Estatísticas da  meta-wiki

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist

Metrics have been collected from a full archive dump, which contains all revisions of every article, meta data and raw content.
See also metrics definitions


 
Monthly counts & Quarterly rankings: março 2013
 
DataAutoresArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
Mar 2013+1% -22%-24%+4%   -12%+2%+3%+2%+2%+3%+1%+2%
Feb 2013+2% +66% +2%   +64%+2%+2%+3%+1%+5%+2%+3%
Jan 2013+1% -14% +2%   -26%+2%+2%+2%+2%+3%+1%+1%
Dec 2012+1% -27% +2%   -5%+2%+2%+1%+1%+4%+2%+1%
Nov 2012+2% -0% +1%   -7%+2%+2%+1%+1%+3%+1%+1%
Oct 2012+2% +36%+35%+3%   +30%+2%+2%+2%+1%+3%+2%+3%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
Mar 20136915734452229 k3335,4600221 k256 Mb28,2 M116 k136 k29 k131 k11 k
Feb 201368421225722928 k1935,9606223 k251 Mb27,5 M114 k133 k28 k130 k11 k
Jan 20136720473441827 k1635,8605414 k246 Mb26,9 M111 k132 k27 k128 k10 k
Dec 20126673723983027 k1635,9606019 k242 Mb26,5 M108 k130 k26 k126 k10 k
Nov 201266011005471926 k1235,9606520 k237 Mb26,0 M107 k128 k25 k123 k10 k
Oct 201265011255493526 k2035,6605722 k233 Mb25,6 M106 k127 k24 k122 k10,0 k
Sep 20126376824052625 k1535,6607817 k228 Mb25,1 M104 k126 k24 k120 k9,7 k
Aug 20126294953971425 k1435,6605614 k223 Mb24,5 M102 k125 k23 k116 k9,5 k
Jul 201261991064281124 k1035,7602613 k219 Mb24,0 M100 k124 k22 k114 k9,4 k
Jun 20126093442891424 k935,659819,9 k215 Mb23,5 M99 k122 k22 k112 k9,3 k
May 20126049463152424 k1035,6597113 k212 Mb23,2 M98 k121 k22 k111 k9,2 k
Apr 20126003413431923 k1235,6594815 k208 Mb22,8 M97 k120 k21 k110 k9,1 k
Mar 20125962593571923 k935,4593513 k205 Mb22,4 M95 k119 k21 k108 k9,0 k
Feb 201259031485872423 k1235,3590520 k201 Mb22,0 M93 k118 k20 k107 k8,9 k
Jan 20125755483491922 k1234,9588014 k197 Mb21,6 M92 k116 k20 k105 k8,7 k
Dec 20115707452932122 k1034,9580113 k192 Mb20,9 M91 k115 k19 k103 k8,5 k
Nov 20115662723771722 k2534,8580815 k189 Mb20,7 M90 k114 k18 k101 k8,4 k
Oct 20115590893941821 k935,3586513 k185 Mb20,2 M90 k113 k18 k99 k8,3 k
Sep 20115501983871621 k935,1582713 k182 Mb19,8 M90 k111 k18 k97 k8,2 k
Aug 20115403763541720 k2434,9577513 k178 Mb19,4 M88 k110 k17 k95 k8,2 k
Jul 20115327312161220 k1035,658298,4 k173 Mb18,8 M85 k109 k17 k93 k8,1 k
Jun 2011529648240619 k835,758487,5 k171 Mb18,6 M84 k108 k17 k92 k7,8 k
May 20115248623091019 k1335,8584610 k169 Mb18,4 M83 k107 k16 k91 k7,8 k
Apr 2011518638222419 k103658237,3 k165 Mb17,9 M81 k105 k16 k89 k7,7 k
Mar 2011514840258718 k636,258808,2 k164 Mb17,8 M80 k105 k16 k89 k7,4 k
Feb 201151081134551018 k636,1585613 k161 Mb17,5 M79 k104 k16 k88 k7,3 k
Jan 2011499560333818 k935,7579710 k158 Mb17,2 M78 k102 k16 k86 k7,2 k
Dec 2010493552260718 k435,757607,3 k155 Mb16,9 M77 k101 k15 k84 k7,1 k
Nov 20104883753591018 k1435,5572511 k152 Mb16,6 M76 k101 k15 k83 k7,1 k
Oct 2010480878333817 k835,857559,8 k149 Mb16,3 M74 k100 k15 k81 k6,9 k
Sep 2010473055247517 k535,857187,2 k146 Mb16,0 M73 k99 k15 k79 k6,8 k
Aug 2010467538217617 k435,757026,8 k144 Mb15,8 M73 k99 k15 k78 k6,8 k
Jul 2010463735190417 k635,556686,1 k142 Mb15,6 M73 k98 k14 k76 k6,7 k
Jun 2010460237182217 k335,556634,6 k141 Mb15,4 M72 k98 k14 k76 k6,6 k
May 2010456558204516 k335,456456,3 k140 Mb15,3 M72 k97 k14 k75 k6,6 k
Apr 2010450743211416 k535,356095,8 k139 Mb15,1 M72 k97 k14 k74 k6,5 k
Mar 2010446449230416 k435,255986,7 k137 Mb14,9 M71 k96 k14 k74 k6,5 k
Feb 201044151514441316 k535,1556012 k135 Mb14,7 M71 k95 k14 k73 k6,4 k
Jan 201042641243401116 k1134,6550413 k133 Mb14,5 M71 k93 k14 k72 k6,4 k
Dec 2009414046204416 k334,554826,2 k129 Mb14,1 M68 k92 k13 k70 k6,4 k
Nov 2009409454271516 k634,354737,0 k128 Mb14,0 M68 k91 k13 k69 k6,4 k
Oct 2009404044229415 k1834,254768,1 k126 Mb13,8 M67 k89 k13 k69 k6,3 k
Sep 2009399642185215 k33555725,0 k125 Mb13,6 M67 k90 k13 k66 k6,2 k
Aug 2009395450254715 k634,955627,5 k124 Mb13,4 M67 k90 k13 k65 k6,1 k
Jul 20093904833411515 k2134,8554611 k122 Mb13,2 M66 k89 k13 k64 k6,0 k
Jun 2009382136190714 k535,655985,7 k118 Mb12,8 M64 k88 k13 k63 k6,0 k
May 2009378550195814 k635,656036,8 k117 Mb12,7 M64 k87 k13 k62 k6,0 k
Apr 20093735512871114 k935,656028,8 k115 Mb12,5 M63 k85 k12 k61 k5,8 k
Mar 20093684482761713 k635,656089,4 k113 Mb12,3 M62 k84 k12 k60 k5,7 k
Feb 200936361655261613 k735,4558217 k112 Mb12,0 M61 k83 k12 k59 k5,5 k
Jan 2009347178319713 k834,6552310 k109 Mb11,7 M61 k82 k12 k58 k5,2 k
Dec 2008339344221813 k634,555586,7 k108 Mb11,6 M59 k81 k12 k57 k5,1 k
Nov 20083349712841312 k2034,4546110 k105 Mb11,3 M58 k80 k11 k57 k5,0 k
Oct 20083278412611012 k735,354458,8 k102 Mb10,7 M56 k79 k11 k55 k4,9 k
Sep 2008323765261712 k535,253088,1 k99 Mb10,2 M55 k77 k11 k53 k4,8 k
Aug 20083172542521012 k63552898,4 k98 Mb10,1 M55 k76 k11 k53 k4,8 k
Jul 2008311852230411 k334,852537,2 k96 Mb9,8 M54 k75 k11 k51 k4,7 k
Jun 2008306678321511 k434,552229,7 k94 Mb9,7 M53 k74 k11 k51 k4,6 k
May 2008298852268811 k733,951009,2 k92 Mb9,4 M52 k72 k11 k50 k4,5 k
Apr 2008293657230811 k733,849707,4 k87 Mb9,0 M48 k70 k10 k49 k4,5 k
Mar 2008287955228711 k433,749767,1 k86 Mb8,8 M47 k69 k10 k48 k4,4 k
Feb 2008282444205911 k533,549466,8 k84 Mb8,7 M47 k68 k10 k47 k4,3 k
Jan 20082780392171210 k633,348927,7 k82 Mb8,5 M45 k67 k10 k46 k4,1 k
Dec 2007274178273910 k433,148538,2 k81 Mb8,2 M44 k67 k9,9 k46 k4,0 k
Nov 20072663863471510 k632,7479812 k78 Mb8,0 M35 k66 k9,8 k45 k3,9 k
Oct 2007257757258710,0 k632,247209,5 k75 Mb7,8 M33 k64 k9,2 k44 k3,8 k
Sep 200725204823189,8 k631,847128,6 k73 Mb7,6 M32 k63 k9,0 k43 k3,7 k
Aug 200724726621339,6 k631,546307,7 k70 Mb7,3 M32 k62 k8,6 k42 k3,6 k
Jul 200724065723689,4 k731,445948,0 k69 Mb7,1 M32 k60 k8,3 k41 k3,6 k
Jun 200723499035389,2 k1631,3461711 k67 Mb7,0 M31 k58 k8,3 k41 k3,5 k
May 200722594921578,7 k431,646827,2 k65 Mb6,7 M31 k57 k8,0 k40 k3,3 k
Apr 200722105720138,6 k431,346456,6 k64 Mb6,6 M30 k55 k8,0 k40 k3,2 k
Mar 200721535220038,4 k33145965,7 k62 Mb6,4 M30 k54 k7,9 k39 k3,0 k
Feb 200721013617238,3 k430,645976,0 k62 Mb6,3 M30 k53 k7,9 k38 k3,0 k
Jan 200720655821148,2 k630,345987,1 k61 Mb6,2 M29 k52 k7,9 k38 k2,9 k
Dec 200620077328278,1 k930,1458710,0 k59 Mb6,1 M29 k51 k7,7 k37 k2,8 k
Nov 2006193496308117,8 k1329,9464011 k58 Mb6,0 M28 k50 k7,5 k36 k2,6 k
Oct 200618387329377,4 k529,946608,4 k56 Mb5,7 M27 k48 k7,3 k35 k2,5 k
Sep 2006176567292107,3 k729,3460610 k55 Mb5,5 M27 k47 k7,0 k34 k2,4 k
Aug 2006169898283117,0 k2528,8460511 k53 Mb5,3 M26 k45 k6,5 k33 k2,3 k
Jul 200616005820256,2 k630,749037,3 k50 Mb5,1 M25 k42 k6,2 k31 k2,2 k
Jun 200615425823156,1 k830,449078,0 k49 Mb4,9 M24 k41 k5,9 k30 k2,2 k
May 200614845720795,8 k530,249227,6 k47 Mb4,8 M23 k40 k5,8 k30 k2,1 k
Apr 200614276222675,7 k629,749587,6 k46 Mb4,7 M23 k39 k5,7 k29 k2,1 k
Mar 200613656120085,5 k1029,350669,1 k45 Mb4,6 M23 k38 k5,6 k29 k2,0 k
Feb 200613045216255,2 k629,350046,3 k43 Mb4,3 M22 k37 k5,5 k27 k1,9 k
Jan 200612526623755,0 k102949269,3 k41 Mb4,1 M22 k36 k5,4 k25 k1,9 k
Dec 200511868024574,7 k92949788,3 k39 Mb3,9 M21 k34 k5,3 k24 k1,8 k
Nov 200511064418444,4 k62950196,5 k37 Mb3,7 M19 k31 k5,2 k22 k1,8 k
Oct 200510625718344,2 k728,849877,1 k35 Mb3,5 M19 k30 k5,1 k22 k1,7 k
Sep 200510056018614,0 k628,450236,8 k34 Mb3,3 M18 k29 k5,0 k21 k1,6 k
Aug 20059454719563,8 k1028,150437,5 k33 Mb3,2 M18 k28 k4,9 k20 k1,5 k
Jul 20058985116453,5 k628,550986,7 k30 Mb3,0 M17 k27 k4,5 k19 k1,5 k
Jun 20058476119473,3 k928,251397,0 k29 Mb2,8 M15 k25 k4,2 k18 k1,4 k
May 20057865015453,0 k528,451435,6 k27 Mb2,6 M14 k23 k3,7 k16 k1,4 k
Apr 200573644158102,9 k728,151806,5 k25 Mb2,5 M13 k21 k3,5 k15 k1,3 k
Mar 20056925416592,7 k1127,852706,7 k24 Mb2,4 M12 k19 k3,4 k14 k1,1 k
Feb 20056384215862,3 k1028,953116,0 k22 Mb2,1 M11 k17 k2,9 k12 k1,1 k
Jan 20055964316232,1 k83055035,6 k20 Mb1,9 M10 k16 k2,5 k10 k968
Dec 20045533411021,8 k33158743,9 k19 Mb1,8 M9,6 k15 k2,4 k9,6 k936
Nov 20045195014931,7 k430,558415,2 k18 Mb1,7 M9,3 k14 k2,0 k9,1 k891
Oct 20044694113171,6 k529,458735,6 k17 Mb1,6 M8,8 k13 k1,9 k8,4 k838
Sep 20044286415981,4 k628,958947,5 k15 Mb1,4 M7,8 k12 k1,7 k7,6 k781
Aug 2004364216231,2 k327,455752,5 k13 Mb1,2 M6,9 k11 k9035,5 k643
Jul 2004343219241,1 k327,557643,6 k12 Mb1,1 M6,6 k10 k9055,4 k595
Jun 20043222710651,0 k326,656003,5 k11 Mb1,0 M6,0 k9,5 k8864,8 k382
May 2004295391093959225,256303,7 k10 Mb942 k5,7 k8,7 k7995,0 k311
Apr 200425629662889323,155902,5 k9,3 Mb873 k5,3 k7,9 k7714,0 k289
Mar 200422720771800122,658701,9 k8,5 Mb831 k5,0 k4,2 k7473,6 k262
Feb 20042071141 763121,158151,1 k8,0 Mb781 k4,8 k3,6 k6883,2 k238
Jan 20041964232725220,855809307,2 Mb725 k4,6 k3,3 k5913,0 k224
Dec 20031928361676220,954001,1 k4,5 Mb651 k4,3 k3,1 k5862,7 k213
Nov 20031841132 620220,953911,1 k4,1 Mb596 k3,9 k3,0 k5812,4 k175
Oct 20031731648 556221,355441,2 k3,8 Mb553 k3,3 k2,5 k5682,1 k154
Sep 2003157481041502221,257602,8 k3,5 Mb515 k3,0 k2,3 k5102,0 k136
Aug 2003109491371444217,656932,8 k3,0 Mb439 k2,8 k1,9 k3581,6 k123
Jul 200360923 38411359355572,6 Mb397 k2,4 k1,4 k1161,3 k83
Jun 200351410 361 12,360872942,5 Mb383 k2,4 k1,3 k501,2 k81
May 200347110 349111,861534012,4 Mb374 k2,1 k1,2 k511,1 k74
Apr 20034616 320 11,763412122,3 Mb354 k2,1 k1,1 k491,0 k70
Mar 200345816 308111,464075002,3 Mb344 k2,0 k1,0 k471,0 k68
Feb 200337211 288210,565294592,1 Mb328 k2,0 k8204497864
Jan 200335210 246110,470452951,9 Mb304 k1,4 k3863784428
Dec 20023319 219 10,473032361,7 Mb281 k1,2 k3073778623
Nov 200232511 20619,972292231,6 Mb262 k1,1 k2353572918
Oct 200227411 18519,873873861,5 Mb241 k1,0 k933563716
Sep 20022355 151 9,477671201,2 Mb204 k9738313808
Aug 20021813 141 9,28071531,2 Mb198 k9198313177
Jul 200217   136 9,28154501,2 Mb194 k9048303087
Jun 200217   130 9,28396261,1 Mb191 k8988303047
May 200217   121 9,78233181,0 Mb174 k8088302936
Apr 20021768 12019,683772671,0 Mb176 k8058302896
Mar 200211 2 92 9,7857744833 kb138 k6548302436
Feb 20021113 89 9,5872593822 kb136 k6588302316
Jan 20021026 76 9,99332221746 kb124 k6438302114
Dec 2001816 66 88707203604 kb100 k608492074
Nov 20017711 5126,46766328369 kb60 k479  1694
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
 AutoresArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Autores (usuários registrados)
A = Autores que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de autores que editaram pelo menos dez vezes desde que chegaram
C = Autores que contribuíram cinco vezes ou mais este mês
D = Autores que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  5  10  100  1000  1  3  5  10  25  100  250  1000  2500  10000  25000  100000  250000  5  10  100  1000  10000  1  3  5  10  25  100  250  1000  2500  5  10  100  1000  10000 
Mar 2013136465744526412422611294187337824311537853     652  113148736722912230131 1412431
Feb 20131768812572364166297 985273331419711234732111  54   111047537625413935132 1311521
Jan 20131085501344221113183 884 65526815981254411111 22   88338427719110729101 108211
Dec 20121128546398283150309 973156522614970295432111 44   780365290221137411511109311
Nov 20121467759547336177194 983172626916780356321111154   914463361257156331321119311
Oct 20121397731549359182354 11731767306205108398422111 661  106952141129116946131 1412521
Sep 20121181565405267138264 864 6392651739029331111  54   806388303223122335  119211
Aug 20121233567397245122142 1074 701284193109491021111  32   8934083002071253413  1412421
Jul 201215716184282569811  663 7462781799927421111  53   1306482314198109171  1110211
Jun 201289642228916986141 874 5812381408223211111  54   72126218813568173  98311
May 201292345231519291243 874 6052381598227311111  32   75628320314175287  119211
Apr 2012973467343204102196 985166929420610734411111  54   7743262491628314111 1212321
Mar 20121040493357214102193 973 67730121211243311111  43   78829520412867173  108211
Feb 201217248275873551482451974 734327220122461211111  54   907345237163882381 1210311
Jan 2012121353134920097193 973 7142881839543621111  431  849297196125672151 1511411
Dec 20119134042931727421311095 642238140662731111   54   7902841971195615851118311
Nov 2011120054937720894174 985 682271169833221111   43   939369263155672313211010311
Oct 201112755803942248718  883 7923071819643911111  33   95733421012456155  1111521
Sep 2011141756938723484162 772 72529018910748711111  44   8582641711055192  1211311
Aug 2011162456635419682174 542 1003345211107461221111  22   9572991891045272  99211
Jul 201182034821612456121 653 51419111164236211    44111690219150873792  109211
Jun 2011999404240130546  552 5562071256122311111  33   7402311499649105  88211
May 201111594643091738410  542 7202221326528511111  22   763211142743193  66211
Apr 20117643282221255941 642 440153823812111111  22   635200115672241  66211
Mar 20119353892581386871 873 562231136762311111   44   74523915166295   97211
Feb 2011170769245527811710  652 5992261458232621111  32   760190106542193  87211
Jan 201112034963331826582 532 6152031256117311111  21   860237143793384  87211
Jan 20131085501344221113183 884 65526815981254411111 22   88338427719110729101 108211
Oct 20121397731549359182354 11731767306205108398422111 661  106952141129116946131 1412521
Jul 201215716184282569811  663 7462781799927421111  53   1306482314198109171  1110211
Apr 2012973467343204102196 985166929420610734411111  54   7743262491628314111 1212321
Jan 2012121353134920097193 973 7142881839543621111  431  849297196125672151 1511411
Oct 201112755803942248718  883 7923071819643911111  33   95733421012456155  1111521
Jul 201182034821612456121 653 51419111164236211    44111690219150873792  109211
Apr 20117643282221255941 642 440153823812111111  22   635200115672241  66211
Jan 201112034963331826582 532 6152031256117311111  21   860237143793384  87211
Oct 201010254933331946983 55  4581689848162       22   585152845225522 55211
Jul 2010749300190903542 331 4751881195616        11   631141754119531 55211
Apr 2010917368211101354  651 43713081341111      11   93318590542041  76211
Jan 2010365660334018171113 33  67718610962307            10732521477331103  76311
Oct 20097303372291215041 5521436171117552231      1    5021579858284   95211
Jul 2009112751634119782151 22  508179104432011           639203101502751  44211
Apr 200911224592871565311  221 587197122542241           641210121702884  64211
Jan 200910904753191796874 221 577209107512641      111  717230142702795  43211
Oct 200892839526114655101 221 513196126642122           641188117713062  33211
Jul 200811544922301103942 3   54320612161152       11   81722713271324   54211
Apr 20087903532301395081 221 507192130652841           612203137723271  44321
Jan 200878134221712140121 211 542213131642761      21   6452361398134124  44311
Oct 20078633922581606271 321 564217134572441      11   53818311262269   22211
Jul 20078183592361314681 111 52418311057182       11   60616798472431  4321 
Apr 20078023282011053631     520182112511753      11   56315896472253  2111 
Jan 20077893282111054741 22  643243131602341      22   65120712161202        
Oct 20061083479293125357      703244115461311           658172934115         
Jul 2006790321202964551     5161901035015             59218011061194        
Apr 2006851364226118497      53319911458151            636199115591542       
Jan 20069103602371384851     5011741004718             64821413462222        
Oct 20057872861831033742     3481147037101            5361556530103        
Jul 2005605277164903951 11  34511856289             4611267628112   11   
Apr 20054932421589235102 11  2841097041113            37113174311753       
Jan 2005518236162863431 1   2237943229             26274421771        
Oct 200452321413173327      2008250228             25273391781        
Jul 20042661449249184      16563401691            185613515721       
Apr 20042019966431721     94322183             1264026961        
Jan 20049544231472      511793              6622741         
Oct 20031577148287      52261752             64231481         
Jul 2003843423132      672618124             6418135          
Apr 2003288642      1311               18411          
Jan 200334131031      1985311            2075411        
Oct 200229161182      14753              163211         
Jul 200281        1                 431           
Apr 20021911842      1242               1663           
Jan 20022110631      9321              11532          

 

Distribuição de edições de artigos por autores
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=AutoresEdições total
132,644100.0%844,832100.0%
312,57838.5%814,46796.4%
106,96821.3%782,02992.6%
323,2149.8%716,80984.8%
1001,3554.2%614,97572.8%
3164631.4%457,56154.2%
10001220.4%269,30431.9%
3162170.1%100,51411.9%
1000010.0%11,0921.3%

 

