Estatísticas da Wikispecial nostalgia

Zoom           
Monthly counts & Quarterly rankings / New: Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist
 
Monthly counts & Quarterly rankings
 
DataAutoresArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
mai 2009328   24 k 3,91829 49 Mb6,8 M211 k6( )8,9 k4,7 k
abr 2009328   24 k 3,91829 49 Mb6,8 M211 k6( )8,9 k4,7 k
mar 2009328   24 k 3,91829 49 Mb6,8 M211 k6( )8,9 k4,7 k
fev 2009328   24 k 3,91829 49 Mb6,8 M211 k6( )8,9 k4,7 k
jan 2009328   24 k 3,91829 49 Mb6,8 M211 k6( )8,9 k4,7 k
dez 2008328   24 k 3,91829 49 Mb6,8 M211 k6( )8,9 k4,7 k
nov 2008328   24 k 3,91829 49 Mb6,8 M211 k6( )8,9 k4,7 k
out 2008328   24 k 3,91829 49 Mb6,8 M211 k6( )8,9 k4,7 k
set 2008328   24 k 3,91829 49 Mb6,8 M211 k6( )8,9 k4,7 k
ago 2008328   24 k 3,91829 49 Mb6,8 M211 k6( )8,9 k4,7 k
jul 2008328   24 k 3,91829 49 Mb6,8 M211 k6( )8,9 k4,7 k
jun 2008328   24 k 3,91829 49 Mb6,8 M211 k6( )8,9 k4,7 k
abr 2009328   24 k 3,91829 49 Mb6,8 M211 k6( )8,9 k4,7 k
jan 2009328   24 k 3,91829 49 Mb6,8 M211 k6( )8,9 k4,7 k
out 2008328   24 k 3,91829 49 Mb6,8 M211 k6( )8,9 k4,7 k
jul 2008328   24 k 3,91829 49 Mb6,8 M211 k6( )8,9 k4,7 k
abr 2008328   24 k 3,91829 49 Mb6,8 M211 k6( )8,9 k4,7 k
jan 2008328   24 k 3,91829 49 Mb6,8 M211 k6( )8,9 k4,7 k
out 2007328   24 k 3,91829 49 Mb6,8 M211 k6( )8,9 k4,7 k
jul 2007328   24 k 3,91829 49 Mb6,8 M211 k6( )8,9 k4,7 k
abr 2007328   24 k 3,91829 49 Mb6,8 M211 k6( )8,9 k4,7 k
jan 2007328   24 k 3,91829 49 Mb6,8 M211 k6( )8,9 k4,7 k
out 2006328   24 k 3,91829 49 Mb6,8 M211 k6( )8,9 k4,7 k
jul 2006328   24 k 3,91829 49 Mb6,8 M211 k6( )8,9 k4,7 k
abr 2006328   24 k 3,91829 49 Mb6,8 M211 k6( )8,9 k4,7 k
jan 2006328   24 k 3,91829 49 Mb6,8 M211 k6( )8,9 k4,7 k
out 2005328   24 k 3,91829 49 Mb6,8 M211 k6( )8,9 k4,7 k
jul 2005328   24 k 3,91829 49 Mb6,8 M211 k6( )8,9 k4,7 k
abr 2005328   24 k 3,91829 49 Mb6,8 M211 k6( )8,9 k4,7 k
jan 200532811124 k233,918295,1 k49 Mb6,8 M211 k6( )8,9 k4,7 k
out 2004327   23 k 3,81794 49 Mb6,5 M203 k6( )8,4 k4,5 k
jul 2004327   23 k 3,81794 49 Mb6,5 M203 k6( )8,4 k4,5 k
abr 2004327   23 k 3,81794 49 Mb6,5 M203 k6( )8,4 k4,5 k
jan 2004327   23 k 3,81794 49 Mb6,5 M203 k6( )8,4 k4,5 k
out 2003327   23 k 3,81794 49 Mb6,5 M203 k6( )8,4 k4,5 k
jul 2003327   23 k 3,81794 49 Mb6,5 M203 k6( )8,4 k4,5 k
abr 2003327   23 k 3,81794 49 Mb6,5 M203 k6( )8,4 k4,5 k
jan 2003327   23 k 3,81794 49 Mb6,5 M203 k6( )8,4 k4,5 k
out 2002327   23 k 3,81794 49 Mb6,5 M203 k6( )8,4 k4,5 k
jul 2002327   23 k 3,81794 49 Mb6,5 M203 k6( )8,4 k4,5 k
abr 2002327   23 k 3,81794 49 Mb6,5 M203 k6( )8,4 k4,5 k
jan 2002327   23 k 3,81794 49 Mb6,5 M203 k6( )8,4 k4,5 k
out 2001243411382617 k1932,7165315 k35 Mb4,3 M128 k9( )4,8 k3,3 k
jul 2001114497134,7 k393,111293,2 k10,0 Mb868 k29 k1( )9321,6 k
abr 20014772731,6 k173,511211,6 k4,6 Mb303 k8,2 k ( )188857
jan 2001111111 42110,61375444422 kb9,5 k53 ( )161
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
 AutoresArtigosBase de dadosLigações

