Estatísticas da Wikispecial in memoriam

Zoom           
Monthly counts & Quarterly rankings / New: Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist
 
Monthly counts & Quarterly rankings
 
DataAutoresArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
out 2007137   448 11,42069 1,2 Mb160 k1,4 k1,2 k(36)2,1 k1
set 2007137   448 11,42069 1,2 Mb160 k1,4 k1,2 k(36)2,1 k1
ago 2007137   448 11,42069 1,2 Mb160 k1,4 k1,2 k(36)2,1 k1
jul 2007137   448 11,42069 1,2 Mb160 k1,4 k1,2 k(36)2,1 k1
jun 2007137   448 11,42069 1,2 Mb160 k1,4 k1,2 k(36)2,1 k1
mai 2007137   448 11,42069 1,2 Mb160 k1,4 k1,2 k(36)2,1 k1
abr 2007137   448 11,42069 1,2 Mb160 k1,4 k1,2 k(36)2,1 k1
mar 2007137   448 11,42069 1,2 Mb160 k1,4 k1,2 k(36)2,1 k1
fev 2007137   448 11,42069 1,2 Mb160 k1,4 k1,2 k(36)2,1 k1
jan 2007137   448 11,42069 1,2 Mb160 k1,4 k1,2 k(36)2,1 k1
dez 2006137   448 11,42069 1,2 Mb160 k1,4 k1,2 k(36)2,1 k1
nov 2006137   448 11,42069 1,2 Mb160 k1,4 k1,2 k(36)2,1 k1
out 2007137   448 11,42069 1,2 Mb160 k1,4 k1,2 k(36)2,1 k1
jul 2007137   448 11,42069 1,2 Mb160 k1,4 k1,2 k(36)2,1 k1
abr 2007137   448 11,42069 1,2 Mb160 k1,4 k1,2 k(36)2,1 k1
jan 2007137   448 11,42069 1,2 Mb160 k1,4 k1,2 k(36)2,1 k1
out 20061376  448511,420691,9 k1,2 Mb160 k1,4 k1,2 k(36)2,1 k1
jul 20061117  294 9,42512121989 kb125 k1,3 k538(20)2,1 k 
abr 2006897  238-18,82135298718 kb83 k1,1 k404(14)1,7 k 
jan 2006793  278 6,1251140928 kb118 k1,2 k496(15)2,1 k 
out 200569   272 5,6251344911 kb115 k1,2 k491(12)2,1 k 
jul 2005625  254 5,4248072846 kb106 k1,2 k497(11)2,0 k 
abr 2005522  244 4,7247826808 kb101 k1,1 k457(11)2,0 k 
jan 200546   237 4,5252220795 kb100 k1,1 k444(3)2,0 k 
out 2004411  225 4,5222321683 kb83 k938426(2)1,9 k 
jul 2004381  223 4,2216830662 kb80 k936408(2)1,9 k 
abr 2004377  196 3,92071126570 kb69 k831268(2)1,9 k 
jan 200424   17513,22241105543 kb67 k762110(2)1,9 k 
out 200320   117 3,5291110512 kb58 k57793(1)1,9 k 
jul 2003162  96 3,5334632485 kb54 k51782(1)1,9 k 
abr 200312   33 6,538684171 kb21 k33981( )61 
jan 200310   2 16,525033257 kb9,6 k373( )6 
out 2002103  2 13,022385851 kb8,6 k473( )6 
jul 20022   1 8,044061 45 kb8,4 k62 ( )4 
abr 20022   1 8,044061 45 kb8,4 k62 ( )4 
jan 2002    1 6,040848 42 kb7,8 k62 ( )3 
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
 AutoresArtigosBase de dadosLigações

Counts for image links are based on keyword(s) found in the message file for this language: (Image).
Note that image links based on default keyword 'Image' and/or 'File' have been missed. This will be repaired on the next run.

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

Autores (usuários registrados)
A = Autores que editaram pelo menos dez vezes desde que chegaram (sep11: all)
B = Aumento no número de autores que editaram pelo menos dez vezes desde que chegaram
C = Autores que contribuíram cinco vezes ou mais este mês
D = Autores que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


New: Edit activity levels of registered users and bots per group of namespaces

Namespaces: Articles = 0   Talk = 1,3,5,7,9,..   Other = 2,4,6,8,..