50 autores recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions
agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
PathoschildUC1 011,092520,32867Jan 29, 20062617378---
Cbrown1023UC2 09,051118,3791Jan 13, 20072268249---
SjUC4 08,044315,50787Feb 07, 200433394591--
ShizhaoUC5 07,573491,30311Aug 26, 2003350476---
KaganerUC6+16,7647729,1471,649Apr 15, 200529069612--
MarcoAurelioUC7-16,251678,623237Sep 09, 200816631112--
MxnUC8 05,57741,98311Dec 01, 20033407147---
AnthereUC10 05,19942,9284Oct 06, 20023828201---
Nemo bisUC11+14,5261624,428293Nov 29, 20071948541--
GuillomUC17 03,291202,0609Jan 03, 200626431602--
SiebrandUC19+13,042413,13540Jul 12, 20062453611--
TrijnstelUC21 02,947363,01942Oct 10, 201090212---
Quentinv57UC22 02,851582,10523Dec 21, 2009119581---
ThehelpfuloneUC23 02,793517,903422Dec 15, 20071932281--
PiRSquared17UC24+292,7861,0944,1781,173Jul 01, 201010034726--
GerardMUC26-12,60538282Feb 28, 2004331876---
WikitanvirUC27-12,37342,350-Sep 02, 2009130582---
Jon Harald SøbyUC28-12,32082,0945May 13, 2005287894---
MF-WarburgUC29+82,2832141,672220Jan 18, 20072263821--
Verdy pUC30-22,280152,33926Oct 16, 2005272216---
EloquenceUC31-22,26371,6938Dec 03, 20023770152---
EffeietsandersUC32-22,25941,1341May 17, 2005287489---
GeitostUC35-22,163112,8129Apr 07, 2008181835---
Ruslik0UC37+12,1227178013Oct 23, 2008161910---
Bjankuloski06UC40 02,061502,50997Apr 21, 20062535956--
Philippe (WMF)UC41-22,057152,15726Jan 28, 2010115786---
MathoniusUC42-12,006414,010149Jul 19, 2010985151--
NotafishUC45-11,926101,32710Oct 14, 20043089110---
DcljrUC46 01,918666927Aug 11, 200431533---
BdamokosUC48-11,868261,14326Jul 31, 20062434842--
BarrasUC49-11,850122,14817Feb 11, 200915087---
HerbythymeUC50-11,847177,34569Jan 10, 200722713---
BillinghurstUC51 01,825959,961538Oct 17, 2008162523---
PeterSymondsUC52-21,766151,1563May 24, 2008177125---
DerHexerUC56 01,59441,5335Aug 10, 2007205931---
JafeluvUC58 01,57322,6234Oct 16, 2009126126---
LauraHaleUC59 01,56941179Mar 25, 201173665---
Amire80UC66 01,48641,38418May 23, 2006250349---
SPQRobinUC68 01,473101,0645Feb 04, 2007224633---
CourcellesUC69 01,441281518Jun 17, 20101017----
PharosUC70+61,4256352553Aug 29, 20052770421--
Steven (WMF)UC71-11,417101,83344Sep 16, 201092674---
MZMcBrideUC73+51,381941,709122Dec 02, 20062310784--
BeetstraUC74-11,38023,66913Oct 05, 2006236814---
PhoebeUC77+41,37110762134Jul 11, 20043184924--
DRIHEMUC79+401,3543521,841535Feb 06, 20124185219--
SnowolfUC81+31,296431,04851Jan 14, 200722678---
Tbayer (WMF)UC82+141,2931668,9461,967Jul 22, 201161712917--
VituzzuUC83 01,2923051118Dec 06, 2007194115---
ToliñoUC84+31,292541,12388Jan 05, 20081911743--

 

20 autores recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
AphaiaUC38,759May 09, 20043247Apr 26, 2012338
SpacebirdyUC95,211Aug 04, 20052795Jul 14, 2012259
Mike.lifeguardUC124,503Jul 03, 20072097Aug 17, 2011591
KyluUC133,901May 13, 20062513Sep 30, 2011547
WalterUC143,888Oct 13, 20023821Dec 29, 201291
AngelaUC153,579Aug 05, 20033525Jan 24, 2012431
Meno25UC163,305Feb 15, 20072235Feb 10, 201348
MilloshUC183,058Jul 02, 20043193Mar 01, 201329
YuyuUC203,031Jul 31, 20052799Mar 01, 201329
MavUC252,712Oct 10, 20023824Jan 21, 201368
Anonymous DissidentUC332,181Sep 02, 20072036Nov 14, 2010867
HillgentlemanUC342,172Aug 10, 20062424Aug 06, 2011602
Az1568UC362,146Aug 20, 20062414Nov 17, 2011499
BastiqueUC382,089Apr 17, 20062539Apr 06, 2012358
ThogoUC392,073Jul 12, 20062453Feb 17, 201341
WutsjeUC431,954Nov 29, 20071948Feb 09, 201349
Nick1915UC441,929Sep 16, 20052752Mar 17, 2012378
M7UC471,897Sep 04, 20043129Feb 08, 201350
BeriaUC531,728Mar 05, 20081851Jan 18, 201371
PatrickUC541,657Feb 01, 20033710Dec 14, 2012106

 

usuários anônimos, ordenados por número de contribuições
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
139.78.10.1672
84.48.140.40533
62.31.55.223447
69.153.249.101383
94.193.242.183364
24.73.86.239346
82.35.37.118254
195.115.26.20240
213.164.241.16211
95.34.159.92201

No total 123.071 edições foram feitas por usuários anônimos, de um total de 1016.875 edições ( 12e %)
  


50 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
FuzzyBotUC113,025Oct 26, 2011521Mar 31, 2013-17534
Kimberley-nia BotUC26,273Oct 29, 20071979Mar 27, 20133--
DellieBotUC34,746Jun 07, 20072123Aug 10, 20081693--
ICEAGE botUC44,713Oct 10, 2010902Mar 31, 2013-3-
QuentinvBotUC52,608Oct 07, 2011540Mar 31, 2013-1267
ՋոկերԲոտUC62,359Aug 09, 2012233Mar 04, 2013262-
Alch BotUC71,792Feb 08, 2012416Feb 28, 201330--
TranslationsVolBotUC81,329Sep 15, 2011562Oct 30, 20121512-
ThehelpfulbotUC91,261May 09, 2011691Apr 29, 2012335--
PathosbotUC101,211Jan 09, 20072272Dec 20, 20081561--
MiszaBotUC111,141Dec 19, 20081562Mar 28, 20132702
Erwin85BotUC121,025Oct 25, 20091252Jan 28, 20101157--
JhsBotUC13916Mar 20, 2011741Apr 05, 2012359--
EdwardsBotUC14891Sep 01, 2010941Mar 31, 2013---
AvocatoBotUC15722Jan 06, 2012449Feb 20, 201338--
CommonsDelinkerUC16567Feb 26, 20072224Mar 25, 20135--
MABotUC17559Jan 30, 20091520Mar 02, 2013285-
BOTijoUC18525Mar 28, 20101098Jun 14, 2011655--
AnankeBotUC19488Jul 02, 2011637Jul 18, 2011621--
タチコマ robotUC20397Jul 08, 20081726Oct 01, 2011546--
DougBotUC21252Dec 04, 2011482Dec 10, 2011476--
Liangent-botUC22163Jun 02, 2012301Jun 02, 201230123-
LivingBotUC23154Oct 05, 2011542Mar 28, 20132--
Lucia BotUC24144Mar 02, 2011759Mar 02, 2011759--
InvadibotUC25130Mar 30, 2013 Mar 30, 2013---
SnowbotUC26126Mar 05, 201325Mar 05, 201325--
ArthurBotUC27117Aug 01, 20091337Aug 01, 20091337--
MerlBotUC2886Aug 28, 20091310Mar 02, 201328--
DuesenBotUC2982Nov 08, 2010873Nov 08, 201087313-
MenoBotUC3061Oct 01, 20091276Oct 03, 2011544--
JembotUC3149Apr 10, 20101085May 04, 2011696--
JokerBotUC3238Aug 07, 2012235Aug 09, 20122335-
YurikBotUC3322Apr 15, 20052906Jul 30, 200528009-
FlaBotUC3420May 01, 20052890Jun 22, 20052838--
FluxbotUC3520Nov 20, 20071957Nov 20, 20071957--
CaBotUC3620Aug 29, 2010944Aug 29, 2010944--
Kandy TalbotUC3717May 29, 20072132Feb 22, 20101132--
DvtBotUC3816Feb 18, 20101136Feb 23, 20101131--
SKbotUC3915Apr 09, 20101086May 19, 20101046--
VVVBotUC4013Jun 18, 20072112Jul 10, 20081724--
MelancholieBotUC4112Mar 17, 20091474Apr 23, 20091437--
IMeowbotUC4210Dec 26, 20043016May 08, 20052883--
COIBotUC4310Apr 05, 20072186Feb 09, 2012415--
I JethrobotUC448Oct 11, 2012170Oct 17, 2012164--
Robot MonkUC457Nov 13, 20081598Dec 06, 2012114--
MerlLinkBotUC467Jul 21, 20091348Aug 03, 2010970--
Hazard-BotUC477Aug 19, 2011589Aug 19, 2011589--
MerlIwBotUC487Feb 26, 201332Mar 04, 201326--
CarsracBotUC496May 30, 20081765Mar 22, 20091469--
AlbamhandaebotUC506May 24, 20091406May 24, 20091406--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110DiaDocGifGzHtmHtmlJpgOdpOdtOggOgvPdfPngPovSvgSxcSxdSxiSxwXcfXlsXmlXsl
Mar 201345 k292 k1,5 k4,2 k65 k11 k1,2 k5,4 k      1576911102416777121174822,4 k142174927331
Feb 201344 k289 k1,4 k4,2 k64 k11 k1,2 k4,9 k      1969911102416768121174712,4 k142174927331
Jan 201343 k284 k1,4 k4,2 k64 k11 k1,2 k3,6 k      1184611102416749121174652,4 k142174927331
Dec 201242 k280 k1,4 k4,2 k62 k10 k1,2 k3,5 k      1620611102416747121174642,4 k142074927331
Nov 201241 k277 k1,3 k4,1 k58 k10 k1,2 k3,5 k      1713611102416744121174602,3 k141274927331
Oct 201241 k273 k1,3 k4,1 k52 k10 k1,2 k3,1 k      1867811102416736121174562,3 k140474927331
Sep 201239 k269 k1,3 k4,0 k50 k10 k1,2 k3,1 k      1466211102416724121174482,3 k138374927331
Aug 201239 k265 k1,3 k3,9 k50 k10 k1,2 k3,0 k      1185411102416707121174402,2 k138274927331
Jul 201238 k263 k1,3 k3,9 k49 k9,9 k1,2 k3,0 k      1116211102416705121174332,2 k138274927331
Jun 201237 k260 k1,3 k3,9 k49 k9,8 k1,2 k3,0 k      86271199416703121174302,2 k138274927331
May 201237 k258 k1,3 k3,9 k49 k9,7 k1,2 k3,0 k      108761199416697121174302,2 k138274927331
Apr 201236 k255 k1,3 k3,8 k48 k9,6 k1,2 k2,9 k      120981199416657121174242,2 k138274927331
Mar 201236 k250 k1,3 k3,8 k48 k9,5 k1,1 k2,9 k      118271198416631121074162,2 k138074927331
Feb 201235 k244 k1,3 k3,7 k48 k9,5 k1,0 k2,9 k      18223119841662512973962,1 k138074927331
Jan 201235 k236 k1,2 k3,7 k47 k9,4 k1,0 k2,8 k      11635119841662112973912,1 k138074927331
Dec 201134 k231 k1,2 k3,7 k46 k9,2 k1,0 k2,7 k      10092119841661612973882,1 k137974927331
Nov 201133 k227 k1,2 k3,6 k40 k9,1 k1,0 k2,6 k      12323119841660512973322,1 k137974927331
Oct 201133 k222 k1,2 k3,5 k35 k9,0 k1,0 k2,6 k      10967119841659512973192,1 k137874927331
Sep 201132 k216 k1,2 k3,4 k34 k8,6 k1,0 k2,5 k      11561119841658512973122,0 k137874927331
Aug 201132 k210 k1,2 k3,4 k33 k8,3 k1,0 k2,5 k      10976119841658412972952,0 k137874927331
Jul 201131 k203 k1,2 k3,4 k32 k8,1 k1,0 k2,4 k      6880119841658312972922,0 k137674926331
Jun 201130 k196 k1,2 k3,3 k31 k8,0 k1,0 k2,4 k      6477119841658212972871,9 k137674926331
May 201130 k190 k1,2 k3,3 k31 k7,9 k1,0 k2,4 k      8609119841657212972781,9 k137574926331
Apr 201129 k184 k1,1 k3,3 k30 k7,8 k1,0 k2,3 k      6244119841657012972761,9 k137574926331
Mar 201129 k181 k1,1 k3,2 k30 k7,7 k1,0 k2,3 k      6961119841656612972741,8 k137574926331
Feb 201128 k174 k1,1 k3,2 k29 k7,7 k1,0 k2,3 k      12239119841656312972601,8 k137574926331
Jan 201128 k169 k1,1 k3,2 k28 k7,6 k1,0 k2,3 k      8822119641654912972551,8 k137474926331
Dec 201027 k166 k1,1 k3,1 k27 k7,6 k1,0 k2,3 k      6226119341654912972541,8 k137474926331
Nov 201027 k162 k1,1 k3,1 k25 k7,5 k1,0 k2,2 k      9181119341654712972531,8 k137474926331
Oct 201026 k157 k1,1 k3,1 k24 k7,4 k1,0 k2,2 k      8760119341654312972521,8 k137374926331
Sep 201026 k153 k1,1 k3,1 k23 k7,3 k9972,2 k      6188119341654212972451,8 k137374926331
Aug 201026 k147 k1,1 k3,1 k22 k7,2 k9932,2 k      5836119341654112972441,8 k137374926331
Jul 201025 k141 k1,1 k3,1 k22 k7,1 k9852,2 k      5255119341654112972441,8 k137274926331
Jun 201025 k136 k1,1 k3,1 k22 k7,0 k9792,1 k      3949119341654112972431,8 k137274926331
May 201025 k130 k1,0 k3,1 k21 k6,9 k9782,1 k      5535119341654112972351,8 k137274926331
Apr 201025 k124 k1,0 k3,1 k21 k6,9 k9772,1 k      4975119341654112972311,8 k137274926331
Mar 201025 k118 k1,0 k3,0 k21 k6,8 k9762,1 k      5895119341651712972061,8 k137274926331
Feb 201024 k112 k1,0 k3,0 k21 k6,8 k9742,1 k      11868119241650212922011,8 k137274926331
Jan 201024 k108 k1,0 k3,0 k21 k6,7 k9732,1 k      11935119241649512921961,8 k137274926331
Dec 200924 k103 k9803,0 k20 k6,6 k9721,9 k      5159119241649412921951,8 k137074926331
Nov 200924 k98 k9783,0 k18 k6,6 k9721,9 k      6093119141649312921941,8 k137074926331
Oct 200923 k93 k9642,9 k14 k6,6 k9701,9 k      6245119041649212921881,7 k137074926331
Sep 200923 k87 k9372,9 k14 k6,5 k9691,9 k      4319119041649012921871,7 k136974926331
Aug 200923 k82 k9312,9 k14 k6,5 k9661,8 k      6729119041648812921871,7 k136974926331
Jul 200923 k75 k9252,9 k14 k6,4 k9651,8 k      9878119041648812921861,7 k136974926331
Jun 200922 k69 k9222,9 k13 k6,3 k9631,8 k      5070119041648512921841,7 k136974926331
May 200922 k62 k9152,9 k13 k6,2 k9611,5 k      59991190416484  921821,7 k136774926331
Apr 200921 k60 k8712,9 k13 k6,2 k9601,5 k      77581190416484  921781,7 k135374926331
Mar 200921 k58 k8352,8 k12 k6,1 k9601,4 k      84421190416479  911721,7 k135374926331
Feb 200921 k56 k8102,8 k11 k6,0 k9511,4 k      161621190416478  811651,7 k135274926331
Jan 200920 k53 k8042,8 k11 k5,9 k9421,4 k      90171190416478  811651,7 k135274926331
Dec 200820 k50 k7952,8 k9,7 k5,8 k9401,3 k      57201190416478  7 1621,7 k134974926331
Nov 200819 k49 k7912,7 k8,6 k5,8 k9391,3 k      89351190416477  6 1591,6 k130874926331
Oct 200819 k47 k7842,7 k2,2 k5,7 k9381,3 k      76481190416477  6 1511,6 k130274926331
Sep 200818 k45 k7782,7 k2,2 k5,6 k9311,2 k      66831190416475  6 1511,6 k129174923331
Aug 200818 k44 k7712,7 k2,2 k5,6 k9261,2 k      75811190416475  6 1501,6 k128974923331
Jul 200818 k43 k7542,7 k2,2 k5,5 k9191,2 k      62651190416472  6 1471,6 k128674923331
Jun 200818 k42 k7382,6 k2,2 k5,4 k9151,1 k      86521190416472  6 1441,6 k128574923331
May 200817 k40 k7142,6 k2,2 k5,4 k9101,1 k      80661190416470  6 1441,6 k122974923331
Apr 200817 k39 k6952,6 k2,2 k5,2 k8951,1 k      64991189416469  6 1421,6 k121174923331
Mar 200817 k38 k6852,5 k2,2 k5,1 k8841,1 k      61141189416468  6 1411,6 k119774923331
Feb 200817 k35 k6742,5 k2,1 k5,0 k8731,0 k      57601188416466  6 1321,6 k119274923331
Jan 200816 k32 k6402,5 k2,1 k4,8 k860938      64231185416458  6 1301,6 k118574923331
Dec 200716 k29 k5012,4 k2,0 k4,7 k846892      68611185416455  6 1261,5 k118274923331
Nov 200716 k25 k4932,4 k1,9 k4,6 k808873      98771185416455  6 1221,5 k116074923331
Oct 200715 k23 k4642,4 k1,7 k4,5 k801858      75831184416452  6 1191,5 k116074923331
Sep 200715 k19 k4572,4 k1,4 k4,4 k797827      67111182416447  6 1151,5 k115974723331
Aug 200714 k16 k4482,3 k1,4 k4,4 k797797      57081173416426  6 1141,5 k115374723331
Jul 200714 k15 k4412,3 k1,4 k4,3 k791767      61331173416425  6 1141,5 k115374723331
Jun 200714 k14 k4052,3 k1,3 k4,2 k784748      96691173416423  6 1131,5 k115274723331
May 200713 k13 k3942,3 k1,3 k3,8 k782738      61291173416415  6 1101,5 k114074723331
Apr 200713 k12 k3152,3 k1,3 k3,7 k770720      52381172416412  5 1071,5 k114074723331
Mar 200712 k12 k3122,2 k1,3 k3,5 k744698      44071172416411  4 1031,5 k114074723331
Feb 200712 k11 k3062,2 k1,3 k3,5 k735681      45241172416409  4 931,5 k113874723331
Jan 200712 k11 k3002,2 k1,3 k3,4 k719637      57091171416408  4 731,4 k112874523331
Dec 200612 k11 k2932,2 k1,3 k3,3 k711598      83131169416408  4 671,4 k112774523331
Nov 200611 k10 k2892,1 k1,3 k3,2 k705562      93541165416404  4 601,4 k111974523331
Oct 200611 k9,8 k2852,1 k1,3 k3,1 k686500      62981162416400  4 601,4 k19674523331
Sep 200610 k9,3 k2812,0 k1,3 k3,1 k682484      79601162416397  4 601,4 k19074523331
Aug 200610 k8,9 k2671,9 k1,3 k2,9 k635430      88311162416360  4 591,3 k16974523331
Jul 20069,2 k7,9 k2581,8 k1,3 k2,7 k631367      53701160416343  4 591,3 k14974523331
Jun 20068,9 k7,6 k2541,8 k1,3 k2,7 k597360      60811158416339  4 581,2 k13774523331
May 20068,6 k7,2 k2401,7 k1,3 k2,5 k578347      57891153416324  4 571,2 k12974523331
Apr 20068,3 k6,9 k2381,7 k6742,3 k562338      56921153416320  4 551,2 k12974523331
Mar 20068,0 k6,5 k2161,7 k6742,3 k554316      66651153416310  4 531,2 k12874413331
Feb 20067,8 k6,0 k2011,6 k6742,2 k542271      38941150416298  4 501,2 k12374413331
Jan 20067,5 k5,7 k1971,6 k6732,1 k528259      63881149416270  4 441,1 k12374313331
Dec 20057,2 k5,3 k1931,5 k6732,0 k517248      60191143416260  4 431,1 k12373313331
Nov 20056,7 k4,9 k1841,5 k6591,7 k507235      46441141416254  4 371,1 k12373313331
Oct 20056,5 k4,6 k1801,4 k6581,6 k495231      50541139416230  4 351,0 k12363313231
Sep 20056,2 k4,2 k1781,4 k6581,5 k484213      50271139416225  4 341,0 k12263212231
Aug 20055,9 k3,9 k1781,4 k6581,4 k456205      54471139416222  4 341,0 k12263212231
Jul 20055,5 k3,7 k1661,3 k6561,3 k402194      46281138416207  4 3298112263212231
Jun 20055,2 k3,4 k1611,3 k6041,3 k398182      53831136416196  2 32957122631 2231
May 20054,9 k3,1 k1551,2 k711,1 k381151      43601136416193  1 29935122631 2231
Apr 20054,6 k2,8 k1521,2 k71818352144      51391136416185  1 29899122631 2231
Mar 20054,2 k2,6 k1471,2 k71500214122      52671134416173  1 2688312263  2231
Feb 20053,7 k2,4 k1421,2 k7142819896      47631134416167  1 2287812263  2231
Jan 20053,3 k2,2 k1171,1 k7133519571      43871133416159  1 1986012263  2231
Dec 20043,0 k2,0 k1151,1 k7128819063      28061125416141  1 1983212263  2231
Nov 20042,9 k1,9 k1071,0 k6625118762      38411114416129  1 1880312263  2231
Oct 20042,6 k1,7 k1059926623518258      42291112416120  1 1878612263  2231
Sep 20042,4 k1,5 k1019356616017554      6038119416106  1 1275212263  2231
Aug 20042,0 k1,4 k968726411915837      184111941691  1 1170812262  2131
Jul 20041,9 k1,3 k84864646911030      297411941685  1 1170612262  2131
Jun 20041,5 k1,2 k7584563477912      286411941683  1 869412251  2131
May 20041,4 k1,0 k728056129652      2856 1941674  1 866412251  2131
Apr 20041,3 k90962758311257         17 1659  1 464512221  2131
Mar 20041,1 k8415774731451         17 1659  1 463512221  2121
Feb 20041,1 k7655772931447         16 1657  1 362112221  2121
Jan 20041,0 k7285568930142         14 1657  1 158612211  2121
Dec 20039416945368229138         14 1657  1 1582122 1  2 21
Nov 200383766846672 132         14 1657  1 1572122 1  2 21
Oct 200374864937665 127         14 1657  1 1568122 1  2   
Sep 200367262935596 126         14 1657  1  501122    2   
Aug 200359939131434 18         14  146  1  358 22    1   
Jul 200349326529129 1           2  120     104 1    1   
Jun 20034682272922 1              1      20 1        
May 20034492162214 1              1      12 1        
Apr 20034192072014 1              1      12 1        
Mar 20034041962014 1              1      12 1        
Feb 20033761681911                1      9 1        
Jan 2003297150156                1      4 1        
Dec 2002261133114                       4          
Nov 2002241122113                       3          
Oct 2002215113113                       3          
Sep 200217210011                                   
Aug 20021619211                                   
Jul 2002155909                                   
Jun 2002149859                                   
May 2002137828                                   
Apr 2002134818                                   
Mar 2002107736                                   
Feb 2002104604                                   
Jan 200288474                                   
Dec 200174374                                   
Nov 200158314                                   

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

Nov 2001: 1 11 Logo suggestions , 2 10 Main Page , 3 8 Logo suggestions/Leading candidates , 4 8 Wikipedia drop-outs , 5 4 Policy discussion/Articles on commercial enterprises , 6 4 Species names (to be specific) , 7 3 Disability Etiquette , 8 3 Wikipedia Virtual Mind , 9 2 Wikipedia vandalism , 10 2 Wikipedia metadata management

Dec 2001: 1 7 Logo suggestions/Humorous logos , 2 6 Main Page , 3 6 Logo suggestions/Leading candidates , 4 5 Neutral point of view/draft , 5 5 Avoid copyright paranoia , 6 3 International Wikipedia question , 7 3 Wikipedia Client , 8 3 Axe grinding , 9 2 Logo suggestions , 10 2 Wikisource , 11 1 Columns in 30 minutes or less

Jan 2002: 1 14 Wikimedia merchandise , 2 4 Main Page , 3 4 Why there will always be debate in this project , 4 4 Wikipedia's first press release--draft for comment , 5 3 T-shirt vote summary , 6 3 Listing deleted titles

Feb 2002: 1 3 Main Page , 2 3 Uploads being abused , 3 3 Discussion on business models and organizational charters applicable to large free wikis , 4 2 Science Hypertextbook project , 5 1 Market research in progress at meta wikipedia