Counts for image links are based on keyword(s) found in the message file for this language: (Image).
Note that image links based on default keyword 'Image' and/or 'File' have been missed. This will be repaired on the next run.

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

Autores (usuários registrados)
A = Autores que editaram pelo menos dez vezes desde que chegaram (sep11: all)
B = Aumento no número de autores que editaram pelo menos dez vezes desde que chegaram
C = Autores que contribuíram cinco vezes ou mais este mês
D = Autores que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


New: Edit activity levels of registered users and bots per group of namespaces

Namespaces: Articles = 0   Talk = 1,3,5,7,9,..   Other = 2,4,6,8,..

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 5  10  25  100  250  1000  2500  5  5  5  5  5 
mai 2009            
abr 2009            
mar 2009            
fev 2009            
jan 2009            
dez 2008            
nov 2008            
out 2008            
set 2008            
ago 2008            
jul 2008            
jun 2008            
abr 2009            
jan 2009            
out 2008            
jul 2008            
abr 2008            
jan 2008            
out 2007            
jul 2007            
abr 2007            
jan 2007            
out 2006            
jul 2006            
abr 2006            
jan 2006            
out 2005            
jul 2005            
abr 2005            
jan 20051111111   1 
out 2004            
jul 2004            
abr 2004            
jan 2004            
out 2003            
jul 2003            
abr 2003            
jan 2003            
out 2002            
jul 2002            
abr 2002            
jan 2002            
out 2001138113792610       
jul 20017142213        
abr 20012717931       
jan 20011184         

 

Distribuição de edições de artigos por autores
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=AutoresEdições total
1931100.0%70926100.0%
349953.6%7023099.0%
1032835.2%6925297.6%
3220221.7%6704694.5%
10011412.2%6204187.5%
316525.6%5109772.0%
1000171.8%3017242.5%
316210.1%50647.1%

 

20 autores recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesPrimeira ediçãoúltima edição
 posiçãototaldatadias
atrás
datadias
atrás
Larry_Sanger23007mar 01, 20013012dez 20, 20012718
KoyaanisQatsi32451abr 26, 20012956set 08, 20012821
MichaelTinkler42446jul 31, 20012860dez 18, 20012720
Koyaanis_Qatsi51948jul 20, 20012871dez 16, 20012722
AxelBoldt61775jul 26, 20012865dez 20, 20012718
Zundark71580ago 07, 20012853dez 20, 20012718
Lee_Daniel_Crocker81369mar 14, 20012999dez 20, 20012718
TimShell91320jan 27, 20013045dez 18, 20012720
The_Anome101291nov 04, 20012764dez 17, 20012721
The_Cunctator111235jul 26, 20012865dez 20, 20012718
Ed_Poor121212nov 29, 20012739dez 20, 20012718
Sjc131169mai 28, 20012924dez 18, 20012720
Bryan_Derksen141160ago 21, 20012839dez 20, 20012718
Derek_Ross151082nov 13, 20012755dez 16, 20012722
Josh_Grosse161049fev 20, 20013021dez 20, 20012718
ManningBartlett171014set 24, 20012805dez 14, 20012724
WojPob18968jan 29, 20013043dez 19, 20012719
Stephen_Gilbert19963mar 26, 20012987dez 20, 20012718
Paul_Drye20890set 19, 20012810dez 20, 20012718
Taw21880ago 15, 20012845dez 20, 20012718

