszczyn , 7 4 Jean-Baptiste Vanmour , 8 4 Rihanna , 9 4 List of 600px association football flags , 10 4 George Gamow , 11 4 City hall , 12 4 Sri Lanka , 13 4 Pseudotsuga menziesii , 14 4 Anas platyrhynchos , 15 4 Panthera leo , 16 4 Johann Wolfgang von Goethe , 17 4 Automobile , 18 4 ישראל - إسرائيل , 19 4 日本 , 20 4 Giraffa camelopardalis , 21 4 Cygnus olor , 22 3 Racehorses , 23 3 Burg Grüningen , 24 3 Linaria platycalyx , 25 3 Día das Letras Galegas

jun 2009: 1 7 Michael Jackson , 2 6 France , 3 5 Coats of arms of Chile , 4 5 Harry Potter , 5 4 List of 600px association football flags , 6 4 Turdus merula , 7 4 台灣 , 8 4 Castle , 9 3 Dana International , 10 3 Van Gogh Autorretrato , 11 3 Cornelis de Graeff , 12 3 Theatres in Szczecin , 13 3 Anaspis rufilabris , 14 3 Agriotes gallicus , 15 3 Cerro Castor , 16 3 Chelsea Flower Show , 17 3 Viola selkirkii , 18 3 San Pedro del Pinatar , 19 3 Maps of Hokkaido prefecture , 20 3 Structured gallery of churches dedicated to Saint George , 21 3 2009 swine flu outbreak , 22 3 Flags of subdivisions of Ukraine , 23 3 黄现璠 , 24 3 Universala Kongreso , 25 3 Magdalena de Kino

jul 2009: 1 9 Michael Jackson , 2 6 STS-127 , 3 6 List of 600px association football flags , 4 6 Inachis io , 5 4 Schiffshebewerk Niederfinow Nord , 6 4 Dimitrije Bužarovski , 7 4 Selena Gómez , 8 4 Dresdner Parkeisenbahn , 9 4 Atlas of Romania , 10 4 Panorami di Assisi , 11 4 Република Македонија , 12 4 Tram - Europe , 13 4 Harry Potter , 14 4 National insignia , 15 3 Alain Meilland , 16 3 Nina Paley , 17 3 Ploceus tricolor , 18 3 Gregor schmidinger , 19 3 Vsetínská Bečva , 20 3 Kotzian , 21 3 Post-Impressionist painters , 22 3 Flood in Central Europe (2009) , 23 3 Gasag , 24 3 Фронтон , 25 3 Amador Valley High School

ago 2009: 1 5 Quercus chrysolepis , 2 5 List of 600px association football flags , 3 5 MediaWiki edit toolbar , 4 4 Namib desert horse , 5 4 Laureana di Borrello , 6 4 Andrzej Tadeusz Kijowski , 7 4 STS-127 , 8 4 Crystal Clear by type , 9 4 Windmill , 10 3 Daniela Malusardi , 11 3 朱镕基 , 12 3 Jerry Reed , 13 3 Qairawān , 14 3 Frosinone , 15 3 Burg Reichenstein , 16 3 Rometta , 17 3 Xhevdet Sakaj , 18 3 Grandeur of the Seas , 19 3 Juan Calzadilla , 20 3 Mirante do Vale , 21 3 African elephant , 22 3 Spoon River College , 23 3 Clive standen , 24 3 Alain Meilland , 25 3 STS-128

Estatísticas geradas em Terça-feira, 22 de setembro 2009 a partir de cópias do banco de dados SQL de Segunda-feira, 31 de agosto 2009
Versão do script:2.5
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
For documentation see meta
Scripts: scripts.zip

All data and images on this page are in the public domain.