Mar 2002: 1 4 Science Hypertextbook project , 2 3 Main Page , 3 2 Discussion on business models and organizational charters applicable to large free wikis , 4 2 Proposed Wikipedia policy on foreign characters , 5 2 Wikipedia cloning project

Apr 2002: 1 7 Main Page , 2 5 The Wikipedia Community , 3 5 Response to 24 , 4 4 NPOV as description, not prescription , 5 4 Systemic Bias of Wikipedia , 6 3 Natural point of view , 7 3 T-shirt vote summary , 8 3 Kill the Stub Pages , 9 1 BP synopsis for ActiveUserWikiAdminCommunity

May 2002: 1 2 Main Page , 2 1 Errors in the Encyclopædia Britannica which have been corrected in Wikipedia

Jun 2002: 1 1 The best president to have a beer with

Jul 2002: 1 2 Wikipedia haiku , 2 1 The best president to have a beer with

Aug 2002: 1 5 Main Page , 2 3 Faith vs science with regard to the Wikipedia , 3 2 Wiki markup tables , 4 2 Worst cases

Sep 2002: 1 4 Main Page , 2 4 There is also an English Wikipedia available , 3 3 Avoid copyright paranoia , 4 2 Wikipedia timeline , 5 2 The Free Universal Encyclopedia and Learning Resource , 6 2 Wikipedia and copyright issues

Oct 2002: 1 12 What to do with www.wikipedia.org , 2 11 Main Page , 3 8 MediaWiki feature request and bug report discussion , 4 5 Hoofdpagina Nederlands , 5 5 There is also an English Wikipedia available , 6 4 Thoughts on Wikipedia interlanguage priorities , 7 4 Quelle utilisation pour www.wikipedia.org ? , 8 4 Wikipedia and corporate structure , 9 3 The need for some form of Wikipedia Yearbook , 10 3 Forside , 11 3 Ĉefpaĝo , 12 3 Consolidating vs breaking up , 13 3 Wikipedia and copyright issues , 14 2 Mailing list-s division , 15 2 Syndication feeds , 16 2 Empty page page , 17 2 Trophée du Libre (2003) , 18 2 Portada/es , 19 2 Unicode utilities , 20 2 Selige linguam Wikipediae maestro literaturae

Nov 2002: 1 6 Main Page , 2 5 The provisional portal of Wikipedia , 3 5 Wikipedia and copyright issues , 4 4 Dedicated Wikipedia editor , 5 3 Domena Polskiej Wikipedii , 6 3 TMC's sysop request , 7 2 Huvudsida , 8 2 Wiktionary , 9 1 MediaWiki feature request and bug report discussion

Dec 2002: 1 5 Wiktionary , 2 5 Thoughts on language integration , 3 4 Main Page , 4 4 WIKIng , 5 3 Niepożądane zachowania , 6 3 Wikipedians categorized by sub-cultural affiliation , 7 3 Wikipedia Client , 8 2 FormatSandbox , 9 2 Music markup , 10 2 XML syntax , 11 2 Machine-friendly wiki interface , 12 2 Wikitax (proposal) , 13 2 Wikimedia News

Jan 2003: 1 14 What to do with www.wikipedia.org , 2 5 Date formats in various languages , 3 4 Paper Wikipedia , 4 4 Linux user Wikimedians , 5 3 Main Page , 6 3 Meetup , 7 3 Burn All GIFs , 8 2 MediaWiki feature request and bug report discussion , 9 2 Cabal , 10 2 Protected pages considered harmful , 11 1 FormatSandbox

Feb 2003: 1 19 Wikipedia mascot , 2 6 Legion of Trolls , 3 3 Main Page , 4 3 Wikisource , 5 2 Minor , 6 2 Larry Sanger , 7 2 MediaWiki , 8 2 Linux user Wikimedians , 9 2 Date formats in various languages , 10 2 The ideal Wikimedia board of trustees , 11 2 Hoofdpagina Nederlands , 12 1 Unregistered user

Mar 2003: 1 37 Article count reform , 2 18 Wikipedia mascot , 3 9 Wiki stats other than the article count , 4 6 Main Page , 5 5 Automatic transformation of hyphens and dashes , 6 5 Wikimedia cache strategy evolution during 2003 , 7 4 What to do with entries related to September 11 casualties , 8 3 Legion of Trolls , 9 3 Wikipedia4 (proposal) , 10 3 Accueil , 11 3 The provisional portal of Wikipedia , 12 2 メインページ , 13 2 Compiler optimizations , 14 2 Wikimedia Foundation , 15 2 Kernel upgrade , 16 2 PHP caching and optimization , 17 1 Alternative PHP Cache

Apr 2003: 1 7 Main Page , 2 5 Wikipedia mascot , 3 4 User details special page , 4 3 Image pages , 5 3 Wikipedia is not Wiki , 6 3 Twelve leverage points , 7 3 Meetup , 8 2 ArbitraryLinkingDiscussion , 9 2 WikiPediaReasonable , 10 2 Image pages/Data syntax

May 2003: 1 8 Main Page , 2 6 Deletion management redesign , 3 6 Bans , 4 4 Wikipedia power structure , 5 4 GodKing , 6 4 Association of Wikimedians , 7 3 MediaWiki feature request and bug report discussion , 8 3 Language codes , 9 3 Bans and blocks/old , 10 3 User details special page , 11 3 Mac user Wikimedians , 12 3 Vegetarian Wikimedians , 13 2 Board manual , 14 2 Wikimedia charter , 15 2 List of WikiWomen , 16 2 Geospatial reference , 17 2 Move Text to Filesystem , 18 2 Permission grant extent , 19 1 Intermediate solution for interlanguage links

Jun 2003: 1 7 List of Wikimedians by religion , 2 6 Main Page , 3 6 List of Wikimedians by race and/or ethnicity , 4 6 List of Wikimedians by favorite color , 5 6 Wikimedia News , 6 5 Linux user Wikimedians , 7 3 Wikimedia Foundation , 8 3 Wikipedia mascot , 9 2 Wikipedians by favorite colour , 10 2 Using domains , 11 1 Intermediate solution for interlanguage links

Jul 2003: 1 22 International logo contest/Logos 1-25 , 2 16 International logo contest , 3 12 Wikipedia mascot , 4 11 Layout vote , 5 10 International logo contest/Logos 26-50 , 6 7 List of Wikimedians by religion , 7 7 Wikimedia News , 8 5 Main Page , 9 5 Concours international de logo , 10 4 Move meta.wikipedia.org to wikimedia.org , 11 4 国际图标竞赛 , 12 4 Wikipedia on CD/DVD , 13 4 Wikipedia software upgrade status , 14 3 Internationaler Logo-Wettbewerb , 15 3 Development policy , 16 3 Wikipedia Weekly News , 17 3 List of Wikimedians by favorite color , 18 2 Intermediate solution for interlanguage links , 19 2 Errors in the Encyclopædia Britannica which have been corrected in Wikipedia , 20 1 Wikivoyage/Goals and non-goals

Aug 2003: 1 162 International logo contest/Logos 1-25 , 2 121 International logo contest/Logos 76-100 , 3 113 International logo contest/Logos 126-150 , 4 111 International logo contest/Logos 26-50 , 5 108 International logo contest/Logos 51-75 , 6 92 International logo contest/Logos 101-125 , 7 21 Wikimedia press releases/500,000 Wikipedia articles , 8 12 Wikipedia mascot , 9 11 International logo contest/Vote instructions , 10 10 Premier communiqué de presse de Wikimédia , 11 9 Main Page , 12 8 Name of Wikipedia , 13 8 Wikipedia.org is more popular than... , 14 8 International logo contest , 15 8 List of Wikimedians by favorite color , 16 6 Maps , 17 5 Wikimedia Board of Trustees/Archive1 , 18 5 The ideal Wikimedia board of trustees , 19 5 The provisional portal of Wikipedia , 20 4 International logo contest/Finalists , 21 4 RK , 22 4 Internationale Logo-Wahl , 23 4 Wikimedia Foundation , 24 4 Wikipedia mascot/name , 25 4 MediaWiki

Sep 2003: 1 228 International logo contest/Ratification , 2 177 International logo contest/Ballot , 3 67 International logo contest/Logos 1-25 , 4 52 International logo contest/Logos 126-150 , 5 45 International logo contest/Logos 76-100 , 6 41 International logo contest/Logos 51-75 , 7 39 International logo contest/Logos 26-50 , 8 27 International logo contest/Vote on voting method , 9 24 International logo contest/Final logo variants , 10 24 International logo contest/Logos 101-125 , 11 21 Internationale Logo-Wahl/Stimmzettel , 12 18 International logo contest/Finalists , 13 15 Wikipedia mascot , 14 13 Wikimedia press releases/500,000 Wikipedia articles , 15 11 Main Page , 16 11 Why Wikipedia ran slow in late 2003 , 17 8 Wikimedia News , 18 7 Wikipedia raster name , 19 7 List of Wikimedians by religion , 20 6 International logo contest/Final logo variants/Nohat , 21 5 Linguistic democracy in a multilingual project , 22 5 Wikipedia.org is more popular than... , 23 5 International logo contest/Vote instructions , 24 4 International logo contest/Final logo variants/Paullusmagnus , 25 4 Deletionism

Oct 2003: 1 54 International logo contest/Final logo variants , 2 51 Link style vote , 3 24 Main Page , 4 18 International logo contest/Ratification , 5 14 Logo feedback , 6 11 Watchlist privacy , 7 11 International logo contest/Final logo variants/Nohat , 8 9 Wikipedia raster name , 9 7 WikiTrivia , 10 7 Cologne Blue skin problems , 11 7 The provisional portal of Wikipedia , 12 6 Sharing images across projects , 13 6 List of Wikimedians by religion , 14 6 List of Wikimedians by favorite color , 15 6 Linux user Wikimedians , 16 5 Wikipedia subtitle translations , 17 5 Queer Wikimedians , 18 4 Pure wiki deletion system (proposal) , 19 4 Linguistic democracy in a multilingual project , 20 4 Inclusionism , 21 4 Wikimedia press releases/500,000 Wikipedia articles , 22 4 Mac user Wikimedians , 23 4 Wikimedia News , 24 3 Embedding external images , 25 3 Wikipedia needs editors

Nov 2003: 1 9 Wikimedians by favorite text editor , 2 8 Main Page , 3 8 Wikimedia News , 4 6 Current issues , 5 6 Wikipedia , 6 5 List of Wikimedians by favorite ice cream flavor , 7 5 Current issues/Small Wikipedias , 8 5 Cologne Blue skin problems , 9 5 List of Wikimedians by favorite color , 10 5 Wikipedians categorized by sub-cultural affiliation , 11 4 Wikistress , 12 4 Non-American Wikimedians , 13 4 Interwiki bot , 14 4 Deletionism , 15 4 Wikimedia press releases/500,000 Wikipedia articles , 16 4 MediaWiki , 17 4 The provisional portal of Wikipedia , 18 4 Wikipedia software upgrade status , 19 3 Consumerium , 20 3 Egyptopedia , 21 3 Installer ideas , 22 3 MediaWiki development , 23 3 Referees , 24 3 Sharing images across projects , 25 3 Watchlist privacy

Dec 2003: 1 18 MediaWiki feature request and bug report discussion , 2 18 Wikimedia News , 3 12 Main Page , 4 8 Interwiki bot , 5 7 Wikimorial , 6 7 The provisional portal of Wikipedia , 7 6 Current issues , 8 5 Edits as patches , 9 5 Richtlijnen voor systeembeheerders/werk1 , 10 5 Wikipedia.org is more popular than... , 11 4 Wikimedia Embassy , 12 4 Proposal for dead links , 13 4 Message substitution , 14 4 Wikitravel , 15 4 Interwiki link problem , 16 4 Lorraine , 17 4 Wikimedia Foundation , 18 4 Queer Wikimedians , 19 3 Opera Arabic bug , 20 3 Interwiki bot/Getting started , 21 3 Field-value pairs , 22 3 Wikimedians by favorite text editor , 23 3 Sharing images across projects , 24 3 Wikipedia raster name , 25 3 List of Wikimedians by religion

Jan 2004: 1 12 MediaWiki feature request and bug report discussion , 2 11 Current issues , 3 9 Wikimedia News , 4 8 Wikimedia Embassy , 5 8 Wikipedia mascot , 6 6 Do fair use images violate the GFDL? , 7 6 Incivility , 8 6 Interwiki bot , 9 5 Main Page , 10 5 Windows user Wikimedians , 11 5 List of Wikimedians by religion , 12 4 The Wrong Version , 13 4 MediaWiki development , 14 4 Wikimedia press releases/500,000 Wikipedia articles , 15 4 Deletion management redesign , 16 4 Wikipedia software upgrade status , 17 3 Friends of gays should not be allowed to edit articles , 18 3 Sysop management , 19 3 Title length , 20 3 Source of conflict , 21 3 Guide to the dual-license , 22 3 Wikimedians who use PDAs , 23 3 Wikipedia.org is more popular than... , 24 3 Protected pages considered harmful , 25 3 Linux user Wikimedians

Feb 2004: 1 20 Wikimedia News , 2 16 Bureaucrat , 3 12 International names for Village Pump , 4 10 MediaWiki feature request and bug report discussion , 5 9 Thumbnailed images , 6 9 Wikimedia servers , 7 8 Main Page , 8 8 Language files to be updated , 9 8 Interwiki requests for adminship , 10 8 Wikipedia.org is more popular than... , 11 7 Current issues , 12 7 Wikipedia logo in each language , 13 6 Requests for logos , 14 6 Do fair use images violate the GFDL? , 15 6 Wikimedia press releases/500,000 Wikipedia articles , 16 5 Requests for permissions/Archive/Bureaucrat archive , 17 5 List of Wikimedians by religion , 18 4 Multilingual Wikimedians , 19 4 List of Wikimedians by favorite color , 20 4 Meetup , 21 4 Queer Wikimedians , 22 3 Wikivoyage/Goals and non-goals , 23 3 Wikimedia Embassy , 24 3 Numberpedia , 25 3 MediaWiki/ja

Mar 2004: 1 84 Stewards/elections 2004 , 2 71 Thumbnailed images , 3 50 Edit summary prefill poll , 4 19 Wikimedia News , 5 17 MediaWiki feature request and bug report discussion , 6 17 Main Page , 7 16 Mailing list merge , 8 15 Requests for logos , 9 13 Foundation-L Proposal , 10 12 Extension Syntax , 11 11 Interwiki requests for adminship , 12 10 Administrators of Wikimedia projects/Wikipedias , 13 9 Goings-on/March 2004 , 14 9 Wikipedia.org is more popular than... , 15 9 List of Wikimedians by religion , 16 7 Sidebar behavior poll , 17 7 Wikipedia logo in each language , 18 6 Steward requests/Permissions , 19 6 System administrators , 20 6 Edit summary prefill poll (2) , 21 6 The provisional portal of Wikipedia , 22 5 Wikimedia Embassy , 23 5 List of Wikimedians by age , 24 5 EasyTimeline , 25 5 WYSIWYG editor

Apr 2004: 1 48 Stewards/elections 2004 , 2 36 Steward requests/Permissions , 3 33 List of Wikimedians by age , 4 23 Extension Syntax , 5 22 Extension Syntax/Voting , 6 20 MediaWiki feature request and bug report discussion , 7 19 Wikimedia News , 8 14 Wikimedia Embassy , 9 13 Stewards , 10 13 Main Page , 11 12 Wikimedians by favorite text editor , 12 11 IRC/Channels , 13 11 MediaWiki roadmap , 14 10 Articles on fr with no interwiki link to en , 15 10 Administrators of Wikimedia projects/Wikipedias , 16 9 Requests for logos , 17 9 Wikipedia logo in each language , 18 8 Goings-on/April 2004 , 19 8 System administrators , 20 8 Language files to be updated , 21 7 Stewards policy , 22 7 Multilingual Wikimedians , 23 7 List of Wikimedians by religion , 24 6 Wikipedia power structure , 25 6 Articles on fr with no interwiki link to en/A

May 2004: 1 100 MediaWiki 1.3 comments and bug reports/Archive , 2 28 Board elections/2004/Candidates , 3 26 List of Wikimedians by MBTI type , 4 24 MediaWiki feature request and bug report discussion , 5 23 List of articles every Wikipedia should have , 6 23 Translation/list , 7 23 Board elections/2004/Notice translation , 8 23 Wikimedia News , 9 22 Requests for Wiktionary permissions , 10 21 Steward requests/Permissions , 11 16 Press Corps , 12 15 Main Page , 13 15 Wikipedia languages , 14 14 Server outage message , 15 13 List of Wikimedians by age , 16 12 Artificial languages , 17 12 Offensive content , 18 10 Election Notice Translation , 19 10 Board elections/2004/FAQ , 20 10 Goings-on/May 2004 , 21 10 List of Wikimedians by birthday , 22 10 IRC/Channels , 23 10 MediaWiki roadmap , 24 9 Wikimedians by geekiness , 25 8 Requests for logos

Jun 2004: 1 96 MediaWiki 1.3 comments and bug reports/Archive , 2 80 Artificial languages equal rights , 3 26 Board vote poll , 4 26 List of Wikimedians by MBTI type , 5 23 MediaWiki feature request and bug report discussion , 6 23 Steward requests/Permissions , 7 22 Wikimedia News , 8 18 Main Page , 9 17 Wikipedia languages , 10 15 Wikimedia chapters , 11 15 List of articles every Wikipedia should have , 12 14 List of Wikimedians by age , 13 14 Article validation , 14 13 Administrators of Wikimedia projects/Wikipedias , 15 12 Grants given to Wikimedia Foundation , 16 12 Membership fees , 17 12 Goings-on , 18 12 Requests for logos , 19 12 Wikimedia servers , 20 9 Polls are evil , 21 9 Gallery of user styles , 22 9 IRC/Quotes , 23 8 Q3 and Q4 2004 hardware order worksheet , 24 8 Official position history , 25 8 Interwiki map

Jul 2004: 1 27 Steward requests/Permissions , 2 20 MediaWiki 1.3 comments and bug reports/Archive , 3 16 Main Page , 4 16 Wikimedia Embassy , 5 16 Wikimedia Deutschland/Chat , 6 15 Wikimedia News , 7 14 Foundation website meeting, July 2004 , 8 14 NEH Reference materials grant application/Narrative , 9 14 Interwiki bot , 10 14 List of Wikimedians by religion , 11 13 List of Wikimedians by age , 12 12 MediaWiki feature request and bug report discussion , 13 12 Developer payment/Arguments for and against payment , 14 12 Fragen der Süddeutschen Zeitung , 15 11 Artificial languages equal rights , 16 10 GALILEO Masters 2004 , 17 10 List of Wikimedians by birthday , 18 10 IRC/Channels , 19 9 GALILEO Masters 2004/Questionaire , 20 9 Opt-in Google-ads , 21 9 Wikimedia auf Messen , 22 9 Wikipedia languages , 23 9 IRC/Quotes , 24 9 Requests for logos , 25 8 What we use the money for

Aug 2004: 1 25 Steward requests/Permissions , 2 24 Wikimedia News , 3 20 MediaWiki 1.3 comments and bug reports/Archive , 4 19 List of Wikimedians by age , 5 14 Developer committee , 6 14 List of Wikimedians by birthday , 7 10 Main Page , 8 9 MediaWiki feature request and bug report discussion , 9 9 Artificial languages equal rights , 10 8 Wikimedia press releases/One million Wikipedia articles (int'l) , 11 8 Copyediting , 12 8 Wikimedia projects , 13 8 List of Wikimedians by MBTI type , 14 7 Changing username , 15 7 Wikimedia Commons , 16 7 Requests for logos , 17 6 Wikimedia Press Team , 18 6 Golden Nica Awards 2004 , 19 6 Translation/list , 20 6 IRC/Quotes , 21 6 Wikimedians by geekiness , 22 6 WikiMen , 23 6 Administrators of Wikimedia projects/Wikipedias , 24 6 Windows user Wikimedians , 25 6 Wikistress

Sep 2004: 1 64 Wikimania 2005 overview , 2 33 Translation requests/PR-1mil , 3 32 Translation requests/NL-1/En: , 4 27 Steward requests/Permissions , 5 22 Wikimedia News , 6 16 Translation requests/NL-1 , 7 16 Developer activity , 8 15 Main Page , 9 15 Translation requests/NL-1/Ja: , 10 15 Wikimedia press releases/One million Wikipedia articles (int'l) , 11 15 List of Wikimedians by birthday , 12 14 Foundation wiki feedback , 13 14 Wikimedia projects , 14 13 Translation requests/NL-1/Fr: , 15 13 Translation requests/ancient , 16 12 Press release logbook/pr-1mil/En: , 17 12 Translation requests/NL-1/De: , 18 11 Translation requests/WMF/Fundraising pages , 19 11 Translation requests/NL-1/It: , 20 11 Proposals for new projects , 21 10 Request for an account on the Foundation wiki , 22 10 Translation requests/NL-1/Es: , 23 10 Troisième communiqué de presse , 24 10 Edit conflict handling suggestion , 25 10 Non-development tasks for developers

Oct 2004: 1 138 Wikinews/Vote , 2 58 Wikimania 2005 participants , 3 34 Wikimania 2005 overview , 4 30 Steward requests/Permissions , 5 30 Wikinews/Vote/de , 6 28 Association of Inclusionist Wikipedians , 7 21 Wikinews/Vote/fr , 8 20 Wikinews/License straw poll , 9 19 Wikijunior , 10 19 Wikimedia meetup 2005/City Candidate List , 11 19 Association of Deletionist Wikipedians , 12 17 Wikijunior/Project name/Candidate nominations , 13 17 Wikimedia News , 14 14 Wikinews/Vote/ja , 15 14 Newsletter poll , 16 12 Wikinews/Logo/Proposals , 17 12 Translation requests/NL-1/Annc , 18 11 List of Wikimedians by age , 19 11 Wikinews/Vote/Zh/20041022 , 20 11 Translation requests/NL-1 , 21 11 Non-development tasks for developers , 22 10 Main Page , 23 10 Translation of the week , 24 10 Translation requests/WMF , 25 10 21C3

Nov 2004: 1 53 Wikinews/Vote , 2 37 Translation of the week/Translation candidates , 3 32 Translation of the week/2004 translations/Archive , 4 30 Wikimania 2005 participants , 5 29 Translation of the week , 6 28 Wikimania:Name/Vote , 7 27 Steward requests/Permissions , 8 27 Wikimedia News , 9 23 Realtime recent changes , 10 21 Main Page , 11 20 Wikijunior , 12 20 Association of Inclusionist Wikipedians , 13 19 Reports/October 2004/Wikipedia , 14 17 Wikijunior/Project name/Candidate nominations , 15 17 Association of Deletionist Wikipedians , 16 13 Wikijunior project first topics , 17 12 Firefox extension , 18 12 Wikimania 2005 banner , 19 11 Inactive wikis , 20 10 Bar , 21 10 Reports/October 2004/Wiktionary , 22 10 Goings-on , 23 10 List of Wikimedians by birthday , 24 10 List of Wikimedians by religion , 25 9 Wikinews/Vote/ja

Dec 2004: 1 59 Wikinews/Start a new edition , 2 32 Translation of the week/Translation candidates , 3 30 Redirect arrow contest , 4 28 Steward requests/Permissions , 5 24 Translation of the week/2004 translations/Archive , 6 24 Wikinews/Logo/Proposals , 7 23 WQ/Draft , 8 21 Wikimedia News , 9 18 Main Page , 10 18 Translation of the week , 11 18 Association of Inclusionist Wikipedians , 12 17 Wikispelling , 13 15 WQ/Name , 14 14 Translation requests/WQ/2 , 15 12 Proposals for new projects , 16 11 Wikimedians who blog , 17 11 21C3 , 18 10 Wikinews/License straw poll , 19 9 WQ/Team , 20 9 Translation requests/ancient , 21 9 Wikinews , 22 8 Realtime recent changes , 23 8 List of Wikimedians by MBTI type , 24 8 List of Wikimedians by birthday , 25 7 Association of Mergist Wikipedians