 

usuários anônimos, ordenados por número de contribuições
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
200.191.188.xxx1781
62.253.64.xxx1183
203.109.250.xxx574
63.192.137.xxx486
61.9.128.xxx479
66.153.24.xxx468
213.253.39.xxx398
216.99.203.xxx364
129.128.164.xxx304
65.68.87.xxx259

No total 22.144 edições foram feitas por usuários anônimos, de um total de 93.105 edições ( 23e %)
 


Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110
mai 200932 k 2 6          
abr 200932 k 2 6          
mar 200932 k 2 6          
fev 200932 k 2 6          
jan 200932 k 2 6          
dez 200832 k 2 6          
abr 200932 k 2 6          
jan 200932 k 2 6          
out 200832 k 2 6          
jul 200832 k 2 5          
abr 200832 k 2 5          
jan 200832 k 2 5          
out 200732 k 2 5          
jul 200732 k 2 5          
abr 200732 k 2 5          
jan 200732 k 2 5          
out 200632 k 2 5          
jul 200632 k 2 5          
abr 200632 k 2 5          
jan 200632 k 2 5          
out 200532 k 2 5          
jul 200532 k 2 5          
abr 200532 k 2 5          
jan 200532 k 2 5          
out 200432 k              
jul 200432 k              
abr 200432 k              
jan 200432 k              
out 200332 k              
jul 200332 k              
abr 200332 k              
jan 200332 k              
out 200232 k              
jul 200232 k              
abr 200232 k              
jan 200232 k              
out 200123 k              
jul 20018,6 k              
abr 20013,5 k              
jan 2001290              

 

50 most edited articles (> 25 edits)  More..
 

EdiçõesUnique usersArtigosArchived
TotalReg.Reg.Unreg.
12687%307Wikipedia utilities/Page titles to be deleted< 1 Mb  
12384%137Creationism< 1 Mb  
8175%138Feminism< 1 Mb  
6991%104Ed Poor< 1 Mb  
6888%105The Cunctator/How to destroy Wikipedia< 1 Mb  
6481%122Falsifiability/Talk< 1 Mb  
6284%86Christian views of homosexuality< 1 Mb  
5978%95Judeo-Christian tradition< 1 Mb  
5775%209The Wikipedia Militia< 1 Mb  
5679%93Opera browser< 1 Mb  
5589%104Galileo/Talk< 1 Mb  
5571%54Orders of magnitude< 1 Mb  
5392%124Wikipedia Religion and Mythology standards1.0 Mb  
5271%105Falsifiability< 1 Mb  
5296%152God/Talk< 1 Mb  
5186%84Judeo-Christian tradition/Talk< 1 Mb  
5171%1811Requested articles< 1 Mb  
4980%94Go< 1 Mb  
4798%81Taw< 1 Mb  
4696%172God< 1 Mb  
4687%63Thorn/Talk< 1 Mb  
4596%112History of Poland< 1 Mb  
4584%56Intelligent Design< 1 Mb  
4461%137Current events< 1 Mb  
4470%93Taliban/Talk< 1 Mb  
4491%93The stories of Christianity/Talk< 1 Mb  
4374%42Homophobia< 1 Mb  
4281%114Christian Mythology/Talk< 1 Mb  
42100%6 Fundamental Dimensions/Talk< 1 Mb  
4290%113Wikipedia Announcements< 1 Mb  
4298%101Wikipedia subpages pros and cons< 1 Mb  
4185%74Intelligent Design/Talk< 1 Mb  
4173%96Silesia/Talk< 1 Mb  
4195%172Wikipedians/History talk< 1 Mb  
4195%172Wikipedia utilities/find or fix a stub< 1 Mb  
4090%153Larry Sanger< 1 Mb  
4095%61Wikipedia utilities< 1 Mb  
3992%112Noam Chomsky< 1 Mb  
3913%11TwoOneTwo< 1 Mb  
3882%62Jzcool< 1 Mb  
3868%64United States Constitution/Amendment Fourteen< 1 Mb  
3882%83White trash/Talk< 1 Mb  
36100%3 Asynchronous Transfer Mode< 1 Mb  
3678%92Christian views of homosexuality/Talk< 1 Mb  
3681%92Free software/Talk< 1 Mb  
3689%83Galileo Galilei< 1 Mb  
3678%238Wikipedia Announcements/Larrys Wedding Card< 1 Mb  
35100%6 HomePage< 1 Mb  
3577%92Masculism/Talk< 1 Mb  
3583%74Silesia< 1 Mb  

 

ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

jan 2001: 1 3 WikiSupremeCourt , 2 3 UsenetCabal , 3 2 SlavicLanguages , 4 2 SnowBOARDING , 5 2 SwedisH , 6 2 RationalNumbers , 7 2 RinGs , 8 2 PhillipHankins , 9 2 NirvanaBuddhism , 10 2 MappinG , 11 2 MerloT , 12 2 InaugurationProtests , 13 2 CalvinOstrum , 14 2 AtlasShrugged/WhyThisSectionExists , 15 2 AbbevilleFrance , 16 2 ALittleLuck , 17 1 ZeuS

fev 2001: 1 5 SportS , 2 4 UnitedStates/AmericasPoor , 3 3 ZeuS , 4 3 WikiShouldOfferSimplifiedUseOfTables , 5 3 VisualArtsAndDesign , 6 3 StatisticalModel , 7 3 StatisticalAssumptions , 8 3 SeriousScholarshipTalk , 9 3 ResearchSubjects , 10 3 PoetrY , 11 3 MacroeconomicS , 12 3 LiteraTure , 13 3 HollywooD , 14 3 GoD , 15 2 WhatIsMathematicsReally , 16 2 WaltZ , 17 2 WhyRossum , 18 2 WolfgangAmadeusMozart , 19 2 UnitedStates/StandardOfLiving , 20 2 UnitedStates , 21 2 Therapy/Occupational , 22 2 ThePurposeOfGovernment/Talk , 23 2 TraditionalAnarchism/Talk , 24 2 TheRationalityOfAtheism , 25 2 TheProblemOfEvil/Talk

mar 2001: 1 6 Stupid Republicans , 2 4 This (way) , 3 3 Wikipedia commentary/Like this , 4 3 William Jefferson Clinton , 5 3 Wiki ASCII codes page , 6 3 WikiPediaFaq , 7 3 Scepticism , 8 3 ScienceFiction , 9 3 Populism and Nationalism/Talk , 10 3 Pseudo science , 11 3 PseudoScience , 12 3 Minuscule , 13 3 JapaneseLanguage , 14 3 Games/Letter , 15 3 Games/Board , 16 3 Extinct political countries, empires, etc. , 17 3 ConstitutioN , 18 3 ComputerHardware , 19 3 ArthurKoestler , 20 2 Zimbabwe/Transational Issues , 21 2 Wikipedia Commentary/Ethics or Morals , 22 2 WikiIsNotAnEncyclopedia , 23 2 Welcome Newcomers/Talk , 24 2 William Ernest Henley , 25 2 William Jefferson Clinton/Talk

abr 2001: 1 4 Turkish , 2 3 Why Wikipedia is so great/Talk , 3 3 Tensors , 4 3 Hormone , 5 3 Fish , 6 3 Anarres , 7 3 Atlas 2091 , 8 2 Wilhelm von Humboldt , 9 2 WeaRable , 10 2 White elephant , 11 2 Wikipedia commentary/A poem of sorts in narrative style... , 12 2 Time constraints , 13 2 Trade secret , 14 2 Spike Lee , 15 2 Silence of the Lambs , 16 2 Scorpio , 17 2 Statutes of limitations , 18 2 Sanctions , 19 2 Ridley Scott , 20 2 Random Page , 21 2 Richard Petty , 22 2 RulesToConsider/Define and Describe , 23 2 Paul Robeson , 24 2 Political conservative , 25 2 Pseudorandomness