Jan 2005: 1 161 Wikinews logo contest voting , 2 43 Nofollow , 3 35 Wikinews/Start a new edition , 4 28 Translation of the week/Translation candidates , 5 26 Www.wikipedia.org portal , 6 22 Steward requests/Permissions , 7 20 Proposals for new projects , 8 19 Translation requests/WQ/2 , 9 19 Requests for new languages , 10 19 Wikimedia News , 11 18 Translation of the week/2005 translations/Archive , 12 18 Edit hints , 13 16 Main Page , 14 12 Wikimania 2005 overview , 15 12 Goings-on , 16 12 Association of Inclusionist Wikipedians , 17 11 Www.wikipedia.org portal/Catherine , 18 11 List of Wikipedias , 19 10 Translation of the week/2004 translations/Archive , 20 10 Wikinews/Logo/Proposals , 21 9 Wikinews Chat , 22 9 Redirect arrow contest , 23 9 Translation of the week , 24 9 Administrators of Wikimedia projects/Wikipedias , 25 9 Wikimedia servers

Feb 2005: 1 92 Wikinews logo contest voting/Runoff , 2 51 Wikinews/China , 3 48 Steward requests/Permissions , 4 30 Wikinews/Start a new edition , 5 27 Translation requests/WMF/Fundraising pages , 6 24 Translation requests/WQ/2 , 7 23 Nofollow , 8 21 Main Page , 9 20 Translation of the week/2005 translations/Archive , 10 20 Translation of the week/Translation candidates , 11 19 Wikimedia News , 12 17 Requests for new languages , 13 17 Wikimania 2005 banner , 14 16 Proposals for new projects , 15 15 Association of Inclusionist Wikipedians , 16 13 MediaWiki feature request and bug report discussion , 17 13 Goings-on , 18 13 List of Wikipedias , 19 12 Translation requests/WMF , 20 12 Wikipedia logo in each language , 21 11 日本語版ウィクショナリーの整備 , 22 10 Request for an account on the Foundation wiki , 23 10 Wikinews Chat , 24 10 Wikimania 2005 participants , 25 9 Foundation wiki feedback

Mar 2005: 1 48 Steward requests/Permissions , 2 24 Translation requests/WQ/2 , 3 23 Wikinews/Start a new edition , 4 20 Wikimedia News , 5 19 Association of Inclusionist Wikipedians , 6 17 Translation requests/Wikimania , 7 17 Board agenda/Open questions , 8 17 Presentations , 9 16 List of Wikipedias , 10 15 Translation of the week/2005 translations/Archive , 11 15 Requests for logos , 12 14 Main Page , 13 14 WQ/Retro , 14 13 Requests for new languages , 15 13 Translation of the week/Translation candidates , 16 12 日本語版ウィクショナリーの整備 , 17 11 Goings-on , 18 10 Ignore all rules , 19 10 List of Wikimedians by age , 20 10 Proposals for new projects , 21 10 Administrators of Wikimedia projects/Wikipedias , 22 9 Translation requests/WMF , 23 9 Translation requests/ancient , 24 9 Non-development tasks for developers , 25 9 Interwiki map

Apr 2005: 1 52 Steward requests/Permissions , 2 29 CheckUser , 3 25 Requests for new languages , 4 25 Wikimedia News , 5 22 Translation requests/Wikimania , 6 22 Translation of the week/Translation candidates , 7 18 Wikinews/Start a new edition , 8 17 Translation requests/WMFnews , 9 17 Wikimedia COTW/Help , 10 17 Translation of the week/2005 translations/Archive , 11 17 MediaWiki FAQ , 12 16 List of Wikipedias , 13 13 Wikimedia Embassy , 14 13 Proposals for new projects , 15 13 Association of Inclusionist Wikipedians , 16 12 List of Wikimedians by age , 17 12 Goings-on , 18 11 Registration begins for Wikimania 2005 , 19 11 Vandalism reports , 20 11 Translation requests/ancient , 21 11 List of Wikimedians by birthday , 22 11 Administrators of Wikimedia projects/Wikipedias , 23 10 Legal department/Historical , 24 10 Wikimedia COTW , 25 10 Translation of the week

May 2005: 1 208 Stewards/elections 2005 , 2 43 Steward requests/Permissions , 3 28 Requests for new languages , 4 25 En validation topics , 5 25 Wikinews/Start a new edition , 6 25 Translation of the week/Translation candidates , 7 22 Wikimedia News , 8 21 Proposals for new projects , 9 18 Board elections/2005/Notice translation , 10 18 Translation of the week/2005 translations/Archive , 11 16 Wikimedia Deutschland/Vorstandswahlen 2005 , 12 16 IRC/Quotes , 13 15 List of Wikipedias , 14 15 Administrators of Wikimedia projects/Wikipedias , 15 14 List of Wikimedians by age , 16 14 Wikimedia Research Network , 17 14 Board elections/2005/FAQ , 18 14 Translation requests/WMFnews , 19 12 Wikinews design contest , 20 12 Interwiki bot , 21 12 Sites using MediaWiki , 22 11 Board elections/2005/Candidates , 23 11 Translation requests/quick translation , 24 11 Wikimedia projects , 25 11 Translation/list

Jun 2005: 1 60 Steward requests/Permissions , 2 59 Requests for new languages , 3 31 Wikimedia Research Network , 4 31 Wikimedia News , 5 28 Wikijunior/Project name/Vote , 6 22 List of Wikipedias , 7 20 Wikimedia CH/Archive , 8 19 Board elections/2005/Notice translation , 9 19 Board elections/2005/Candidates , 10 17 Translation of the week/Translation candidates , 11 17 Proposals for new projects , 12 16 Wikimedia Research Network/Interests , 13 16 Translation of the week/2005 translations/Archive , 14 14 Wikimedia servers , 15 13 List of Wikimedians by age , 16 13 Board elections/2005/Interface translation , 17 13 MediaWiki 1.5 upgrade , 18 12 Board elections/2005/Candidates/fr , 19 12 En validation topics , 20 12 Association of Wikipedians Who Dislike Making Broad Judgments About the Worthiness of a General Category of Article, and Who Are in Favor of the Deletion of Some Particularly Bad Articles, but That Doesn't Mean They Are Deletionists , 21 12 Wikimedia chapters , 22 11 A new look at the interwiki link , 23 11 Wikijunior/Project name/Final vote , 24 11 Administrators of Wikimedia projects/Wikipedias , 25 11 Sites using MediaWiki

Jul 2005: 1 82 Steward requests/Permissions , 2 34 Requests for new languages , 3 32 Board elections/2005/Results , 4 30 Wikimedia News , 5 27 Wikinews/Start a new edition , 6 27 Proposals for new projects , 7 25 Translation of the week/Translation candidates , 8 23 WikiProject Chess , 9 21 List of Wikipedias , 10 18 Translation of the week/2005 translations/Archive , 11 17 Proposal for Sinitic linguistic policy , 12 17 Capital and small letters for interwiki , 13 16 Sites using MediaWiki , 14 14 Wikimedia Research Network , 15 14 MediaWiki FAQ , 16 12 Association of Wikipedians Who Dislike Making Broad Judgments About the Worthiness of a General Category of Article, and Who Are in Favor of the Deletion of Some Particularly Bad Articles, but That Doesn't Mean They Are Deletionists , 17 12 List of Wikimedians by birthday , 18 11 Wikinews/Future Talk , 19 11 Www.wikipedia.org template/temp , 20 11 Goings-on , 21 10 List of Wikimedians by age , 22 10 Interwiki bot/Warnfiles , 23 9 MediaWiki extensions , 24 8 Toytoy's proposed policy for wiki closure , 25 8 Slavopedia

Aug 2005: 1 95 Steward requests/Permissions , 2 39 Requests for new languages , 3 33 Proposals for new projects , 4 29 Wikimedia News , 5 27 International Wikinews Writing Contest , 6 24 List of Wikipedias , 7 21 Wikimania 2006/Planning , 8 21 Fund drives/2005/Q3 planning/Translations , 9 21 Proposal for Sinitic linguistic policy , 10 20 Translation of the week/2005 translations/Archive , 11 16 Wikimania:Blog , 12 16 Wikinews/Start a new edition , 13 14 Translation of the week/Translation candidates , 14 12 Improving on Wikimania 2005 , 15 12 Fund drives/2005/Q3 planning/Translations/Fundraising drive letter - en , 16 12 Goings-on , 17 12 MediaWiki FAQ , 18 12 Eliminating index.php from the url , 19 11 Wikijunior/Kiki character/Designs/Second last round , 20 11 Spam blacklist , 21 11 Wikinews/License straw poll , 22 11 Rewrite Rules , 23 11 Wikimedia chapters , 24 10 Wikinews/Licensure Poll , 25 10 Fund drives/2005/Q3 planning

Sep 2005: 1 157 Wikiversity/Vote/Votes yes , 2 88 Steward requests/Permissions , 3 56 Wikiversity/Vote/Votes no , 4 47 Requests for new languages , 5 33 International Wikinews Writing Contest , 6 32 Multilingual error messages/Translations , 7 32 International Wikinews Writing Contest/log , 8 28 Proposal for Sinitic linguistic policy , 9 27 Wikinews/Licensure Poll/CC-BY/For , 10 25 Wikimedia News , 11 23 Proposals for new projects , 12 18 Translation of the week/2005 translations/Archive , 13 18 Translation of the week/Translation candidates , 14 18 List of Wikipedias , 15 14 Wikinews/Licensure Poll/WNL2/For , 16 14 Goings-on , 17 12 Botopedia , 18 12 Wikinews/Licensure Poll/WNL2/Oppose , 19 12 Wikinews/Licensure Poll/GFDL/Oppose , 20 11 Ignore all rules , 21 11 Wikiversity , 22 11 Wikinews/Start a new edition , 23 11 Interwiki map , 24 10 Spam blacklist , 25 10 Association of Wikipedians Who Dislike Making Broad Judgments About the Worthiness of a General Category of Article, and Who Are in Favor of the Deletion of Some Particularly Bad Articles, but That Doesn't Mean They Are Deletionists

Oct 2005: 1 129 Wikiversity/Vote/Votes yes , 2 80 Steward requests/Permissions , 3 53 Requests for new languages , 4 51 Wikiversity/Vote/Votes no , 5 37 Wikimania 2006/Why and why not? , 6 30 Proposals for new projects , 7 25 Requests for new languages/Old requests archive/Approved , 8 25 Wikimedia News , 9 21 Administrators of Wikimedia projects/Wikipedias , 10 20 Translation of the week/Translation candidates , 11 19 List of Wikipedias , 12 16 Toolserver , 13 16 Wikinews/Start a new edition , 14 14 Wikimania 2006/Planning , 15 14 International Wikinews Writing Contest/log , 16 14 Translation of the week/2005 translations/Archive , 17 14 Association of Wikipedians Who Dislike Making Broad Judgments About the Worthiness of a General Category of Article, and Who Are in Favor of the Deletion of Some Particularly Bad Articles, but That Doesn't Mean They Are Deletionists , 18 13 Wikimedia UK v1.0 , 19 12 Ignore all rules , 20 12 Requests for new languages/Wikipedia Dutch Low Saxon , 21 11 Multilingual error messages/Translations , 22 11 Requests for new languages/Wikipedia Lombard , 23 11 IRC/Quotes , 24 10 Wikimania 2006/Boston , 25 10 International Wikinews Writing Contest

Nov 2005: 1 89 Requests for new languages , 2 73 Steward requests/Permissions , 3 37 Steward requests/Bot status , 4 35 Requests for new languages/Wikipedia Murcian Spanish , 5 28 Proposals for new projects , 6 23 Wikimedia News , 7 20 CheckUser policy , 8 18 Ignore all rules , 9 18 Administrators of Wikimedia projects/Wikipedias , 10 15 List of Wikipedias , 11 14 Requests for new languages/Old requests archive/Approved , 12 14 Translation of the week/Translation candidates , 13 12 Translation of the week/2005 translations/Archive , 14 12 Association of Deletionist Wikipedians , 15 12 Sites using MediaWiki , 16 11 Requests for new languages/Old requests archive/Native speaker support , 17 11 List of Wikimedians by age , 18 11 Toolserver , 19 11 Wikinews/Start a new edition , 20 11 Wikimedia UK v1.0 , 21 10 Wikimedia Research Network , 22 10 Goings-on , 23 10 MediaWiki FAQ , 24 9 November 2005 image server , 25 9 Louvre forbids taking photographs

Dec 2005: 1 218 Stewards/elections 2006 , 2 71 Steward requests/Permissions , 3 68 Fund drives/2005/Q4 planning/Translations , 4 56 Steward requests/Bot status , 5 47 Requests for new languages , 6 32 Translation of the week/Translation candidates , 7 29 Request for an account on the Foundation wiki , 8 26 Wikimedia News , 9 25 Proposals for new projects , 10 21 Wikinews/Start a new edition , 11 21 List of Wikipedias , 12 19 Ignore all rules , 13 18 Association of Wikipedians Who Dislike Making Broad Judgments About the Worthiness of a General Category of Article, and Who Are in Favor of the Deletion of Some Particularly Bad Articles, but That Doesn't Mean They Are Deletionists , 14 16 Translation of the week/2005 translations/Archive , 15 14 Administrators of Wikimedia projects/Wikipedias , 16 13 Requests for new languages/Old requests archive/Approved , 17 13 Foundation wiki feedback , 18 13 Requests for new languages/Wikipedia Ladin , 19 13 Spam blacklist , 20 13 MediaWiki FAQ , 21 13 Sites using MediaWiki , 22 12 Goings-on , 23 11 Association of Deletionist Wikipedians , 24 11 Wikimedia servers , 25 10 Fund drives/2005/Q4 planning/Translations/Fundraising drive letter - fr

Jan 2006: 1 126 Stewards/elections 2006 , 2 105 Requests for new languages , 3 87 Steward requests/Permissions , 4 70 Steward requests/Bot status , 5 39 9/11 wiki move proposal , 6 35 Translation of the week/Translation candidates , 7 32 Wiki for standards/Vote , 8 32 Proposals for new projects , 9 30 List of Wikipedias , 10 28 Ignore all rules , 11 27 Wikimedia News , 12 21 Requests for new languages/Old requests archive/Non-natural , 13 18 Steward requests/Permissions/2006-01 , 14 18 Toolserver , 15 17 MediaWiki FAQ , 16 16 Translation of the week/2006 translations/Archive , 17 14 Requests for new languages/Old requests archive/Approved , 18 14 Request for an account on the Foundation wiki , 19 14 Wikimedia Canada/Participants , 20 14 Spam blacklist , 21 14 Administrators of Wikimedia projects/Wikipedias , 22 13 Stewards , 23 13 Wikimedia Australia , 24 13 Fund drives/2005/Q4 planning/Translations , 25 13 Association of Wikipedians Who Dislike Making Broad Judgments About the Worthiness of a General Category of Article, and Who Are in Favor of the Deletion of Some Particularly Bad Articles, but That Doesn't Mean They Are Deletionists

Feb 2006: 1 54 Steward requests/Bot status , 2 53 Steward requests/Permissions , 3 36 Wikimedia News , 4 26 Wikinews/Vote/zh , 5 25 Requests for new languages , 6 23 Translation of the week/Translation candidates , 7 22 Ignore all rules , 8 21 Wikimedia Canada/Participants , 9 21 List of Wikipedias , 10 18 Proposals for new projects , 11 17 Google Grants , 12 17 Wikimedia Foundation Board meetings , 13 14 Translation of the week/2006 translations/Archive , 14 14 MediaWiki FAQ , 15 13 Association of Wikipedians Who Dislike Making Broad Judgments About the Worthiness of a General Category of Article, and Who Are in Favor of the Deletion of Some Particularly Bad Articles, but That Doesn't Mean They Are Deletionists , 16 13 Sites using MediaWiki , 17 11 Communications committee , 18 11 IRC/Quotes , 19 10 Wikimedia press releases/English Wikipedia hits milestone 1 million articles , 20 10 Wikimania 2006/Program Team , 21 10 Association of Deletionist Wikipedians , 22 10 Administrators of Wikimedia projects/Wikipedias , 23 10 Wikiquote , 24 9 Wikimedia Taiwan/發起人名冊/非正式 , 25 9 Goings-on

Mar 2006: 1 86 Steward requests/Permissions , 2 78 Requests for new languages , 3 55 Steward requests/Bot status , 4 39 Proposals for new projects , 5 38 Wikimedia News , 6 23 Translation of the week/Translation candidates , 7 21 Office actions , 8 21 List of Wikipedias , 9 20 Requests for new languages/Old requests archive/Approved , 10 18 Wikinews/Start a new edition , 11 17 Translation of the week/2006 translations/Archive , 12 16 Wikinews/Vote/zh , 13 16 MediaWiki FAQ , 14 15 Wikimedia press releases/English Wikipedia hits milestone 1 million articles , 15 14 Foundation wiki feedback , 16 14 Cite/Cite.php , 17 14 Steward requests/Checkuser , 18 13 Ignore all rules , 19 13 Spam blacklist , 20 12 Request for an account on the Foundation wiki , 21 12 Wikimedia Taiwan/發起人名冊/非正式 , 22 12 List of Wikimedians by birthday , 23 12 Administrators of Wikimedia projects/Wikipedias , 24 11 Toolserver , 25 11 IRC/Quotes

Apr 2006: 1 106 Requests for new languages , 2 84 Steward requests/Permissions , 3 60 Proposals for closing projects , 4 53 Wikimedia Taiwan/命名投票 , 5 48 Steward requests/Bot status , 6 41 Wikimedia News , 7 32 Proposals for new projects , 8 26 Translation of the week/Translation candidates , 9 24 OTRS/Personnel , 10 22 List of Wikipedias , 11 21 Ignore all rules , 12 21 MediaWiki FAQ , 13 20 Office actions , 14 18 Summer of Code 2006 , 15 15 Translation of the week/2006 translations/Archive , 16 14 Spam blacklist , 17 13 Toolserver , 18 13 IRC/Quotes , 19 12 Requests for new languages/Old requests archive/Approved , 20 12 Requests for new languages/Old requests archive/Non-natural , 21 12 Steward requests/Permissions/2006-04 , 22 10 Requests for new languages/Ancient , 23 10 Snowball clause , 24 10 Wikimedia Taiwan/發起人名冊/非正式 , 25 10 Steward requests/Checkuser

May 2006: 1 78 Steward requests/Permissions , 2 64 Requests for new languages , 3 47 Wikimedia News , 4 39 Requests for new languages/Ancient , 5 37 Proposals for closing projects , 6 33 Requests for new languages/Wikipedia Montenegrin , 7 25 Translation of the week/Translation candidates , 8 19 Wikimedia Hong Kong/會員召募/初步意向調查 , 9 19 Proposals for new projects , 10 19 List of Wikipedias , 11 17 Requests for new languages/Old requests archive/Non-natural , 12 15 IRC/Quotes , 13 14 Request for an account on the Foundation wiki , 14 14 Translation of the week/2006 translations/Archive , 15 14 Toolserver , 16 14 Goings-on , 17 13 Requests for new languages/Old requests archive/Approved , 18 13 Foundation wiki feedback , 19 13 Ignore all rules , 20 13 Steward requests/Checkuser , 21 12 Requests for new languages/Old requests archive/Native speaker support , 22 12 Translation requests/Wikimania/Announcements , 23 11 Wikinews/Start a new edition , 24 11 IRC/Channels , 25 10 Snowball clause

Jun 2006: 1 122 Proposals for closing projects , 2 104 Requests for new languages , 3 73 Steward requests/Permissions , 4 39 Wiktionary/logo/archive-vote-1 , 5 36 Wikimedia News , 6 32 Wikimedia Incubator/logo , 7 31 Translation of the week/Translation candidates , 8 26 Requests for new languages/Wikipedia Montenegrin , 9 24 Translation requests/Wikimania/June notice , 10 22 Requests for new languages/Old requests archive/Non-natural , 11 22 Wikimedia Incubator/name , 12 21 Requests for new languages/Ancient , 13 20 List of Wikipedias , 14 18 Wikibooks/Logo/Archive 1 , 15 18 Fundraising committee/2006/Main page , 16 18 Proposals for new projects , 17 14 Toolserver/New accounts , 18 14 Steward requests/Bot status , 19 13 IRC/Quotes , 20 12 Translation of the week/2006 translations/Archive , 21 12 Spam blacklist , 22 11 Request for an account on the Foundation wiki , 23 11 Svensk lokalförening , 24 11 Association of Wikipedians Who Dislike Making Broad Judgments About the Worthiness of a General Category of Article, and Who Are in Favor of the Deletion of Some Particularly Bad Articles, but That Doesn't Mean They Are Deletionists , 25 10 Requests for new languages/Old requests archive/Approved

Jul 2006: 1 89 Wikimedia Incubator/logo , 2 73 Steward requests/Permissions , 3 70 Requests for new languages , 4 67 Proposals for closing projects , 5 45 Wiktionary/logo/archive-vote-1 , 6 39 Wikimedia Incubator/name , 7 26 Wikimedia News , 8 23 Wikibooks/Logo/Archive 1 , 9 23 Proposals for new projects , 10 22 Translation of the week/Translation candidates , 11 17 Election translations 2006 , 12 17 Steward requests/Checkuser , 13 15 Toolserver/New accounts , 14 15 Steward requests/Bot status , 15 14 Ignore all rules , 16 13 List of Wikipedias , 17 13 Administrators of Wikimedia projects/Wikipedias , 18 12 Foundation wiki feedback , 19 12 Snowball clause , 20 12 Translation of the week/2006 translations/Archive , 21 10 Spam blacklist , 22 9 Requests for new languages/Old requests archive/Approved , 23 9 Request for an account on the Foundation wiki , 24 9 Medical dictionary wiki , 25 9 IRC/Quotes

Aug 2006: 1 174 Requests for new languages , 2 95 Steward requests/Permissions , 3 69 Board elections/2006/Candidates/en , 4 32 Election translations 2006 , 5 28 Proposals for new projects , 6 27 Wikimedia News , 7 26 Wiktionary/logo/archive-vote-1 , 8 26 Wikinews/Start a new edition , 9 24 Translation of the week/Translation candidates , 10 23 Proposals for closing projects , 11 22 List of Wikipedias , 12 20 Ignore all rules , 13 20 Wikiversity/Logo/archive-vote-1 , 14 20 Translator in the following language combinations , 15 20 Board elections/2006/Candidates/de , 16 18 Requests for new languages/Ancient , 17 17 Board elections/2006/Candidates/fr , 18 15 Translation of the week/2006 translations/Archive , 19 15 List of Wikimedians by birthday , 20 14 Requests for new languages/Wikipedia Montenegrin , 21 13 Stewards , 22 13 Wikimania 2007/Taipei , 23 13 OTRS/Personnel , 24 13 Help Forum , 25 13 Spam blacklist

Sep 2006: 1 131 Wikiversity/Logo/archive-vote-1 , 2 130 Wiktionary/logo/archive-vote-1 , 3 115 Requests for new languages , 4 105 Wikibooks/Logo/Archive 1 , 5 82 Steward requests/Permissions , 6 58 Requests for permissions/CommonsDelinker , 7 45 Snowball clause , 8 45 Proposals for closing projects , 9 42 Wikimania 2007/Torino , 10 31 Wikimania 2007/Taipei , 11 31 Wikimedia News , 12 27 Wikibooks/Logo/Archive 3 , 13 27 Wikinews/Start a new edition , 14 21 Ignore all rules , 15 20 Requests for new languages/Ancient , 16 20 Translation of the week/Translation candidates , 17 19 Wikiversity/Logo/archive-vote-3 , 18 19 List of Wikipedias , 19 18 OTRS/Personnel , 20 17 Wiktionary/logo/archive-vote-3 , 21 16 Wikimedia Taiwan/發起人名冊 , 22 15 Wikimania 2007/Alexandria , 23 13 Proposals for new projects , 24 12 Wikimania 2007/Bid list , 25 12 Steward requests/Bot status