mai 2001: 1 4 User friendly , 2 4 Sexism/Talk , 3 4 Swiss cheese , 4 3 WWF , 5 3 Valerian , 6 3 Trolltech , 7 3 Sequential access , 8 3 MusicMatch , 9 3 Millsaps College , 10 3 Laws of Kepler , 11 3 Guernsey/History , 12 3 Film Directors , 13 2 Zippy the Pinhead , 14 2 Z , 15 2 Y , 16 2 Whisky/Canadian , 17 2 Whisky/scotch , 18 2 Whiskey , 19 2 World Wildlife Fund , 20 2 Wu-Tang Clan , 21 2 Wiki Administrators , 22 2 Varanger glaciation , 23 2 Veal , 24 2 Vieille Montagne , 25 2 Vidkun Quisling

jun 2001: 1 6 Unamerican activities , 2 4 When Harry Met Sally , 3 4 World War II/OKH , 4 4 Unamerican activities/Talk , 5 3 Yellow fever , 6 3 Wikipedia/Questions , 7 3 War film , 8 3 Vim mappings , 9 3 The Night of the Living Dead , 10 3 Tyburn , 11 3 SoftwareDevelopmentProcess , 12 3 Rammstein , 13 3 Mandrake , 14 3 John Cabot , 15 3 Isotope , 16 3 Historical anniversaries/January 2 , 17 3 Coma , 18 3 Basic tastes , 19 2 Yellow fever/Talk , 20 2 William deVries , 21 2 WorldForge/Talk , 22 2 Werner Herzog , 23 2 Wathiik , 24 2 World War I/reparations , 25 2 World War II/Double Cross System

jul 2001: 1 9 WikiPediaBugs , 2 5 Third World/Talk , 3 5 Science fiction television , 4 4 William Morris , 5 4 The Terminator/Talk , 6 3 Zero-sum/Talk , 7 3 Wayne Gretszky , 8 3 W H Auden , 9 3 Wikipedia policy/Layout recommendations talk , 10 3 Tony Blair/Talk , 11 3 To delete or not to delete , 12 3 The Church of Jesus Christ of Latter-day Saints , 13 3 Solar power , 14 3 Science Fiction Awards/Talk , 15 3 Sir Thomas More , 16 3 Socksdelux , 17 3 Skinheads , 18 3 Partial function , 19 3 Lee Daniel Crocker/Talk , 20 3 John A Macdonald , 21 3 Edmund Stoiber , 22 3 Avicenna , 23 2 25 Etudes op.60/Talk , 24 2 Zocchihedron , 25 2 Xena

ago 2001: 1 7 Stephen Jay Gould/Talk , 2 6 US Taxes , 3 6 The future of Wikipedia , 4 5 US Taxes/Talk , 5 5 Trans-Neptunian object , 6 5 THERESA KNOTT , 7 5 Steve Wozniak/Talk , 8 5 String , 9 5 Sir Thomas More , 10 4 Yooden/Talk , 11 4 Wikify/Talk , 12 4 Utgard , 13 4 The Rise of Christianity/Talk , 14 4 Trans-Neptunian objects , 15 4 Tyrannosaurus Rex , 16 4 String/Talk , 17 3 Xerox Parc , 18 3 Xenophobia , 19 3 Wikipedia Projects/Project Gutenberg Encyclopedia , 20 3 Well-order , 21 3 Wikipedia teamwork , 22 3 WYSIWYG , 23 3 Wikipedia/Nupedia2Wikipedia , 24 3 Waffen-SS , 25 3 Viollet le Duc

set 2001: 1 9 World Trade Center/Plane crash , 2 6 Wheel , 3 6 Writing Systems , 4 6 Why Wikipedia is not so great , 5 6 Tattoo , 6 6 Son of God/Talk , 7 6 September 11, 2001 Terrorist Attack/Gasoline Price Gouging , 8 5 Wikipedians/Canadians , 9 5 Wikipedians/Australians , 10 5 Wikipedia commentary/Search Engine , 11 5 U.S. President , 12 5 Singular they/Talk , 13 5 Sinn Fein , 14 5 September 11, 2001 Terrorist Attack/Give Blood , 15 5 Skateboarding , 16 4 Yaohushua/Talk , 17 4 Yaohushua , 18 4 Yaohushuahim , 19 4 Yapura/Talk , 20 4 Wheel/Talk , 21 4 Wikipedia Commentary/U.S. vs. US , 22 4 United States Congress , 23 4 Tree of life/Talk , 24 4 Terrorist/Talk , 25 4 Terrorist

out 2001: 1 10 Wikipedia Anti-Rules , 2 10 The Cunctator/How to destroy Wikipedia , 3 9 Werewolf , 4 9 Wikipedia subpages pros and cons , 5 8 Witchhunts , 6 8 Wikipedia subpages pros and cons/Talk , 7 7 Wikipedia Anti-Rules/Talk , 8 7 White trash/Talk , 9 7 Vitamin C , 10 6 Wilhelm Gustloff/Talk , 11 6 Wikipedia commentary/Wikipedia Anti-Rules Talk , 12 6 Western canon , 13 6 UNICODE , 14 6 The Sophia of Jesus Christ/Talk , 15 6 The Sophia of Jesus Christ , 16 6 Theodore Kaczynski , 17 6 TARDIS , 18 6 TimShell , 19 6 Sealand , 20 6 Silent Ethnic Cleansing/Talk , 21 6 String theory , 22 5 Year 2000 problem , 23 5 Witchhunts/Talk , 24 5 Wikipedia History standards , 25 5 Wolf

nov 2001: 1 17 Wikipedia Announcements/Larrys Wedding Card , 2 16 Wikipedia utilities/Page titles to be deleted , 3 16 Wikipedians/History talk , 4 12 The Wikipedia Militia , 5 11 Gamefoolz/Talk , 6 10 Current events , 7 9 Wikipedia utilities/find or fix a stub , 8 9 Wikipediholic/Confessed wikipediholics , 9 8 Stolen Generation/Talk , 10 8 Religion , 11 8 History of Christianity , 12 8 Gamefoolz , 13 8 Big bang/Talk , 14 7 The most basic encyclopedia article topics/Talk , 15 7 Requested articles , 16 7 Political parties of the world , 17 7 History of Poland , 18 7 Go , 19 7 Christian views of homosexuality , 20 7 Box-cutter knife/Talk , 21 7 Blue Screen of Death , 22 7 British Isles , 23 7 Bad jokes and other deleted nonsense , 24 6 1000000km2 , 25 6 Yngwie J. Malmsteen

dez 2001: 1 20 Wikipedia utilities/Page titles to be deleted , 2 15 God , 3 14 Requested articles , 4 14 Larry Sanger , 5 14 God/Talk , 6 13 Little guru/talk , 7 12 Wikipedia Religion and Mythology standards , 8 12 Feminism , 9 11 Wikipedia utilities/find or fix a stub , 10 11 Wikipedia Announcements , 11 11 Creationism , 12 10 Wikipedians , 13 10 VANDALISM IN PROGRESS/Talk , 14 10 Falsifiability/Talk , 15 10 Christian Mythology/Talk , 16 9 Rush Limbaugh/Feminazi , 17 9 Masculism/Talk , 18 9 Galileo/Talk , 19 9 Ed Poor , 20 9 Countries of the world/Talk , 21 8 Wikipedia utilities/Pages needing attention , 22 8 White supremacy , 23 8 VANDALISM IN PROGRESS , 24 8 The stories of Christianity/Talk , 25 8 The Wikipedia Militia

jan 2005: 1 1 22nd century

Estatísticas geradas em Terça-feira, 22 de setembro 2009 a partir de cópias do banco de dados SQL de Segunda-feira, 31 de agosto 2009
Versão do script:2.5
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
For documentation see meta
Scripts: scripts.zip

All data and images on this page are in the public domain.