Oct 2006: 1 207 Wiktionary/logo/archive-vote-4 , 2 199 Requests for new languages , 3 159 Wikiversity/Logo/archive-vote-4 , 4 151 Wikibooks/Logo/Archive 4 , 5 126 Wiktionary/logo/archive-vote-3 , 6 99 Wikibooks/Logo/Archive 3 , 7 98 Steward requests/Permissions , 8 96 Wikiversity/Logo/archive-vote-3 , 9 35 Wikimedia News , 10 25 Requests for comment/Board Election 2006 , 11 22 List of Wikipedias , 12 19 Requests for new languages/Ancient , 13 18 Translation of the week/Translation candidates , 14 17 Association of Stroopwafel Addicts , 15 16 Proposals for closing projects , 16 16 Proposals for new projects , 17 15 Requests for new languages/Wikipedia Montenegrin , 18 15 Wikinews/Start a new edition , 19 14 Copyright wishlist , 20 14 Spam blacklist , 21 14 IRC/Quotes , 22 13 Requests for new languages/Old requests archive/Approved , 23 13 Translation of the week/2006 translations/Archive , 24 12 Ignore all rules , 25 12 Toolserver/New accounts

Nov 2006: 1 277 Stewards/elections 2006-2 , 2 171 Proposals for closing projects/Closure of Siberian Wikipedia , 3 94 Requests for new languages , 4 79 Steward requests/Permissions , 5 78 Requests for new languages/Wikipedia Montenegrin , 6 74 Proposals for closing projects , 7 36 Wikiversity/Logo/archive-vote-6 , 8 33 Wikimedia News , 9 31 Requests for new languages/Ancient , 10 30 Discussion on the logo votes , 11 26 Proposals for new projects , 12 23 Stewards/elections 2006-2/statements , 13 23 Stewards/confirm/2009/mul , 14 21 Requests for new languages/Wikisource Siberian , 15 19 Proposals for closing projects/Closure of Moldovan Wikipedia , 16 18 Steward requests/Checkuser , 17 18 Translation of the week/Translation candidates , 18 17 Requests for logos , 19 16 Translation of the week/2006 translations/Archive , 20 15 Requests for new languages/Wikipedia Belarusian (1959) , 21 15 List of Wikipedias , 22 13 Foundation wiki feedback , 23 12 OTRS/Volunteering , 24 12 Requests for comment/Request to Stewards , 25 11 Spam blacklist

Dec 2006: 1 265 Stewards/elections 2006-2 , 2 101 Steward requests/Permissions , 3 67 Proposals for closing projects/Closure of Siberian Wikipedia , 4 59 Stewards/confirm/2009/mul , 5 31 Proposals for new projects , 6 28 Wikimedia News , 7 26 Translation requests/WMF/Fundraising Sitenotice(Anonymous)/2006 , 8 26 Translation requests/WMF/disclaimer/status , 9 24 List of Wikipedias , 10 23 Translation request/WMF/Fundraising Sitenotice(default)/2006 , 11 23 Wikiversity/Logo/archive-vote-6 , 12 22 Snowball clause , 13 22 Steward requests/Checkuser , 14 21 Fundraising FAQ/status , 15 19 Translation requests/WMF/Give the gift of knowledge/status , 16 19 Proposals for closing projects/Closure of Old English Wikisource , 17 19 Proposals for closing projects/Closure of Moldovan Wikipedia , 18 18 Request for an account on the Foundation wiki , 19 18 Spam blacklist , 20 17 Steward requests/Bot status , 21 16 Wikimedia Open Access chat , 22 15 Stewards , 23 15 Foundation wiki feedback , 24 13 Requests for new languages/Wikipedia Ottoman Turkish 2 , 25 13 OTRS/Volunteering

Jan 2007: 1 86 Steward requests/Permissions , 2 29 Wikimedia News , 3 28 Proposals for new projects , 4 23 Spam blacklist , 5 22 Requests for new languages/Wikipedia Montenegrin 2 , 6 18 Proposals for closing projects/Closure of Siberian Wikipedia , 7 18 Translation of the week/Translation candidates , 8 17 Steward requests/Bot status , 9 16 Toolserver/New accounts , 10 16 List of Wikipedias , 11 15 Proposals for closing projects/Closure of Kanuri Wikipedia , 12 15 Wikimedia Japan/Archives/20110819 , 13 15 Steward requests/Checkuser , 14 15 Association of Wikipedians Who Dislike Making Broad Judgments About the Worthiness of a General Category of Article, and Who Are in Favor of the Deletion of Some Particularly Bad Articles, but That Doesn't Mean They Are Deletionists , 15 14 Requests for comment/Blockinblox on Simple English Wikipedia , 16 14 Requests for new languages/Wikipedia Sakha , 17 14 Association of Stroopwafel Addicts , 18 13 Snowball clause , 19 13 Translation requests/WMF/Wikimedia thanks all contributors/status , 20 13 Proposals for closing projects/Closure of Inuktitut Wikipedia , 21 12 Proposals for closing projects/Closure of Finnish Wikiquote , 22 11 Spam blacklist/Log , 23 11 Steward requests/Permissions/Approved temporary , 24 11 Requests for new languages , 25 11 List of Wikimedians by birthday

Feb 2007: 1 90 Steward requests/Permissions , 2 29 List of Wikipedias , 3 28 OTRS/Volunteering , 4 26 Wikimedia News , 5 19 Ignore all rules , 6 19 OTRS/Personnel , 7 18 Steward requests/Checkuser , 8 17 Proposals for closing projects/Closure of Herero Wikipedia , 9 16 Spam blacklist , 10 15 Steward requests/Bot status , 11 15 Proposals for new projects , 12 14 Translation requests/WMF/Press releases/Wikipedia stable, but still dependent on your support/status , 13 14 Proposals for closing projects/Closure of Siberian Wikipedia , 14 14 OTRS , 15 14 Requests for new languages , 16 13 Deceased editors , 17 12 MediaWiki Ideal , 18 12 Proposals for closing projects/Closure of Simple English Wikiquote , 19 12 Toolserver/New accounts , 20 11 Requests for new languages/Wikipedia Montenegrin 2 , 21 11 Proposals for closing projects/Closure of Venda Wikipedia , 22 10 Requests for new languages/Wikipedia Insubric , 23 10 Requests for new languages/Wikiversity Italian 2 , 24 10 Translation of the week/2007 translations/Archive , 25 10 Wikimedia chapters

Mar 2007: 1 84 Steward requests/Permissions , 2 43 Planet Wikimedia/New language , 3 35 Wikimedia Norge , 4 33 Planet Wikimedia , 5 26 Wikimedia News , 6 23 OTRS/Volunteering , 7 22 Proposals for closing projects/Closure of Siberian Wikipedia , 8 22 List of Wikipedias , 9 21 Requests for new languages/Wikipedia Ottoman Turkish 2 , 10 20 Ignore all rules , 11 20 Steward requests/Bot status , 12 19 Request for an account on the Foundation wiki , 13 19 Steward requests/Checkuser , 14 18 Proposals for new projects , 15 17 OTRS/Personnel , 16 16 Wikimedia Vatican , 17 16 Toolserver/New accounts , 18 13 Staff , 19 13 Translation requests/WMF/Staff/en , 20 12 Office actions , 21 12 Translation of the week/2007 translations/Archive , 22 11 Foundation wiki feedback , 23 11 Requests for new languages/Wikipedia Insubric , 24 11 Spam blacklist , 25 11 Wikinews/Start a new edition

Apr 2007: 1 83 Steward requests/Permissions , 2 34 Wikimedia News , 3 30 OTRS/Volunteering , 4 27 Planet Wikimedia/New language , 5 23 Steward requests/Checkuser , 6 22 Steward requests/Bot status , 7 21 OTRS/Personnel , 8 21 List of Wikipedias , 9 19 Requests for new languages/Wikipedia Classical Japanese 2 , 10 19 Toolserver/New accounts , 11 18 Wikimedia Forum , 12 18 Requests for new languages , 13 18 Proposals for new projects , 14 17 Ignore all rules , 15 16 Requests for new languages/Wikisource Tamil , 16 16 Communication Projects Group , 17 15 Requests for new languages/Wikipedia Lower Sorbian 2 , 18 15 Requests for new languages/Wikipedia Karelian 2 , 19 14 Communication Projects Group/Projects/Success stories - how has Wikimedia changed your life? , 20 14 List of Wikimedian pubs , 21 14 Open Source Toolset , 22 14 Wikimedia Norge , 23 14 Requests for new languages/Wikipedia American Sign Language 2 , 24 14 Translation of the week/Translation candidates , 25 13 OTRS

May 2007: 1 108 Steward requests/Permissions , 2 55 Wikimedia Czech Republic , 3 47 Ignore all rules , 4 37 Steward requests/Checkuser , 5 34 Wikimedia brand survey , 6 32 Wikimedia News , 7 31 Steward requests/Bot status , 8 31 List of Wikipedias , 9 27 Don't leave your fly open , 10 25 OTRS/Volunteering , 11 19 Wikimedia Forum , 12 18 Translation of the week/Translation candidates , 13 16 OTRS/Personnel , 14 15 GDJ 2007 , 15 15 Spam blacklist , 16 15 Proposals for new projects , 17 15 IRC/Channels , 18 14 Requests for new languages/Wiktionary Upper Sorbian , 19 14 Toolserver/New accounts , 20 13 Deceased editors , 21 12 OTRS , 22 12 Wikimedia chapters , 23 11 FireWiki Proposal , 24 11 Requests for new languages/Wikipedia Karelian 2 , 25 10 Proposals for closing projects/Closure of Swati Wikipedia

Jun 2007: 1 380 Board elections/2007/Endorsements/Submission , 2 105 Steward requests/Permissions , 3 57 Wikimedia brand survey , 4 56 Board elections/2007/Candidates/Danny/questions , 5 44 Board elections/2007/Candidates/WarX/questions , 6 43 Board elections/2007/Candidates/Kate/questions , 7 42 Steward requests/Checkuser , 8 40 Board elections/2007/Candidates/Eloquence/questions , 9 40 Board elections/2007/Candidates/Mindspillage/questions , 10 39 Board elections/2007/Candidates/Michael Snow/questions , 11 37 Board elections/2007/Candidates/DragonFire1024/questions , 12 36 Board elections/2007/Candidates/^demon/questions , 13 36 Board elections/2007/Candidates/Oscar/questions , 14 34 Board elections/2007/Candidates/Yann/questions , 15 33 Board elections/2007/Candidates/Ausir/questions , 16 33 Wikimedia News , 17 32 Board elections/2007/Candidates/UninvitedCompany/questions , 18 29 Board elections/2007/Candidates/Kim Bruning/questions , 19 29 Board elections/2007/Translations , 20 24 Ignore all rules , 21 23 Board elections/2007/Candidates/Kingboyk/questions , 22 22 Steward requests/Bot status , 23 21 Wikipedia.de , 24 21 Board elections/2007/Candidates/SarekOfVulcan/questions , 25 20 Requests for permissions/Yiddish Wikipedia

Jul 2007: 1 98 Steward requests/Permissions , 2 49 Steward requests/Checkuser , 3 36 OTRS/Volunteering , 4 32 Ignore all rules , 5 32 Board elections/2007/Results/status , 6 28 OTRS/Personnel , 7 26 List of Wikipedias , 8 25 Steward requests/Bot status , 9 23 Wikimedia News , 10 21 Wikibooks/Logo/Archive 5 , 11 21 Toolserver/New accounts , 12 18 Requests for new languages/Wikipedia Aeres , 13 17 Critiques papier étudiants Sciences Po , 14 17 Wikimedia Pennsylvania , 15 16 Board elections/2007/Candidates/Danny/questions , 16 15 Translation of the week/Translation candidates , 17 14 Steward requests/Username changes , 18 14 Translation requests/Eleccom mail, 07-05/status , 19 14 Board elections/2007/Vote , 20 14 OTRS , 21 14 Wikimedia chapters , 22 13 Wikimedia Forum , 23 13 Requests for comment/Board Election 2007 , 24 13 Board elections/2007/Candidates/^demon/questions , 25 13 Translation of the week/2007 translations/Archive

Aug 2007: 1 91 Steward requests/Permissions , 2 38 Requests for new languages/Wikipedia Latinized Russian , 3 26 Steward requests/Bot status , 4 24 OTRS/Volunteering , 5 24 Proposals for new projects , 6 23 Ignore all rules , 7 23 Steward requests/Checkuser , 8 21 Steward requests/Username changes , 9 21 Wikimedia News , 10 19 Requests for new languages/Wikipedia Pre-reform Russian , 11 18 Wikimania 2008/Bids , 12 17 Wikimania 2008/Wishlist , 13 17 Toolserver/New accounts , 14 16 Wikimania 2008/Bids/Atlanta , 15 16 Wikimedia Japan/Archives/20110819 , 16 16 Multilingual error messages/Translations , 17 15 List of Wikipedias , 18 14 Wikimedia Forum , 19 14 Requests for new languages , 20 13 Requests for new languages/Wikiquote Limburgish , 21 13 Requests for new languages/Wikisource Bengali 2 , 22 12 GDJ 2007 , 23 12 Spam blacklist , 24 11 Proposals for closing projects/Closure of Simple English Wikiquote , 25 11 Wikimania 2008/Bids/Toronto

Sep 2007: 1 90 Steward requests/Permissions , 2 49 Proposals for closing projects/Closure of Volapük Wikipedia , 3 40 Fundraising 2007/web buttons , 4 40 OTRS/Volunteering , 5 26 GDJ 2007 , 6 24 Steward requests/Checkuser , 7 24 Steward requests/Bot status , 8 22 Wikimedia Forum , 9 21 Proposals for new projects , 10 20 Ignore all rules , 11 20 Wikimania 2008/Bids/Alexandria , 12 20 List of Wikipedias , 13 18 Wikimedia Australia , 14 17 Translation of the week/Translation candidates , 15 16 Multilingual error messages/Draft , 16 16 OTRS/Personnel , 17 15 Toolserver/New accounts , 18 15 Wikimedia chapters , 19 15 Wikimedia News , 20 14 Betawiki being hosted by Wikimedia , 21 13 Wikimania 2008/Bids/Alexandria/Q&A , 22 13 Wikimania 2008/Bids/Atlanta/Southeast team , 23 12 Wikimedia New York City , 24 11 Wikimania 2008/Bids/Cape Town , 25 11 Steward requests/Username changes

Oct 2007: 1 102 Steward requests/Permissions , 2 99 Fundraising 2007/Text for sitenotice , 3 67 Proposals for closing projects/Closure of Volapük Wikipedia , 4 47 Proposals for closing projects/Deletion of Siberian Wikipedia , 5 44 Fundraising 2007/Video with Jimmy subtitles/Translations/status , 6 40 Fundraising 2007/Landing page/Translations/status , 7 33 Fundraising 2007/Donate form/Translations/status , 8 32 Wikimania 2008/Bids/Alexandria , 9 28 Fundraising 2007/Core interface , 10 26 Steward requests/Bot status , 11 25 Fundraising 2007/Landing page testimonials/Translations/status , 12 25 Wikimedia News , 13 24 Fundraising 2007/web buttons , 14 22 Fundraising 2007/Fundraising FAQ/Translation , 15 21 Wikimania 2008/Bids/Alexandria/Volunteers , 16 21 OTRS/Volunteering , 17 21 Steward requests/Checkuser , 18 20 Fundraising 2007/Landing page/Translations , 19 18 Wikimedia Forum , 20 18 Toolserver/New accounts , 21 17 OTRS/Personnel , 22 17 List of Wikipedias , 23 16 Steward requests/Username changes , 24 16 Wikimedia chapters , 25 14 Ignore all rules

Nov 2007: 1 189 Stewards/elections 2007/statements/Aphaia , 2 131 Stewards/elections 2007/statements/Lar , 3 130 Stewards/elections 2007/statements/DerHexer , 4 125 Stewards/elections 2007/statements/Dmcdevit , 5 119 Stewards/elections 2007/statements/.anaconda , 6 109 Stewards/elections 2007/statements/Majorly , 7 105 Steward requests/Permissions , 8 104 Stewards/elections 2007/statements/Thogo , 9 92 Stewards/elections 2007/statements/Nick1915 , 10 87 Stewards/elections 2007/statements/Spacebirdy , 11 85 Proposals for closing projects/Closure of Lombard Wikipedia , 12 84 Stewards/elections 2007/statements/Wpedzich , 13 84 Fundraising 2007/Text for sitenotice , 14 81 Stewards/elections 2007/statements/Dungodung , 15 69 Stewards/elections 2007/statements/Andre Engels , 16 68 Stewards/confirm/2009/mul , 17 66 Stewards/elections 2007/statements/Jusjih , 18 64 Stewards/elections 2007/statements/Fabexplosive , 19 63 Wikimedia Forum , 20 63 Stewards/elections 2007/statements/.snoopy. , 21 61 Stewards/elections 2007/statements/Hillgentleman , 22 59 Stewards/elections 2007/statements/Bèrto 'd Sèra , 23 56 Stewards/elections 2007/statements/Millosh , 24 54 Stewards/elections 2007/statements/Zirland , 25 48 Stewards/elections 2007

Dec 2007: 1 113 Stewards/elections 2007/statements/Dmcdevit , 2 93 Stewards/elections 2007/statements/Lar , 3 90 Stewards/elections 2007/statements/DerHexer , 4 83 Steward requests/Permissions , 5 74 Proposals for closing projects/Radical cleanup of Volapük Wikipedia , 6 68 Stewards/elections 2007/statements/Majorly , 7 64 Proposals for closing projects/Closure of Lombard Wikipedia , 8 63 Stewards/confirm/2009/mul , 9 59 Stewards/elections 2007/statements/Nick1915 , 10 53 Stewards/elections 2007/statements/Thogo , 11 53 Stewards/elections 2007/statements/.anaconda , 12 44 Stewards/elections 2007/statements/Millosh , 13 43 Stewards/elections 2007/statements/Spacebirdy , 14 43 Stewards/elections 2007/statements/Andre Engels , 15 39 Wikimedia Forum , 16 35 Stewards/elections 2007/statements/Edmundwoods , 17 34 Stewards/elections 2007/statements/Dungodung , 18 33 Steward requests/Bot status , 19 30 Stewards/elections 2007/statements/.snoopy. , 20 30 Stewards/elections 2007/statements/Fabexplosive , 21 28 Stewards/elections 2007/statements/Wpedzich , 22 26 Stewards/elections 2007/statements/Jusjih , 23 26 Translation of the week/Translation candidates , 24 25 Stewards/elections 2007/statements/Hillgentleman , 25 24 Stewards/elections 2007/statements/Zirland

Jan 2008: 1 110 Steward requests/Permissions , 2 53 Proposals for closing projects/Radical cleanup of Volapük Wikipedia , 3 49 Wikimedia Forum , 4 32 Proposal for Policy on overuse of bots in Wikipedias , 5 30 Fundraising 2007/Text for sitenotice , 6 29 Fundraising 2007/Thank you , 7 29 Steward requests/Bot status , 8 24 Ignore all rules , 9 22 OTRS/Volunteering , 10 22 Requests for new languages , 11 21 Wikimedia News , 12 18 List of Wikipedias/Table , 13 18 Proposals for new projects , 14 17 Toolserver/New accounts , 15 16 Wikimedia Canada/Meetings/2008-01-30 , 16 16 Requests for new languages/Wikipedia Karakalpak 3 , 17 15 Requests for comment/Ramir on Russian Wikibooks , 18 15 Translation of the week/Translation candidates , 19 13 Steward requests/Checkuser , 20 13 Wikimedia chapters , 21 12 Wikimedia Canada/Steering Committee , 22 12 Migration to the new preprocessor , 23 12 Requests for new languages/Wikipedia Gagauz 2 , 24 12 Requests for new languages/Wikinews Hungarian , 25 12 List of Wikipedias

Feb 2008: 1 89 Steward requests/Permissions , 2 46 Requests for new languages/Wikiversity Japanese 2 , 3 44 OTRS/Volunteering , 4 26 Steward requests/Bot status , 5 19 Wikimedia Forum , 6 18 Requests for new languages , 7 17 Ignore all rules , 8 17 Wikimedia News , 9 15 Village stocks , 10 15 Translation of the week/Translation candidates , 11 14 Wiki Wall Photo Contest , 12 14 Steward requests/Checkuser , 13 13 Toolserver/New accounts , 14 12 Translation teams/zh , 15 12 Wikimedia Canada/Meetings/2008-02-06 , 16 12 OTRS/Personnel , 17 11 Wikimania 2009/Bids/Toronto , 18 11 Requests for new languages/Wikinews Hungarian , 19 11 Steward requests/Username changes , 20 11 Wikimania 2009/Bids/Buenos Aires , 21 11 Spam blacklist , 22 11 Wikimedia chapters , 23 10 Board elections/2008/Committee/en , 24 10 Wikimania 2009/Bids/Toronto/Q&A , 25 10 Wikimania 2009/Bids/Buenos Aires/Q&A

Mar 2008: 1 92 Steward requests/Permissions , 2 84 Steward requests/SUL requests , 3 59 OTRS/Volunteering , 4 31 Steward requests/Bot status , 5 28 Wikibooks/Logo/Archive 7 , 6 27 Steward requests/Username changes , 7 25 Ignore all rules , 8 22 Wikimedia São Paulo/Interessados , 9 22 Toolserver/New accounts , 10 22 Non-free content , 11 21 Translation requests/Wikimania/Sitenotice 2008 , 12 20 Request for an account on the Foundation wiki , 13 20 Wikimedia chapters , 14 18 Proposals for closing projects/Closure of Tatar Wikipedia , 15 18 Wikimedia Australia/Incorporation , 16 17 Mutirões pelo Conhecimento Livre/Participantes , 17 17 Translation of the week/Translation candidates , 18 16 OTRS/Personnel , 19 16 Wikimedia News , 20 15 Steward requests/SUL requests/2008-03 , 21 15 Top Ten Wikipedias , 22 15 Steward requests/Checkuser , 23 14 Requests for comment/-jkb- , 24 12 Requests for new languages/Wikipedia Silesian , 25 11 Translation of the week/2008 translations/Archive

Apr 2008: 1 91 Steward requests/Permissions , 2 69 Steward requests/SUL requests , 3 39 Community petition/sign , 4 37 Community petition , 5 34 OTRS/Volunteering , 6 32 Wikibooks/Logo/Archive 7 , 7 29 Steward requests/Username changes , 8 28 Requests for new languages , 9 26 Wikimedia News , 10 24 Steward requests/Bot status , 11 23 Board elections/2008/Translation , 12 23 Steward requests/Checkuser , 13 22 Wikimedia Forum , 14 21 Translation requests/Wikimania/Sitenotice 2008 , 15 21 OTRS/Personnel , 16 20 Requests for new languages/Wikipedia Egyptian Arabic , 17 20 Translation of the week/Translation candidates , 18 19 Toolserver/New accounts , 19 18 Wikimedia chapters , 20 17 Requests for new languages/Wikiversity Czech , 21 17 Spam blacklist , 22 14 Communication Projects Group/Membership/Roll-call , 23 14 Wikimedia Australia , 24 13 Wikijunior/Logo/Archive 2 , 25 13 Top Ten Wikipedias

May 2008: 1 144 Steward requests/SUL requests , 2 103 Steward requests/Permissions , 3 60 Community petition/sign , 4 50 Board elections/2008/Translation , 5 45 OTRS/Volunteering , 6 44 Steward requests/Bot status , 7 41 Board elections/2008/Candidates/Questions , 8 34 Steward requests/Checkuser , 9 29 Proposals for closing projects/Closure of Beta Wikiversity , 10 26 Wikimedia Forum , 11 23 Proposals for closing projects/Closure of Incubator Wikimedia , 12 22 Steward requests/Username changes , 13 21 Board elections/2008/Candidates/Questions/2 , 14 21 Board elections/2008/Candidates/Submissions , 15 20 Wikibooks/Logo/Proposal/D , 16 18 List of Wikipedias/Table , 17 18 Wikimedia chapters , 18 17 Translation of the week/Translation candidates , 19 14 Wikimedia News , 20 13 Board elections/2008/Candidates/ru , 21 13 Chapter-selected Board seats , 22 12 Translation requests/Wikimania/Sitenotice 2008 , 23 12 Translation of the week/2008 translations/Archive , 24 12 Toolserver/New accounts , 25 11 Board elections/2008/Candidates/Questions/1

Jun 2008: 1 458 Wikimedia Forum , 2 219 Steward requests/SUL requests , 3 91 Steward requests/Permissions , 4 56 OTRS/Volunteering , 5 43 Steward requests/Bot status , 6 28 Board elections/2008/Candidates/Questions/3 , 7 27 Steward requests/Checkuser , 8 25 Requests for new languages/Wikipedia Moldavian-Romanian , 9 24 Board elections/2008/Candidates/Questions/2 , 10 23 Wikimedia nomail list , 11 23 Steward requests/Username changes , 12 22 Steward requests/SUL requests/Bug 14330 , 13 22 Global sysops/2008 proposal , 14 22 Board elections/2008/Translation , 15 18 Proposals for closing projects/Closure of Incubator Wikimedia , 16 17 Proposals for closing projects/Closure of Beta Wikiversity , 17 17 Wikimedia News , 18 16 Wikibooks/Logo/Proposal/D , 19 15 Ignore all rules , 20 15 OTRS/Personnel , 21 14 Foundation wiki feedback , 22 14 Steward requests/Permissions/Approved temporary , 23 13 Mutirões pelo Conhecimento Livre/Participantes , 24 13 List of Wikipedias/Table , 25 13 Vandalism reports

Jul 2008: 1 411 Top Ten Wikipedias/poll , 2 123 Steward requests/Permissions , 3 103 Steward requests/SUL requests , 4 51 Wikimania 2010/Bids/Copenhagen , 5 50 Wikimedia Forum , 6 31 Steward requests/Checkuser , 7 30 Steward requests/Bot status , 8 29 IRC/Group Contacts/Meetings/July 2008 , 9 27 OTRS/Volunteering , 10 27 Toolserver/New accounts , 11 22 Steward requests/Username changes , 12 20 List of Wikipedias/Table , 13 19 Translation of the week/Translation candidates , 14 16 GDJ 2008 , 15 16 IRC/wikipedia-fr/extraits choisis , 16 15 Top Ten Wikipedias , 17 15 Wikimedia News , 18 14 Requests for new languages/Wikipedia Teochew , 19 14 Vandalism reports , 20 12 Ignore all rules , 21 12 Proposals for closing projects/Closure of Beta Wikiversity , 22 12 Translation of the week/2008 translations/Archive , 23 12 OTRS/Personnel , 24 11 Steward requests/Permissions/Approved temporary , 25 11 List of articles every Wikipedia should have

Aug 2008: 1 109 Steward requests/Permissions , 2 62 Wikimedia Forum , 3 51 Steward requests/SUL requests , 4 45 Wikimania 2010/Bids/Copenhagen , 5 44 IRC/Guidelines/Public logging , 6 38 Steward requests/Bot status , 7 35 Steward requests/Checkuser , 8 34 OTRS/Volunteering , 9 28 Request for an account on the Foundation wiki , 10 24 Wikimedia UK , 11 21 Toolserver/New accounts , 12 20 List of Wikipedias/Table , 13 20 Steward requests/Username changes , 14 19 Tell us about your Wikipedia , 15 19 Why Wikimedians edit , 16 19 Translation of the week/Translation candidates , 17 18 Translation of the week/2008 translations/Archive , 18 18 Wikimedia News , 19 17 Wikimania 2010/Bids/Oxford , 20 16 GDJ 2008 , 21 16 Bot policy/Implementation , 22 16 Requests for new languages , 23 16 Steward requests/Miscellaneous , 24 15 Steward requests/Global , 25 15 OTRS/Personnel

Sep 2008: 1 96 Steward requests/Permissions , 2 90 Wikimedia Forum , 3 66 Wikimedia Forum/On disbanding Wikiquote , 4 58 OTRS/Volunteering , 5 41 Wikimedia UK , 6 41 IRC/Guidelines/Public logging , 7 41 Steward requests/SUL requests , 8 38 GDJ 2008 , 9 30 Steward requests/Checkuser , 10 30 Steward requests/Bot status , 11 27 Requests for comment/Poetlister and Cato , 12 22 Tell us about Italian Wikipedia , 13 22 Wikimedia News , 14 21 Why Wikimedians edit , 15 19 Requests for comment/Lombard wikipedia, urgent desysoping and unblock requests , 16 19 Wikimedia chapters , 17 18 List of Wikipedias/Table , 18 17 Toolserver/New accounts , 19 17 OTRS/Personnel , 20 16 Translation of the week/Translation candidates , 21 14 Wikimedia UK v2.0/Candidate statements , 22 14 Steward requests/Global , 23 13 Wikimania 2010/Bids/Copenhagen , 24 13 Steward requests/Username changes , 25 13 Planet Wikimedia

Oct 2008: 1 70 Steward requests/Permissions , 2 55 Mutirões pelo Conhecimento Livre/Projetos/WikiBrasil/Inscrição , 3 47 Wikimedia Forum , 4 45 Steward requests/SUL requests , 5 41 Proposals for closing projects/Closure of Simple English Wikipedia (2) , 6 37 Steward requests/Global , 7 37 Steward requests/Bot status , 8 31 Mutirões pelo Conhecimento Livre/Participantes , 9 28 OTRS/Volunteering , 10 19 Arbitration Committee/Election processes , 11 19 Toolserver/New accounts , 12 18 Steward requests/Checkuser , 13 18 Translation of the week/Translation candidates , 14 18 Wikimedia chapters , 15 18 Wikimedia News , 16 17 Translation of the week/2008 translations/Archive , 17 14 IRC/wikipedia/Guidelines/Public logging/Roll call , 18 14 Wikimania 2010/Bids/Amsterdam , 19 14 List of Wikipedias/Table , 20 14 Steward requests/Username changes , 21 14 Proposals for new projects , 22 13 Why Wikimedians edit , 23 12 Requests for new languages/Wikipedia Xiang , 24 11 Requests for comment/Sysop abuse on Greek Wikipedia , 25 11 Requests for comment/Lombard wikipedia, urgent desysoping and unblock requests

Nov 2008: 1 287 Wikibooks/Logo/Archive 8 , 2 81 Steward requests/Permissions , 3 62 Wikimedia Forum , 4 49 Translation requests/quick translation , 5 47 Mutirões pelo Conhecimento Livre/Participantes , 6 34 OTRS/Volunteering , 7 34 Steward requests/Checkuser , 8 29 Requests for comment/Canopus Kilya Blocking , 9 28 Steward requests/SUL requests , 10 27 Steward requests/Global , 11 27 Wikimedia News , 12 23 Steward requests/Bot status , 13 22 Proposals for closing projects/Closure of Simple English Wikipedia (2) , 14 21 Toolserver/New accounts , 15 19 Wikimedia UK v2.0/Newsletter/Subscribers , 16 18 List of Wikipedias/Table , 17 17 Proposals for closing projects/Closure of Simple English Wiktionary (2) , 18 17 Translation of the week/Translation candidates , 19 17 Proposals for new projects , 20 15 Translation of the week/2008 translations/Archive , 21 14 Wikimedia chapters , 22 13 Wikivoices/ACE2008 Special , 23 13 Mutirões pelo Conhecimento Livre/Projetos/WikiBrasil/Inscrição , 24 13 Request for an account on the Foundation wiki , 25 13 Requests for new languages

Dec 2008: 1 92 Steward requests/Permissions , 2 72 Proposals for closing projects/Closure of Simple English Wikipedia (2) , 3 57 Wikibooks/Logo/Archive 9 , 4 53 Wikibooks/Logo/Archive 10 , 5 49 Wikimedia Forum , 6 31 Steward requests/Checkuser , 7 28 Steward requests/Bot status , 8 22 List of Wikipedias/Table , 9 21 OTRS/Volunteering , 10 19 Foundation wiki feedback , 11 19 Steward requests/SUL requests , 12 18 Proposals for closing projects/Closure of Simple English Wiktionary (2) , 13 17 Steward requests/Global , 14 17 Mutirões pelo Conhecimento Livre/Participantes , 15 17 Wikimedia News , 16 16 Toolserver/New accounts , 17 16 OTRS/Personnel , 18 14 Fundraising 2008/appeal/ru , 19 14 Proposals for new projects , 20 13 Requests for comment/Canopus Kilya Blocking , 21 13 IRC/wikipedia-en-admins/Policy ratification , 22 12 Requests for new languages/Wikipedia Mandarin , 23 12 FLOSS-Exchange , 24 12 Translation of the week/Translation candidates , 25 11 Licensing update/Questions and Answers

Jan 2009: 1 167 Stewards/elections 2009 , 2 106 Stewards/elections 2009/Translation/CentralNotice , 3 90 Steward requests/Permissions , 4 74 Stewards/elections 2009/Introduction , 5 40 Proposals for closing projects/Closure of Simple English Wikipedia (2) , 6 40 Wikimedia Forum , 7 36 Steward requests/Bot status , 8 32 Stewards/confirm/2009/mul , 9 31 Wikibooks/Logo/Archive 10 , 10 30 Wikimedia chapters , 11 28 Steward requests/Checkuser , 12 24 Wishes 2009 , 13 24 Steward requests/SUL requests , 14 22 Stewards/elections 2009/statements/Alexanderps , 15 22 OTRS/Volunteering , 16 22 Translation of the week/Translation candidates , 17 21 Stewards/elections 2009/statements/Cometstyles , 18 21 Stewards/elections 2009/statements/EVula , 19 21 Stewards/elections 2009/statements/Meno25 , 20 21 Steward requests/Global , 21 20 Translation of the week/2009 translations , 22 19 Stewards/elections 2009/statements/Mike.lifeguard , 23 18 Restoration.wikimedia.org , 24 18 Wikimania 2010/Bids/Amsterdam , 25 18 Toolserver/New accounts

Feb 2009: 1 305 Stewards/elections 2009/statements/Mardetanha , 2 303 Stewards/elections 2009/statements/Mike.lifeguard , 3 228 Stewards/elections 2009/statements/putnik , 4 227 Stewards/elections 2009/statements/Kylu , 5 221 Stewards/elections 2009/statements/Erwin , 6 211 Stewards/elections 2009/statements/Avraham , 7 206 Stewards/elections 2009/statements/Dorgan , 8 190 Stewards/elections 2009/statements/Alexanderps , 9 176 Stewards/elections 2009/statements/Al Lemos , 10 176 Stewards/elections 2009/statements/EVula , 11 175 Stewards/elections 2009/statements/Meno25 , 12 173 Stewards/elections 2009/statements/Leinad , 13 161 Stewards/elections 2009/statements/Fabexplosive , 14 151 Stewards/elections 2009/statements/SpeedyGonsales , 15 143 Stewards/elections 2009/statements/Cometstyles , 16 139 Stewards/elections 2009/statements/Apteva , 17 137 Stewards/elections 2009/statements/Laaknor , 18 117 Stewards/elections 2009/statements/PhiLiP , 19 113 Stewards/elections 2009/statements/avjoska , 20 107 Stewards/elections 2009/statements/Mywood , 21 106 Stewards/elections 2009/statements/Jredmond , 22 101 Steward requests/Permissions , 23 88 Wikimedia Forum , 24 85 Stewards/elections 2009/statements/Fadesga , 25 78 Stewards/elections 2009/statements/Loco085

Mar 2009: 1 166 Wikimania 2009/CentralNotice , 2 102 Steward requests/Permissions , 3 76 Wikimania 2010/Bids/Gdańsk , 4 61 Licensing update/CentralNotice , 5 39 Steward requests/Bot status , 6 38 Wikimedia Forum , 7 32 Wikimania 2010/Bids/Amsterdam , 8 30 Steward requests/Global , 9 26 Toolserver/New accounts , 10 25 OTRS/Volunteering , 11 23 Licensing update/Options and suffrage , 12 23 Wikimedia CAT/Members and Supporters , 13 23 Wikimedia Danmark , 14 22 Wiktionary/logo/refresh , 15 21 Steward requests/SUL requests , 16 20 Wikimania 2010/Bids/Oxford , 17 19 Steward requests/Checkuser , 18 18 Wikimedia chapters , 19 17 List of Wikipedias/Table , 20 17 Wikimedia News , 21 16 Foundation wiki feedback , 22 16 Chapters meeting 2009/Committees , 23 15 Book tool/Feedback , 24 15 Steward requests/Permissions/2009-03 , 25 14 Proposals for closing projects/Closure of Simple English Wikipedia (2)

Apr 2009: 1 144 Licensing update/CentralNotice , 2 132 Wikimania 2009/CentralNotice , 3 86 Steward requests/Permissions , 4 79 April 2009 Wikimedia Conference/Pictures , 5 59 Proposals for closing projects/Closure of English Wikipedia , 6 56 Wiktionary/logo/refresh , 7 56 Wikimedia Forum , 8 52 Licensing update/Options and suffrage , 9 44 OTRS/Volunteering , 10 41 Licensing update/Header and jump text , 11 37 Steward requests/Checkuser , 12 30 Steward requests/Bot status , 13 27 Licensing update/Questions and Answers/Oppositional arguments , 14 27 Steward requests/Global , 15 25 Steward requests/SUL requests , 16 24 Licensing update/Header tracking , 17 19 Wikimania 2010/Bids/Gdańsk , 18 18 Requests for new languages/Wikipedia Kurdish (Sorani) , 19 18 Wikimedia chapters , 20 17 Wikimania 2010/Bids/Oxford/Team , 21 16 Toolserver/New accounts , 22 15 Licensing update/Translation , 23 15 Wikimedia News , 24 14 Proposals for closing projects/Closure of Wikimedia Quality , 25 14 OpenStreetMap

May 2009: 1 98 Steward requests/Permissions , 2 94 Licensing update/CentralNotice , 3 52 OTRS/Volunteering , 4 39 Wikimedia Forum , 5 35 Wiktionary/logo/refresh/proposals , 6 28 Steward requests/Checkuser , 7 26 Steward requests/Bot status , 8 21 Steward requests/Global , 9 19 Wiktionary/logo/refresh , 10 17 Steward requests/SUL requests , 11 16 Licensing update/Result , 12 16 Wikimedia News , 13 15 Huggle/Wine , 14 15 List of Wikipedias/Table , 15 14 Licensing update/Result/es , 16 14 Planet Wikimedia , 17 14 Translation of the week/Translation candidates , 18 13 Викимедија Македонија , 19 12 Licensing update/Result/de , 20 12 Spam blacklist/Log/2009/05 , 21 12 Licensing update , 22 12 Spam blacklist , 23 11 Licensing update/Outreach , 24 11 Toolserver/New accounts , 25 11 Wikimedia chapters

Jun 2009: 1 75 Steward requests/Permissions , 2 58 Wiktionary/logo/refresh/proposals , 3 45 Fundraising 2009/Donation buttons upgrade/Round1 , 4 40 Steward requests/Checkuser , 5 32 Steward requests/Bot status , 6 29 Wikimedia Forum , 7 28 OTRS/Volunteering , 8 23 Wikimedia News , 9 21 Requests for new languages/Wikisource Georgian , 10 20 Steward requests/Global , 11 17 Translation of the week/Translation candidates , 12 14 List of Wikipedias/Table , 13 14 Toolserver/New accounts , 14 13 Board elections/2009/Translation , 15 13 Wikimedia Conference Japan , 16 13 Steward requests/Username changes , 17 13 OTRS/Personnel , 18 12 Foundation wiki feedback , 19 11 Free Travel-Shirt/White T-Shirt , 20 11 Steward requests/SUL requests , 21 11 Steward requests/Permissions/Approved temporary , 22 10 Steward requests/Permissions/2009-06 , 23 10 Translation of the week/2009 translations , 24 10 Spam blacklist , 25 9 IRC/wikipedia-fr/extraits choisis/signatures

Jul 2009: 1 128 Board elections/2009/Translation , 2 93 Steward requests/Permissions , 3 89 Board elections/2009/CentralNotice , 4 58 Wiktionary/logo/refresh/proposals , 5 55 Board elections/2009/Candidates/en , 6 46 Proposals for closing projects/Closure of Dutch Wikinews , 7 40 Wikimedia Forum , 8 38 Board elections/2009/Candidates/Questions/1 , 9 38 Steward requests/Global , 10 35 CentralNotice/Downtime , 11 35 Proposals for closing projects/Closure of Simple English Wikibooks (3) , 12 31 Board elections/2009/Candidates/es , 13 26 IRC/Group Contacts/Meetings/August 2009 , 14 24 Fundraising 2009/Donation buttons upgrade/Round1 , 15 23 Board elections/2009/Candidates/de , 16 23 Steward requests/Checkuser , 17 23 Steward requests/Bot status , 18 20 OTRS/Personnel , 19 19 GDJ 2009 , 20 18 Board elections/2009/Candidates/fr , 21 18 OTRS/Volunteering , 22 17 Steward requests/SUL requests , 23 17 Wikimedia chapters , 24 16 Board elections/2009/Candidates/ru , 25 15 Board elections/2009/Candidates/it

Aug 2009: 1 122 Steward requests/Permissions , 2 94 CentralNotice/Strategic Planning , 3 83 Wikimania 2009/CentralNotice , 4 67 Wikimedia nomail list , 5 38 Wikimedia Forum , 6 33 GDJ 2009 , 7 31 OTRS/Volunteering , 8 28 Wiktionary/logo/refresh , 9 26 Board elections/2009/Translation , 10 25 Wiktionary/logo/refresh/proposals , 11 22 Steward requests/SUL requests , 12 22 Wikimedia News , 13 21 Steward requests/Checkuser , 14 21 Steward requests/Bot status , 15 18 Wikimedia Belgium/Members , 16 17 Public speakers , 17 16 Board elections/2009/Candidates/Questions/2 , 18 16 Proposals for closing projects/Closure of Dutch Wikinews , 19 14 Interwiki synchronization/Open source vs Open source software , 20 14 CentralNotice/Downtime , 21 13 IRC/Group Contacts/Meetings/August 2009 , 22 13 Board elections/2009/Candidates/Questions/1 , 23 13 Proposals for closing projects/Closure of Simple English Wikibooks (3) , 24 13 Translation of the week/2009 translations , 25 12 Foundation wiki feedback

Sep 2009: 1 105 Steward requests/Permissions , 2 32 Wiktionary/logo/refresh , 3 32 Steward requests/Global , 4 32 Steward requests/Bot status , 5 28 GDJ 2009 , 6 28 Wikimedia Forum , 7 28 OTRS/Volunteering , 8 25 Steward requests/Checkuser , 9 22 Wikimedia News , 10 20 Public speakers , 11 19 Improving Foundation-l , 12 15 Steward requests/SUL requests , 13 15 List of Wikipedias/Table , 14 15 Translation of the week/Translation candidates , 15 13 Wikimedia chapters , 16 12 Translation of the week/2009 translations , 17 11 IRC/Channels , 18 10 Foundation wiki feedback , 19 10 Proposals for new projects , 20 9 Steward requests/Permissions/2009-09 , 21 9 Bot policy/Implementation , 22 9 OTRS/Personnel , 23 8 Spam blacklist/Log/2009/09 , 24 8 Proposals for closing projects/Closure of Simple English Wikibooks (3) , 25 8 Spam blacklist

Oct 2009: 1 106 Steward requests/Permissions , 2 41 Proposals for closing projects/Closure of Simple English Wikiquote (3) , 3 41 Steward requests/Global , 4 37 OTRS/Volunteering , 5 28 Multimedia Usability Project Meeting France/Members , 6 25 Steward requests/Bot status , 7 22 Steward requests/Checkuser , 8 19 IRC/wikimedia-admin/User list , 9 18 CentralNotice/Global sysops , 10 18 OTRS/Personnel , 11 17 Wiktionary/logo/refresh , 12 17 Steward requests/SUL requests , 13 16 Wikimedia News , 14 14 Fundraising 2009/core messages/ru , 15 14 Proposals for closing projects/Closure of Simple English Wikibooks (3) , 16 14 Translation of the week/2009 translations , 17 14 Wikimedia Forum , 18 14 List of Wikipedias/Table , 19 14 Translation of the week/Translation candidates , 20 13 Multimedia Usability Project Meeting France/Schedule , 21 13 Request for an account on the Foundation wiki , 22 11 Steward requests/Username changes , 23 10 Foundation wiki feedback , 24 10 Mutirões pelo Conhecimento Livre/Mutirões/Planejamento Estratégico/Sesc Pompéia , 25 10 Steward requests/Permissions/2009-10

Nov 2009: 1 102 Steward requests/Permissions , 2 89 Fundraising 2009/Launch Feedback , 3 79 Fundraising 2009/Alternative banners , 4 49 Wikimedia CAT/Members and Supporters , 5 34 Steward requests/Checkuser , 6 31 Steward requests/Global , 7 25 Wikimedia Forum , 8 25 Steward requests/SUL requests , 9 23 Foundation wiki feedback , 10 21 Proposals for closing projects/Closure of Simple English Wikiquote (3) , 11 18 Wiktionary/logo/refresh , 12 18 Steward requests/Bot status , 13 18 Wikimedia News , 14 17 Translation of the week/Translation candidates , 15 16 List of Wikipedias/Table , 16 15 Improving Foundation-l , 17 12 Translation of the week/2009 translations , 18 12 Request for an account on the Foundation wiki , 19 12 OTRS/Volunteering , 20 11 Fundraising 2009/core messages/de , 21 10 Free Travel-Shirt/White T-Shirt , 22 10 Steward requests/Username changes , 23 9 Spam blacklist/Log/2009/11 , 24 9 Spam blacklist , 25 9 Proposals for new projects

Dec 2009: 1 484 Wiktionary/logo/refresh/voting/tally , 2 110 Steward requests/Permissions , 3 59 Fundraising 2009/Launch Feedback , 4 37 Foundation wiki feedback , 5 29 Steward requests/Global , 6 28 Translation of the week/Translation candidates , 7 26 Wikimedia CAT/Members and Supporters , 8 26 OTRS/Volunteering , 9 23 Steward requests/Checkuser , 10 21 Steward requests/SUL requests , 11 21 Wikimedia España , 12 19 Wiktionary/logo/refresh/voting , 13 19 Wikimedia Forum , 14 19 Steward requests/Bot status , 15 16 Wikimedia News , 16 14 Fundraising 2009/appeal/fr , 17 14 List of Wikipedias/Table , 18 12 Steward requests/Username changes , 19 11 List of Wikimedians by birthday , 20 10 Spam blacklist/Log/2009/12 , 21 10 Museums and the Web 2010 , 22 10 Spam blacklist , 23 9 Steward requests/Permissions/2009-12 , 24 9 Translation of the week/2009 translations , 25 9 Proposals for closing projects/Closure of Ndonga Wikipedia

Jan 2010: 1 2145 Global sysops/Vote , 2 571 Wiktionary/logo/refresh/voting/tally1 , 3 461 Wiktionary/logo/refresh/voting/tally2 , 4 119 CentralNotice/Global sysops , 5 107 Steward requests/Permissions , 6 84 Stewards/elections 2010/Questions , 7 59 Global sysops/Vote/Introduction , 8 52 Stewards/elections 2010 , 9 48 Steward requests/Global , 10 46 CentralNotice/Wiktionary logo vote , 11 41 Stewards/elections 2010/Introduction , 12 38 Stewards/elections 2010/statements , 13 38 Translation of the week/Translation candidates , 14 31 Steward requests/Checkuser , 15 26 CentralNotice/Strategic Planning , 16 26 OTRS/Volunteering , 17 25 Steward requests/SUL requests , 18 24 Wikimedia Forum , 19 22 Fundraising 2009/Launch Feedback , 20 21 Requests for new languages/MediaWiki Russian , 21 19 Stewards/elections 2010/Translation/CentralNotice , 22 18 Stewards/elections 2010/Entirety , 23 18 Wikimedia News , 24 17 Steward requests/Username changes , 25 16 Stewards/elections 2010/statements/Evalowyn

Feb 2010: 1 306 Stewards/elections 2010/votes/J.delanoy , 2 251 Stewards/elections 2010/votes/Dferg , 3 249 Stewards/elections 2010/votes/Avraham , 4 240 Stewards/elections 2010/votes/Wutsje , 5 210 Stewards/elections 2010/votes/Annabel , 6 188 Stewards/elections 2010/votes/Thekohser , 7 185 Stewards/elections 2010/votes/Mercy , 8 185 Stewards/elections 2010/votes/Melos , 9 169 Stewards/elections 2010/votes/Mentifisto , 10 150 Stewards/confirm/2010/Lar , 11 145 Stewards/elections 2010/votes/Billinghurst , 12 136 Stewards/elections 2010/votes/EivindJ , 13 131 Stewards/elections 2010/votes/Sir Lestaty de Lioncourt , 14 127 Stewards/elections 2010/votes/Jyothis , 15 120 Stewards/elections 2010/votes/Jamesofur , 16 105 Stewards/elections 2010/votes/Bletilla , 17 104 Stewards/elections 2010/votes/Carkuni , 18 103 Stewards/elections 2010/votes/Fail , 19 96 Stewards/confirm/2010/DerHexer , 20 86 Stewards/confirm/2010/Pathoschild , 21 86 Stewards/elections 2010/votes/Evalowyn , 22 84 Stewards/elections 2010/votes/Razorflame , 23 84 Steward requests/Permissions , 24 82 Stewards/elections 2010/votes/Damërung , 25 81 Stewards/elections 2010/votes/Krinkle

Mar 2010: 1 96 Steward requests/Permissions , 2 92 Steward requests/Global , 3 86 Steward requests/Global permissions , 4 85 Wikimania 2010/CentralNotice , 5 66 Requests for comment/Remove Founder flag , 6 44 Steward requests/Checkuser , 7 31 OTRS/Volunteering , 8 31 Steward requests/Bot status , 9 30 Wikimedia Forum , 10 29 Wikimedia Conference 2010/Developers' Workshop/Attendees , 11 24 List of Wikipedias/Table , 12 23 Requests for comment/Croatian Wikipedia-misuse of admin tools by User:Kubura , 13 23 Requests for new languages/Wikipedia Montenegrin 3 , 14 22 Steward requests/SUL requests , 15 22 Wikimedia News , 16 18 Translation of the week/Translation candidates , 17 17 Chapters meeting 2010/Brainstorming , 18 16 Wikimania 2011/Bids/Haifa , 19 15 Wikimedia Conference 2010/Developers' Workshop/Topic brainstorms , 20 15 Translation of the week/2010 translations/Archive , 21 13 Steward requests/Miscellaneous , 22 11 Foundation wiki feedback , 23 11 Wikimedia chapters , 24 10 Spam blacklist/Log/2010/03 , 25 10 Spam blacklist

Apr 2010: 1 94 Wikimania 2010/CentralNotice , 2 76 Steward requests/Permissions , 3 62 Requests for comment/Shut down Wikiversity , 4 59 Proposals for closing projects/Closure of French Wikipedia , 5 48 Wikimedia Forum , 6 38 Steward requests/Checkuser , 7 36 Wikimedia España/Votaciones 2010 , 8 32 Chapters meeting 2010/Participants , 9 29 OTRS/Volunteering , 10 24 Steward requests/Global permissions , 11 24 Translation of the week/Translation candidates , 12 23 Steward requests/Username changes , 13 22 Steward requests/Global , 14 19 Steward requests/SUL requests , 15 18 Chapters meeting 2010/Schedule , 16 18 Steward requests/Bot status , 17 18 Wikimedia News , 18 16 Wikimedia chapters , 19 15 Spam blacklist/Log/2010/04 , 20 15 Requests for comment/Remove Founder flag , 21 15 Spam blacklist , 22 14 Wikimedia España , 23 12 Vector , 24 12 List of Wikipedias/Table , 25 11 Wikimedia España/Votaciones 2010/Alegaciones

May 2010: 1 493 Requests for comment/Remove Founder flag , 2 368 Petition to Jimbo , 3 109 Steward requests/Permissions , 4 71 Wikimania 2010/CentralNotice , 5 51 Wikimedia Forum , 6 42 Steward requests/Global permissions , 7 40 Requests for comment/Restore Founder flag , 8 24 Steward requests/SUL requests , 9 23 Steward requests/Global , 10 21 OTRS/Volunteering , 11 21 Steward requests/Checkuser , 12 19 Steward requests/Bot status , 13 19 Translation of the week/Translation candidates , 14 17 Wikimedia España , 15 17 Wikimedia News , 16 13 Translation of the week/2010 translations/Archive , 17 13 Wikimedia chapters , 18 11 Stewards' noticeboard , 19 11 Wikimedia CAT/Members and Supporters , 20 10 Foundation wiki feedback , 21 10 Wikimedia California , 22 10 Steward requests/Username changes , 23 10 Public speakers , 24 10 Spam blacklist , 25 9 Spam blacklist/Log/2010/05

Jun 2010: 1 118 Wikimedia CAT/Members and Supporters , 2 101 Steward requests/Permissions , 3 54 Proposals for closing projects/Closure of Samogitian Wikipedia , 4 41 Wikimania Chapter Gathering , 5 31 Steward requests/Global permissions , 6 26 Steward requests/SUL requests , 7 23 Wikimedia Forum , 8 22 Wikimedia News , 9 20 OTRS/Volunteering , 10 19 Steward requests/Username changes , 11 17 Steward requests/Checkuser , 12 16 Translation of the week/Translation candidates , 13 15 Steward requests/Global , 14 15 Steward requests/Bot status , 15 14 Meetup/London/34 , 16 14 Foundation wiki feedback , 17 14 Wikimedia chapters , 18 13 2010 Wikimedia design and feature change/Feedback , 19 12 Meetup/Montréal/2 , 20 12 Vandalism reports , 21 12 Requests for new languages , 22 11 2010 Wikimedia design and feature change/Bug reports , 23 11 Requests for new languages/Wikipedia Simple German 3 , 24 11 Proposals for closing projects/Closure of Fulan Wikipedia , 25 10 2010 Wikimedia design and feature change

Jul 2010: 1 93 CentralNotice/Work at Wikimedia , 2 73 Steward requests/Permissions , 3 58 Steward requests/Global permissions , 4 52 Requests for comment/ace.wikipedia and Prophet Muhammad images , 5 36 Steward requests/Global , 6 33 OTRS/Volunteering , 7 30 Wikimedia Forum , 8 29 Wikimedia CAT/Members and Supporters , 9 29 Steward requests/Checkuser , 10 28 Fundraising 2010/Committee , 11 28 Steward requests/SUL requests , 12 21 Requests for new languages/Wikipedia Banjar , 13 19 Steward requests/Username changes , 14 18 2010 Wikimedia design and feature change/Feedback , 15 18 Wikimedia News , 16 16 Requests for comment/Locally indef-blocked global sysops , 17 16 Proposals for closing projects/Closure of Samogitian Wikipedia , 18 15 Foundation wiki feedback , 19 15 Requests for new languages/Wikinews Korean , 20 14 Steward requests/Bot status , 21 14 Translation of the week/Translation candidates , 22 13 Proposals for closing projects/Closure of Acehnese Wikipedia , 23 13 Requests for comment/Prophet Muhammad images around Wikimedia projects , 24 13 List of Wikipedias/Table , 25 10 Requests for comment/Global arbitration and dispute resolution

Aug 2010: 1 80 Steward requests/Permissions , 2 68 Requests for comment/Global banners , 3 57 MaxMindCityTesting , 4 43 Steward requests/Global permissions , 5 43 Steward requests/Global , 6 40 CentralNotice/Usability Initiative , 7 37 Wikimedia CAT/Members and Supporters , 8 35 Steward requests/Bot status , 9 32 OTRS/Volunteering , 10 28 Fundraising 2010/Messages , 11 27 Steward requests/SUL requests , 12 27 Wikimedia News , 13 26 Steward requests/Checkuser , 14 25 Wikimedia Forum , 15 24 Sabat , 16 21 CentralNotice/Work at Wikimedia , 17 21 Foundation wiki feedback , 18 20 Wikimedia chapters , 19 17 Translation of the week/Translation candidates , 20 16 Fundraising 2010/Committee , 21 16 Steward requests/Miscellaneous , 22 15 GDJ 2010/Lista uczestników , 23 14 Steward requests/Username changes , 24 12 Wikimedia Foundation contractors , 25 11 Wikimedia South Africa

Sep 2010: 1 88 Fundraising 2010/Messages/New , 2 71 Steward requests/Permissions , 3 40 Steward requests/Checkuser , 4 35 Steward requests/Global permissions , 5 33 Wikimedia Forum , 6 26 Fundraising 2010/Messages/Funny , 7 26 OTRS/Volunteering , 8 25 Global message delivery/Targets/Signpost , 9 23 Wikimedia chapters , 10 22 Fundraising 2010/Messages/Language , 11 20 Fundraising 2010/Messages/Language/fr , 12 20 Steward requests/Global , 13 20 Steward requests/Bot status , 14 19 GDJ 2010/Lista uczestników , 15 17 Sabat , 16 17 Translation of the week/Translation candidates , 17 15 Fundraising 2010/Messages/Project specific , 18 15 Requests for comment/fi.wikipedia and community action missing in problem solving , 19 15 Wikimedia News , 20 14 Fundraising 2010/Messages , 21 13 Fundraising 2010/Messages/Language/de , 22 12 Fundraising 2010/Committee , 23 12 Meetup/London/37 , 24 12 Wikimedia CAT/Members and Supporters , 25 11 Fundraising 2010/Messages/Language/ru

Oct 2010: 1 87 Fundraising 2010/Messages/Language/pl , 2 85 Fundraising 2010/Messages/New , 3 82 Steward requests/Permissions , 4 41 Fundraising 2010/Messages/Language/fr , 5 41 Fundraising 2010/Messages/Language/ru , 6 32 Steward requests/Global permissions , 7 24 Wikimedia Forum , 8 23 Steward requests/SUL requests , 9 22 OTRS/Volunteering , 10 22 Translation of the week/Translation candidates , 11 21 Steward requests/Global , 12 21 Steward requests/Bot status , 13 20 Steward requests/Checkuser , 14 19 Wikimedia News , 15 18 Fundraising 2010/Messages/Language/he , 16 18 Fundraising 2010/Messages/Language/it , 17 18 GDJ 2010/Lista uczestników , 18 16 Requests for comment/User:Ottava Rima , 19 16 Fundraising 2010/Messages/BeatJimmy , 20 16 Meetup/London/38 , 21 15 Proposals for closing projects/Closure of Korean Wikinews , 22 13 Foundation wiki feedback , 23 13 Request for an account on the Foundation wiki , 24 12 List of Wikipedias/Table , 25 12 List of Wikipedias

Nov 2010: 1 114 Steward requests/Permissions , 2 111 Wikimedia CAT/en/Survey , 3 40 Fundraising 2010/Graphic Banners/Proposals , 4 37 Foundation wiki feedback , 5 36 Wikimedia Forum , 6 35 Steward requests/Global permissions , 7 31 Steward requests/Checkuser , 8 30 Steward requests/Global , 9 30 Steward requests/Bot status , 10 27 OTRS/Volunteering , 11 24 Fundraising 2010/Messages/New , 12 23 Proposals for closing projects/Closure of Hungarian Wikinews , 13 23 Translation of the week/Translation candidates , 14 20 Steward requests/SUL requests , 15 20 List of Wikipedias/Table , 16 18 Wikimedia News , 17 17 Fundraising 2010/Write An Appeal , 18 17 OTRS/Personnel , 19 16 Sabat/Lista uczestników , 20 14 Proposals for closing projects/Closure of Norwegian (Nynorsk) Wikipedia , 21 14 Meetup/London/39 , 22 14 Steward requests/Username changes , 23 13 Meetup/London/40 , 24 12 Fundraising 2010/FAQ/it , 25 11 Requests for comment/Chapters. Proposal to give transparency and voice to the communities/Comments against

Dec 2010: 1 89 Steward requests/Permissions , 2 57 Steward requests/Global permissions , 3 46 Wikimedia Forum , 4 37 Steward requests/Global , 5 31 Steward requests/Username changes , 6 29 Steward requests/Checkuser , 7 28 OTRS/Volunteering , 8 28 Steward requests/Bot status , 9 24 Foundation wiki feedback , 10 19 Wikimedia News , 11 16 Wikimedia CAT/Members and Supporters , 12 16 List of Wikipedias/Table , 13 16 Translation of the week/Translation candidates , 14 15 Steward requests/SUL requests , 15 13 Proposals for closing projects/Closure of Kannada Wikiquote , 16 13 Fundraising 2010/Write An Appeal , 17 13 Wikimedia chapters , 18 12 Fundraising 2010/Graphic Banners/Proposals , 19 11 Requests for new languages/Wikinews Sinhala , 20 11 Steward requests/Miscellaneous , 21 10 Requests for comment/Chapters. Proposal to give transparency and voice to the communities/Comments against , 22 10 List of Wikipedias , 23 9 Proposals for closing projects/Closure of Hungarian Wikinews , 24 9 Fundraising 2010/Updates , 25 9 CentralNotice/Log

Jan 2011: 1 105 Wikimania 2011/CentralNotice , 2 97 Steward requests/Permissions , 3 65 Stewards/elections 2011/Questions , 4 59 Steward requests/Checkuser , 5 57 Steward requests/Global permissions , 6 52 Stewards/elections 2011/Translation/CentralNotice , 7 46 Wikimedia Forum , 8 45 Steward requests/Bot status , 9 37 Stewards/elections 2011/Introduction , 10 34 Steward requests/SUL requests , 11 32 Stewards/elections 2011 , 12 30 Stewards/elections 2011/Guidelines , 13 28 Steward requests/Global , 14 28 Steward requests/Username changes , 15 27 Stewards/elections 2011/statements , 16 27 OTRS/Volunteering , 17 24 Wikimedia News , 18 21 Foundation wiki feedback , 19 20 Translation of the week/Translation candidates , 20 19 Stewards/elections 2011/statements/Barras , 21 19 Wikimedia Conference 2011/Participants , 22 18 Stewards/elections 2011/statements/מתניה , 23 18 List of Wikipedias/Table , 24 17 Wikimedia CAT/Members and Supporters , 25 15 Stewards/elections 2011/statements/Bhawani Gautam Rhk

Feb 2011: 1 274 Stewards/elections 2011/votes/מתניה , 2 271 Stewards/elections 2011/votes/Barras , 3 270 Stewards/elections 2011/votes/PeterSymonds , 4 232 Stewards/elections 2011/votes/wpedzich , 5 203 Stewards/elections 2011/votes/Manuelt15 , 6 194 Stewards/elections 2011/votes/Bsadowski1 , 7 188 Stewards/elections 2011/votes/Beria , 8 183 Stewards/elections 2011/votes/Jafeluv , 9 176 Stewards/elections 2011/votes/Swatjester , 10 163 Stewards/elections 2011/votes/WizardOfOz , 11 160 Stewards/elections 2011/votes/Ruslik0 , 12 148 Stewards/elections 2011/votes/Mentifisto , 13 146 Stewards/elections 2011/votes/Fr33kman , 14 133 Stewards/elections 2011/votes/Bennylin , 15 130 Stewards/elections 2011/votes/Eptalon , 16 113 Stewards/elections 2011/votes/Cekli829 , 17 111 Stewards/confirm/2011/DerHexer , 18 108 Stewards/elections 2011/votes/Kameraad Pjotr , 19 103 Stewards/elections 2011/votes/Mayur , 20 99 Steward requests/Permissions , 21 94 Stewards/elections 2011/votes/Djsasso , 22 94 Stewards/elections 2011/votes/Bhawani Gautam Rhk , 23 89 Stewards/confirm/2011/Pathoschild , 24 80 CentralNotice/MediaWiki 1.17 deployment , 25 80 Stewards/confirm/2011/Dferg

Mar 2011: 1 150 CentralNotice/March 2011 Update , 2 88 Steward requests/Permissions , 3 67 Steward requests/Global permissions , 4 46 Wikimedia Forum , 5 44 Steward requests/Username changes , 6 43 Foundation wiki feedback , 7 35 Steward requests/SUL requests , 8 31 Wikimedia Conference 2011/Schedule , 9 29 Steward requests/Checkuser , 10 27 Steward requests/Global , 11 24 OTRS/Volunteering , 12 24 Steward requests/Bot status , 13 23 Wikimedia Conference 2011/Participants , 14 18 Wikimania 2012/Bids/Washington, D.C. , 15 18 List of Wikipedias/Table , 16 18 Wikimedia News , 17 15 Wikimedia Brasil/Interessados , 18 15 Wikimedia CAT/Members and Supporters , 19 14 Requests for new languages , 20 14 Wikimedia chapters , 21 13 Chapter Agreements , 22 12 Requests for new languages/Wikinews Croatian , 23 12 Requests for new languages/Wikisource Belarusian 2 , 24 12 Wikimania 2011/CentralNotice , 25 12 Translation of the week/Translation candidates

Apr 2011: 1 69 Steward requests/Permissions , 2 63 Steward requests/Global permissions , 3 38 Foundation wiki feedback , 4 35 Steward requests/Checkuser , 5 32 Board elections/2011/Translation , 6 32 Proposals for closing projects/Move Servers to Canada , 7 30 Wikimedia Forum , 8 27 Steward requests/Global , 9 26 GLAMcamp NYC , 10 25 Requests for new languages/Wikinews Vietnamese , 11 23 Wikimania 2011/CentralNotice , 12 23 Steward requests/Bot status , 13 22 Wikimedia chapters , 14 21 Board elections/2011/CentralNotice , 15 20 Steward requests/SUL requests , 16 18 Steward requests/Username changes , 17 15 Wikimedia Venezuela/Votaciones 2011 , 18 15 Wikimedia Venezuela/Propuesta de camisetas institucionales , 19 15 Reports , 20 14 Wikimedia Venezuela/Junta Directiva , 21 14 Wikimedia Venezuela , 22 14 Wikimedia News , 23 13 Encuentro Wikimedia Iberoamericano 2011/Participantes , 24 13 List of Wikipedias/Table , 25 13 Requests for new languages

May 2011: 1 166 CentralNotice/May 2011 Update , 2 102 Board elections/2011/Translation , 3 94 Steward requests/Permissions , 4 59 Steward requests/Global permissions , 5 53 Board elections/2011/Candidates/en , 6 46 Wikimedia Forum , 7 43 Steward requests/Checkuser , 8 39 Foundation wiki feedback , 9 34 OTRS/Volunteering , 10 32 Board elections/2011/Candidates/Questions/1 , 11 29 Board elections/2011/Candidates/es , 12 28 Steward requests/Global , 13 26 Board elections/2011/Candidates/Questions/2 , 14 26 GLAMcamp NYC , 15 23 Board elections/2011/CentralNotice , 16 18 CentralNotice/Generic maintenance notice , 17 17 Board elections/2011/Candidates/Template/en , 18 17 Steward requests/Bot status , 19 16 Board elections/2011/Candidates/fr , 20 15 Grant Advisory Committee , 21 15 Board elections/2011/Candidates/ja , 22 15 CentralNotice/Log , 23 15 Wikimedia Venezuela , 24 15 Steward requests/Username changes , 25 14 Board elections/2011/es

Jun 2011: 1 99 Wikimedia nomail list , 2 79 Steward requests/Permissions , 3 56 Steward requests/Global permissions , 4 54 Wikimedia Forum , 5 45 Steward requests/Checkuser , 6 42 Steward requests/Global , 7 39 Foundation wiki feedback , 8 35 OTRS/Volunteering , 9 28 Steward requests/SUL requests , 10 22 Steward requests/Bot status , 11 20 Board elections/2011/Candidates/Questions/2 , 12 20 Requests for new languages/Wikipedia Bahrani Arabic , 13 19 Requests for comment/Oppression in zh wikipedia , 14 19 Requests for new languages/Wikipedia Mingrelian , 15 18 WikiConference India 2011 , 16 18 Brazil Catalyst Project/Agenda June 2011 , 17 18 Steward requests/Miscellaneous , 18 16 Board elections/2011/Post mortem , 19 16 Requests for comment/ПешСай@mhr.wikipedia , 20 16 Translation of the week/Translation candidates , 21 15 Global message delivery/Targets/Signpost , 22 15 Steward requests/Username changes , 23 15 Wikimedia chapters , 24 14 OTRS/Personnel , 25 13 Fundraising 2011/Fundraising Summit/Official List of Participants

Jul 2011: 1 85 Steward requests/Permissions , 2 58 Steward requests/Global , 3 54 Steward requests/Global permissions , 4 44 Proposals for closing projects/Closure of Old English Wikipedia , 5 43 Wikimedia Forum , 6 38 Image filter referendum/Translation , 7 38 Steward requests/Checkuser , 8 35 Requests for comment/Global ban for Poetlister , 9 34 Foundation wiki feedback , 10 26 Proposals for closing projects/Closure of Inuktitut Wikipedia (2) , 11 23 Requests for comment/Abigor , 12 19 Steward requests/Bot status , 13 18 Steward requests/SUL requests , 14 18 Steward requests/Miscellaneous , 15 17 Meetup/Hong Kong/55 , 16 17 WikiConference India 2011 , 17 17 Requests for comment/Global banners , 18 17 Wikimedia News , 19 15 Image filter referendum/Announcement/Locations , 20 15 OTRS/Volunteering , 21 15 MediaWiki FAQ , 22 14 Translation of the week/Translation candidates , 23 14 Wikimedia chapters , 24 13 Meetup/London/47 , 25 13 Global message delivery/Targets/Signpost

Aug 2011: 1 357 Wikimedia nomail list , 2 88 Image filter referendum/CentralNotice , 3 86 Image filter referendum/Translation , 4 82 Steward requests/Permissions , 5 63 Wikimedia Forum , 6 56 Stewards/elections 2011-2/Translation/CentralNotice , 7 38 Steward requests/Checkuser , 8 34 Image filter referendum/en , 9 34 Fundraising 2011/Translation/Old , 10 34 Steward requests/Global , 11 33 Foundation wiki feedback , 12 32 Steward requests/Global permissions , 13 29 Image filter referendum/de , 14 27 Steward requests/Username changes , 15 26 Proposed letter of agreement between Wikimedia Foundation and Brazilian volunteers/Signers , 16 26 Wikimedia News , 17 22 Steward requests/SUL requests , 18 21 Steward requests/Bot status , 19 20 Proposals for closing projects/Closure of Scots Wikipedia , 20 19 Stewards/elections 2011-2/Introduction , 21 19 Meetup/Hong Kong/56 , 22 19 Image filter referendum/es , 23 19 Vandalism reports , 24 19 Reports , 25 18 Image filter referendum/fr

Sep 2011: 1 193 Stewards/elections 2011-2/votes/Wikitanvir , 2 178 Stewards/elections 2011-2/votes/Axpde , 3 166 Stewards/elections 2011-2/votes/Vituzzu , 4 150 Stewards/elections 2011-2/votes/Ezarate , 5 147 Stewards/elections 2011-2/votes/Trijnstel , 6 145 Stewards/elections 2011-2/votes/Quentinv57 , 7 138 Stewards/elections 2011-2/votes/Bencmq , 8 133 Stewards/elections 2011-2/votes/Teles , 9 133 Stewards/elections 2011-2/votes/Quadell , 10 132 Stewards/elections 2011-2/votes/Cekli829 , 11 127 Stewards/elections 2011-2/votes/Bennylin , 12 113 Stewards/elections 2011-2/votes/WilliamH , 13 105 Stewards/elections 2011-2/votes/Ruy Pugliesi , 14 100 Stewards/elections 2011-2/votes/Glavkos , 15 93 Stewards/elections 2011-2/votes/Arbitrarily0 , 16 84 Stewards/elections 2011-2/votes/Mikheil88 , 17 68 Stewards/elections 2011-2/votes/Mys 721tx , 18 67 Steward requests/Permissions , 19 58 Steward requests/Global permissions , 20 46 Steward requests/Checkuser , 21 45 OTRS/Volunteering , 22 44 Steward requests/Global , 23 40 Stewards/elections 2011-2/Questions , 24 39 Wikimedia Forum , 25 37 Fundraising 2011/Translation/CentralNotice

Oct 2011: 1 86 Wikimedia Forum , 2 83 Steward requests/Permissions , 3 60 GLAMcamp Amsterdam , 4 53 Steward requests/Checkuser , 5 45 Steward requests/Global permissions , 6 41 Steward requests/Global , 7 40 Foundation wiki feedback , 8 38 Stewards/elections 2011-2/votes/Trijnstel , 9 38 Stewards/elections 2011-2/votes/Teles , 10 34 Stewards/elections 2011-2/votes/Axpde , 11 34 Stewards/elections 2011-2/votes/Vituzzu , 12 32 Controversial content/Brainstorming , 13 31 Stewards/elections 2011-2/votes/Quentinv57 , 14 30 Stewards/elections 2011-2/votes/Quadell , 15 29 Stewards/elections 2011-2/votes/Wikitanvir , 16 25 Wikimedia News , 17 24 Steward requests/Bot status , 18 23 OTRS/Volunteering , 19 22 Stewards/elections 2011-2/votes/Arbitrarily0 , 20 21 Stewards/elections 2011-2/votes/Ruy Pugliesi , 21 21 Stewards/elections 2011-2/votes/Bencmq , 22 20 Stewards/elections 2011-2/votes/Bennylin , 23 19 Fundraising 2011/brazilargentinastorytelling , 24 19 Stewards/elections 2011-2/votes/Ezarate , 25 19 Steward requests/Username changes

Nov 2011: 1 72 Steward requests/Permissions , 2 58 Steward requests/Global permissions , 3 51 Steward requests/Global , 4 43 WikiConference India 2011/Attendees , 5 43 Foundation wiki feedback , 6 38 Steward requests/Checkuser , 7 37 Wikimedia Forum , 8 31 Steward requests/Bot status , 9 29 Fundraising 2011/Translation/Banner , 10 26 GLAMcamp Amsterdam , 11 24 Meetup/London/51 , 12 22 Fundraising 2011/Jimmy Letter 002/ru , 13 21 OTRS/Volunteering , 14 20 Meetup/Sue Gardner at Imperial College London , 15 20 Steward requests/Username changes , 16 19 Fundraising 2011/Translation/Past donors mail , 17 17 Controversial content/Brainstorming , 18 15 Wikimedia chapters , 19 14 Global message delivery/Targets/Signpost , 20 13 Proposals for closing projects/Closure of Fiji Wikipedia 2 , 21 13 Wikimedia News , 22 12 Fundraising 2011/Jimmy Letter 002/es , 23 12 List of Wikipedias/Table , 24 12 Vandalism reports , 25 11 Fundraising and Funds Dissemination/Funds Dissemination Criteria Table

Dec 2011: 1 77 Steward requests/Permissions , 2 46 Wikimedia Forum , 3 35 Steward requests/Global permissions , 4 33 Steward requests/Checkuser , 5 29 Steward requests/Global , 6 28 Steward requests/Bot status , 7 25 Foundation wiki feedback , 8 21 GLAMcamp DC , 9 20 What Gender Is Wikipedia , 10 19 GLAMcamp Amsterdam , 11 18 Steward requests/Username changes , 12 16 OTRS/Volunteering , 13 15 WikiWomenCamp/FAQ , 14 14 Wikimedia Venezuela/Elección del Portavoz , 15 14 Wikimedia News , 16 12 Mobile projects/WikipediaMobileAndroidFeedback , 17 12 List of Wikipedias/Table , 18 10 Wikimedians in Thailand/Wikiclubs in schools/members , 19 10 Global message delivery/Targets/GLAM , 20 10 Steward requests/Miscellaneous , 21 10 Wikimedia chapters , 22 9 Meetup/Hong Kong/60 , 23 9 Requests for new languages/Wikipedia Kildin Sami , 24 9 Meetup/London/52 , 25 9 Distribution list/Global message delivery

Jan 2012: 1 103 Steward requests/Permissions , 2 53 English Wikipedia anti-SOPA blackout/Congress data , 3 48 Steward requests/Global permissions , 4 47 Wikimedia Forum , 5 41 Steward requests/Global , 6 40 Wikimedia Conference 2012/Participants , 7 39 Foundation wiki feedback , 8 35 Finance meeting 2012 , 9 34 Wikimania 2012/CentralNotice , 10 31 Huggle/Members , 11 31 OTRS/Volunteering , 12 30 Wikimedia chapters/Existing chapters , 13 30 Steward requests/Checkuser , 14 27 Stewards/Elections 2012/Translation/CentralNotice , 15 26 English Wikipedia anti-SOPA blackout/Post-mortem , 16 25 English Wikipedia anti-SOPA blackout/Media , 17 25 Steward requests/Bot status , 18 23 Stewards/Elections 2012/Questions , 19 23 Romanized Pashto Wikipedia/supporters , 20 21 Stewards/Elections 2012/Introduction , 21 21 Stewards/Confirm/Introduction12 , 22 21 Wikimedia News , 23 19 English Wikipedia anti-SOPA blackout/Technical FAQ , 24 19 Steward requests/Username changes , 25 16 Stewards/Elections 2012

Feb 2012: 1 341 Stewards/Elections 2012/Votes/Billinghurst , 2 289 Stewards/Elections 2012/Votes/Snowolf , 3 284 Stewards/Elections 2012/Votes/Elfix , 4 282 Stewards/Elections 2012/Votes/MBisanz , 5 261 Stewards/Elections 2012/Votes/Pundit , 6 252 Stewards/Elections 2012/Votes/Teles , 7 236 Stewards/Elections 2012/Votes/Nihonjoe , 8 234 Stewards/Elections 2012/Votes/Tegel , 9 234 Stewards/Elections 2012/Votes/Luckas Blade , 10 148 Stewards/Elections 2012/Votes/Cekli829 , 11 104 Stewards/Confirm/2012/Magister Mathematicae , 12 95 Stewards/Confirm/2012/DerHexer , 13 91 Steward requests/Permissions , 14 83 Stewards/Confirm/2012/MarcoAurelio , 15 72 Stewards/Confirm/2012/Barras , 16 72 Stewards/Confirm/2012/PeterSymonds , 17 68 Stewards/Confirm/2012/Quentinv57 , 18 68 Wikimedia Forum , 19 63 Stewards/Confirm/2012/Matanya , 20 62 Stewards/Confirm/2012/Dungodung , 21 60 Steward requests/Global permissions , 22 59 Wikimania 2012/CentralNotice , 23 58 Requests for comment/Meta-wiki requests for comment on users , 24 58 Stewards/Confirm/2012/Pathoschild , 25 57 Stewards/Confirm/2012/Darkoneko

Mar 2012: 1 93 Steward requests/Permissions , 2 80 Steward requests/Global permissions , 3 51 Steward requests/Checkuser , 4 48 Wikimedia Forum , 5 42 Chapters Council/Chapter Support , 6 42 Steward requests/Global , 7 35 Wikimania 2013 bids/Hong Kong , 8 35 Steward requests/Bot status , 9 30 Requests for comment/Userrights on Hindi Wikipedia , 10 25 Proposals for closing projects/Closure of Buryat Wikipedia , 11 24 Requests for new languages/Wikipedia Paxto , 12 21 Meetup/London/55 , 13 21 Steward requests/Username changes , 14 19 Steward requests/SUL requests , 15 19 Wikimedia News , 16 15 Meetup/Monmouth/1 , 17 15 Wikimedia Conference 2012/Participants , 18 15 Romanized Pashto Wikipedia/supporters , 19 15 Foundation wiki feedback , 20 15 OTRS/Volunteering , 21 14 WikiWomenCamp/Participation , 22 13 Wikimedia Conference 2012/WLM , 23 13 Meetup/Manchester/12 , 24 12 Turkic Wikimedia Conference 2012/Participants , 25 12 Requests for new languages/Wikipedia Talysh

Apr 2012: 1 88 Steward requests/Permissions , 2 57 Steward requests/Global , 3 56 Steward requests/Global permissions , 4 55 Funds Dissemination Committee/FDC Advisory Group/Formation , 5 42 Foundation wiki feedback , 6 41 Wikivoyage/Supporters , 7 40 Steward requests/Checkuser , 8 29 Wikidata/Volunteers , 9 29 Wikimedia Forum , 10 29 OTRS/Volunteering , 11 26 Steward requests/Bot status , 12 18 Stewards' noticeboard , 13 18 Steward requests/Username changes , 14 17 Sister Projects Committee/Members , 15 17 Proposals for closing projects/Closure of Buryat Wikipedia , 16 14 Sister Projects Committee , 17 14 Wikimedia Costa Rica/es , 18 14 CentralNotice/Generic maintenance notice , 19 14 Steward requests/Miscellaneous , 20 13 Meetup/Monmouth/1 , 21 13 Wikimania 2013 bids/London , 22 13 Steward requests/SUL requests , 23 12 Wikidata , 24 12 Requests for new languages/Wikipedia Tuvan , 25 11 Spam blacklist/Log/2012/04

May 2012: 1 81 Steward requests/Permissions , 2 54 Wikimedia Forum , 3 51 Foundation wiki feedback , 4 50 Steward requests/Global permissions , 5 47 Steward requests/Global , 6 39 Steward requests/Checkuser , 7 32 OTRS/Volunteering , 8 30 Steward requests/Bot status , 9 29 Requests for comment/Disable local uploads on smaller wikis , 10 28 Steward requests/Username changes , 11 20 Wikimania 2014 bids/London , 12 19 Steward requests/Miscellaneous , 13 18 Huggle/Members , 14 18 Wikimedia News , 15 16 WikiWomenCamp/Participation , 16 16 Requests for new languages/Wikipedia Talysh , 17 13 IRC office hours , 18 11 Meetup/Cambridge/15 , 19 11 Spam blacklist , 20 10 Spam blacklist/Log/2012/05 , 21 10 List of Wikipedias/Table , 22 10 Steward requests/Miscellaneous/Bot-reported , 23 9 Wikimedia Blog/Calendar , 24 9 Funds Dissemination Committee/Framework for the Creation and Initial Operation of the FDC , 25 9 Meetup/Hong Kong/65

Jun 2012: 1 82 Steward requests/Permissions , 2 71 Steward requests/Global permissions , 3 54 Steward requests/Global , 4 43 Requests for comment/Internet Defense League , 5 36 Wikimedia Forum , 6 31 Steward requests/Checkuser , 7 23 Grant Advisory Committee/Candidates , 8 23 Steward requests/Bot status , 9 22 Requests for comment/Global bans , 10 21 OTRS/Volunteering , 11 16 Steward requests/Username changes , 12 15 Funds Dissemination Committee/Framework for the Creation and Initial Operation of the FDC , 13 15 Foundation wiki feedback , 14 14 Wikimedia Blog/Calendar , 15 13 Steward requests/Miscellaneous , 16 12 Spam blacklist , 17 11 Meetup/London/59 , 18 11 Spam blacklist/Log/2012/06 , 19 10 IRC/Hosts , 20 10 Wikidata/Development , 21 10 Global message delivery/Targets/Signpost , 22 10 Steward requests/SUL requests , 23 9 Wikimedia Chapters Association/Membership , 24 9 Funds Dissemination Committee/Draft FDC Proposal for the Board/FAQs , 25 9 Wikimedia Cascadia

Jul 2012: 1 577 Requests for comment/Travel Guide , 2 123 Requests for comment/Global bans , 3 80 Steward requests/Permissions , 4 43 Steward requests/Checkuser , 5 39 Wikimedia Forum , 6 38 Steward requests/Bot status , 7 37 Steward requests/Global , 8 33 Requests for comment/Sysop abuse on the Turkish Wikipedia , 9 33 CentralNotice/Travel Guide , 10 31 Steward requests/Global permissions , 11 27 Requests for comment/Internet Defense League , 12 23 Foundation wiki feedback , 13 23 OTRS/Volunteering , 14 21 Wikimedia Chapters Association/Membership , 15 20 Wikidata/Logo voting , 16 19 Wikivoyage , 17 18 Requests for comment/Wiki mobbing on de.wikipedia , 18 18 Stewards' noticeboard , 19 17 Requests for new languages/Wikiversity Tamil , 20 17 Wikidata/Volunteers , 21 16 Wikivoyage/Supporters , 22 15 Steward requests/SUL requests , 23 14 IRC office hours , 24 13 Wikimedia Chapters Association/Meetings/First Meeting , 25 13 Global message delivery/Targets/Signpost

Aug 2012: 1 85 Requests for comment/Travel Guide , 2 67 Steward requests/Permissions , 3 58 Funds Dissemination Committee/Nominations , 4 55 Wikivoyage/New language versions , 5 50 Steward requests/Checkuser , 6 43 Global message delivery/Targets/Wikidata , 7 43 Steward requests/Global permissions , 8 42 Steward requests/Global , 9 35 Wikimedia Forum , 10 33 OTRS/Volunteering , 11 30 Funds Dissemination Committee/Nominations/Q&A , 12 27 Wikimedia Fellowships/Project Ideas/The Wikipedia Library , 13 24 Steward requests/Bot status , 14 20 Proposals for closing projects/Closure of Strategy Wiki , 15 17 Funds Dissemination Committee/Call for Volunteers , 16 16 Proposals for closing projects/Closure of Simple English Wiktionary (3) , 17 16 OTRS/Personnel , 18 15 Requests for comment/Global bans , 19 15 Foundation wiki feedback , 20 15 Steward requests/Username changes , 21 14 Meetup/London/60 , 22 14 Reports , 23 13 Requests for comment/Sysop abuse on the Turkish Wikipedia , 24 13 Wiki Project Med , 25 13 Wikimedia News

Sep 2012: 1 98 Request for comment/Legal Fees Assistance Program/Option1 , 2 81 Steward requests/Permissions , 3 78 Wikivoyage/Naming straw poll , 4 41 Steward requests/Global , 5 39 Wikimedia Forum , 6 29 Wikivoyage/Migration/New policies/Cross-identification of accounts/Verify , 7 26 Steward requests/Checkuser , 8 25 Request for comment/Legal Fees Assistance Program/Option2 , 9 24 Wikivoyage/New language versions , 10 24 Wikimedia Indigenous Languages/Participants , 11 24 Steward requests/Global permissions , 12 23 Global message delivery/Targets/Wikidata , 13 22 Requests for comment/Sysop abuse on the Zazaki Wikipedia , 14 21 Steward requests/Bot status , 15 20 OTRS/Volunteering , 16 17 Reports , 17 16 Foundation wiki feedback , 18 15 Wikimania 2014 bids/Bukittinggi , 19 14 Steward requests/Username changes , 20 13 Wikivoyage/Migration/New policies , 21 13 Wikimania/Scholarships/2012 , 22 13 Steward requests/Miscellaneous , 23 12 Meetup/London/62 , 24 12 Requests for new languages/Wikipedia South Azerbaijani , 25 11 FDC portal/FDC members/2012-2013 round1

Oct 2012: 1 240 Wikivoyage/Naming Process/ProposedNames , 2 70 Steward requests/Permissions , 3 68 Wikivoyage/Logo/Round 1 , 4 51 Steward requests/Global permissions , 5 45 Steward requests/Global , 6 39 Wikimedia Forum , 7 34 Steward requests/Checkuser , 8 30 IRC/Group Contacts/Meetings/October 2012 , 9 29 Planet Wikimedia/Names , 10 24 Wiki Project Med , 11 23 Steward requests/Username changes , 12 23 OTRS/Volunteering , 13 22 Wikivoyage/New language versions , 14 22 Global message delivery/Targets/Wikidata , 15 22 Foundation wiki feedback , 16 20 Steward requests/Bot status , 17 18 Wikimedia Chapters Association/Resolutions/2012 SG recruitment , 18 18 Wikimedia Deutschland/Offener Sonntag November 2012 , 19 18 Wikimedia CEE Meeting 2012/Attendees , 20 17 FDC portal/Questions for FDC staff/2012-2013 round1 , 21 17 Steward requests/SUL requests , 22 17 Steward requests/Miscellaneous , 23 15 Wikivoyage/Migration/New policies/Cross-identification of accounts/Verify , 24 15 Wikimedia Chapters Association/Resolutions/2012 Office location , 25 14 Reports

Nov 2012: 1 290 Wikivoyage/Logo/Round 1 , 2 88 Steward requests/Permissions , 3 60 Steward requests/Global permissions , 4 41 Wikivoyage/Logo , 5 40 Wikivoyage/For naming Russian Wikivoyage \"Викигид\" , 6 37 Wikivoyage/Launch , 7 36 Wikimedia Forum , 8 34 OTRS/Volunteering , 9 32 Proposals for closing projects/Closure of English Wikinews , 10 32 Global message delivery/Targets/Wikidata , 11 32 Steward requests/Checkuser , 12 31 Wikivoyage/For naming Russian Wikivoyage \"Викивояж\" , 13 30 Wikimedia Deutschland/Offener Sonntag November 2012 , 14 30 Steward requests/Global , 15 29 Steward requests/Username changes , 16 28 Democratizing the Wikimedia Foundation , 17 25 Foundation wiki feedback , 18 25 Steward requests/Miscellaneous , 19 24 Glossary , 20 22 Requests for new languages/Wikivoyage Spanish , 21 21 GDJ 2012/Lista uczestników , 22 21 Steward requests/Bot status , 23 19 Wikimedia Chapters Association/Resolutions/2012 WCA place of registration , 24 18 Steward requests/SUL requests , 25 17 Wikivoyage/New language versions

Dec 2012: 1 153 Wikivoyage/Logo , 2 79 Steward requests/Permissions , 3 48 Steward requests/Global permissions , 4 39 Wikimedia Forum , 5 36 Steward requests/Global , 6 27 Steward requests/Bot status , 7 24 Requests for new languages/Wikipedia Minangkabau , 8 23 WikiFocus , 9 23 OTRS/Volunteering , 10 23 Steward requests/Checkuser , 11 21 Global message delivery/Targets/Wikidata , 12 21 Foundation wiki feedback , 13 20 Concise Wikipedia , 14 17 Steward requests/Username changes , 15 16 Concise Wikipedia/supporters , 16 15 Steward requests/Miscellaneous , 17 14 Proposals for new projects/WikiFocus/supporters , 18 13 Ombudsman commission/reform proposals , 19 13 Wiki Project Med , 20 13 Steward requests/SUL requests , 21 12 Metrics and activities meetings/2012-12-06 , 22 12 Reports , 23 11 Wikimedia News , 24 10 Individual Engagement Grants , 25 10 Wikikultur/supporters

Jan 2013: 1 113 Steward requests/Permissions , 2 83 Steward requests/Global permissions , 3 58 Wikimania 2013/CentralNotice , 4 47 Steward requests/Global , 5 35 Steward requests/Checkuser , 6 35 Steward requests/Bot status , 7 34 Wikivoyage 2013/CentralNotice , 8 33 Wikimedia Forum , 9 31 Foundation wiki feedback , 10 28 Global message delivery/Targets/Wikidata , 11 28 OTRS/Volunteering , 12 27 Stewards/Elections 2013/Questions , 13 23 Steward requests/Username changes , 14 18 CentralNotice/Generic maintenance notice , 15 18 Steward requests/SUL requests , 16 18 OTRS/Personnel , 17 18 Steward requests/Miscellaneous , 18 16 Stewards/Elections 2013 , 19 16 Wikivoyage/Lounge , 20 14 CentralNotice/Calendar , 21 14 Wikimedia News , 22 13 Global message delivery/Targets/Grants News , 23 13 Metrics and activities meetings/2013-01-10 , 24 13 Wikimedia Blog/Calendar , 25 12 Wikimedia Blog/Drafts/Your First Million Is Never Forgotten

Feb 2013: 1 335 Stewards/Elections 2013/Votes/MF-Warburg , 2 288 Stewards/Elections 2013/Votes/Jon Harald Søby , 3 258 Stewards/Elections 2013/Votes/Mathonius , 4 247 Stewards/Elections 2013/Votes/Amqui , 5 210 Stewards/Elections 2013/Votes/BRUTE , 6 193 Stewards/Elections 2013/Votes/QuiteUnusual , 7 190 Stewards/Elections 2013/Votes/Ezarate , 8 182 Stewards/Elections 2013/Votes/Cekli829 , 9 150 Stewards/Elections 2013/Votes/Arbitrarily0 , 10 143 Stewards/Elections 2013/Votes/Bletilla , 11 121 WebCite/supporters , 12 97 Stewards/Confirm/2013/Vituzzu , 13 95 Steward requests/Permissions , 14 88 Wikimania 2013/CentralNotice , 15 85 Stewards/Confirm/2013/DerHexer , 16 83 Stewards/Confirm/2013/Snowolf , 17 76 Stewards/Confirm/2013/Trijnstel , 18 75 Stewards/Confirm/2013/Barras , 19 73 Stewards/Confirm/2013/PeterSymonds , 20 72 Stewards/Confirm/2013/Quentinv57 , 21 71 Stewards/Confirm/2013/MarcoAurelio , 22 68 Stewards/Confirm/2013/Billinghurst , 23 62 WebCite , 24 62 Global message delivery/Targets/Wikidata , 25 60 Stewards/Confirm/2013/Wikitanvir

Mar 2013: 1 114 Steward requests/Permissions , 2 67 Global message delivery/Targets/Wikidata , 3 63 Wikimania 2013/CentralNotice , 4 61 Wikimedia CAT/Members and Supporters , 5 48 Wikimedia Conference 2013/Participants , 6 44 WebCite/supporters , 7 44 Steward requests/Global , 8 43 Lua deployments/Localization of Module , 9 40 Steward requests/Checkuser , 10 35 Requests for comment/Adopt OmegaWiki , 11 34 Stewards' noticeboard , 12 33 Wikimedia Forum , 13 28 Steward requests/Global permissions , 14 27 Steward requests/Bot status , 15 26 Requests for comment/Wikidata rollout and interwiki bots , 16 24 OTRS/Volunteering , 17 23 Foundation wiki feedback , 18 22 Requests for comment/Approval of the rewritten Meta-Steward relationship document as policy/Vote , 19 22 Steward requests/SUL requests , 20 21 WebCite , 21 20 Wikivoyage/Lounge , 22 20 Wikimedia News , 23 19 Steward requests/Username changes , 24 19 Steward requests/Miscellaneous , 25 15 EU Policy/Big Fat Brussels Meeting

Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Thursday April 25, 2013 18:21

Dump file metawiki-20130410-pages-meta-history.xml.7z (full dump), size 994 Mb as 7z -> 109 Gb
Dump processed till Mar 31, 2013, on server stat1, ready at Fri-12/04/2013-07:35 after 1 hrs, 17 min, 3 sec.

Versão do script:2.6
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.