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 5  5  5  5  5  5 
out 2007      
set 2007      
ago 2007      
jul 2007      
jun 2007      
mai 2007      
abr 2007      
mar 2007      
fev 2007      
jan 2007      
dez 2006      
nov 2006      
out 2007      
jul 2007      
abr 2007      
jan 2007      
out 2006      
jul 2006      
abr 2006      
jan 2006      
out 2005      
jul 2005      
abr 2005      
jan 2005      
out 2004      
jul 2004      
abr 2004      
jan 2004      
out 2003      
jul 2003      
abr 2003      
jan 2003      
out 2002      
jul 2002      
abr 2002      
jan 2002      

 

Distribuição de edições de artigos por autores
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=AutoresEdições total
1137100.0%3421100.0%
35640.9%328396.0%
102719.7%313691.7%
32139.5%289884.7%
10064.4%252973.9%
31621.5%184954.0%
100010.7%104430.5%

 

20 autores recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesPrimeira ediçãoúltima edição
 posiçãototaldatadias
atrás
datadias
atrás
Timrem11044mai 02, 2006546out 29, 2006366
Fang_Aili2805set 28, 2006397out 27, 2006368
Timichal3279set 28, 2006397out 29, 2006366
MyRedDice4171fev 28, 20031705mar 02, 20031703
Destroy_Litecoveria5123mai 10, 2006538mai 15, 2006533
Maximus_Rex6107dez 06, 20031424jan 25, 20051008
Anthony_DiPierro774abr 21, 20041287mai 21, 20041257
Angela862dez 20, 20031410set 29, 2006396
Rich_Farmbrough957ago 17, 2005804ago 11, 2006445
Timwi1054jun 19, 20031594jun 19, 20031594
Carmelapple1151ago 07, 2006449out 11, 2006384
Suisui1239jul 26, 2006461jul 26, 2006461
Ducks_in_a_pram1332jun 01, 2005881jun 02, 2005880
Kmf1641425mar 30, 2006579abr 09, 2006569
Everyking1523abr 22, 20041286mai 01, 20041277
Lentil_Berkeley1622jul 24, 2006463jul 24, 2006463
Cool_Cat1721out 26, 2006369out 26, 2006369
I_repeat!_Destroy_Litecoveria!1820jul 25, 2006462ago 22, 2006434
Lorenzarius1920set 29, 2006396out 27, 2006368
Jumpseatnews2018set 07, 2005783set 10, 2005780

 

usuários anônimos, ordenados por número de contribuições
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
65.94.86.34102
212.239.147.24591
69.138.229.24625
128.135.108.20220
128.135.226.5518
68.185.2.13418
4.63.108.3316
144.139.125.21315
144.139.127.12614
69.92.179.22512

No total 1.664 edições foram feitas por usuários anônimos, de um total de 5.085 edições ( 32e %)
 


Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110JpgPng
out 2007449 13012  16      100%291
set 2007449 13012  16      100%291
ago 2007449 13012  16      100%291
jul 2007449 13012  16      100%291
jun 2007449 13012  16      100%291
mai 2007449 13012  16      100%291
out 2007449 13012  16      100%291
jul 2007449 13012  16      100%291
abr 2007449 13012  16      100%291
jan 2007449 13012  16      100%291
out 2006449 13012  16      100%291
jul 2006392 12112  1      4%201
abr 2006376 11811  1      4%171
jan 2006337 11611  1      4%151
out 2005330 11311  1      4%121
jul 2005301 11211          111
abr 2005283 11210          111
jan 2005271 1410          31
out 2004255 138          21
jul 2004250 138          21
abr 2004220 13           21
jan 2004198 12           11
out 2003174 11            1
jul 2003143 11            1
abr 200371 11            1
jan 20034                
out 20022                
jul 20021                
abr 20021                
jan 2002   

 

17 most edited articles (> 25 edits)
 

EdiçõesUnique usersArtigosArchived
TotalReg.Reg.Unreg.
38574%2979Tributes to individuals1.8 Mb  
20931%22108In Memoriam1.2 Mb  
15335%2869Personal experiences14.0 Mb  
14086%68New York City Fire Department4.0 Mb  
10382%916Cantor Fitzgerald Securities1.4 Mb  
7837%924Casualties of the September 11, 2001 attacks: plane passengers< 1 Mb  
6999%81World Trade Center victims3.7 Mb  
6632%719Paul Innella< 1 Mb  
5370%1511American Airlines Flight 11< 1 Mb  
5145%824United Airlines Flight 93< 1 Mb  
4986%53Casualties of the September 11, 2001 Attacks: City of New York4.3 Mb  
4860%1117United Airlines Flight 175< 1 Mb  
3661%1011Tributes to companies and organizations< 1 Mb  
3661%913American Airlines Flight 77< 1 Mb  
2928%512Christine Hanson< 1 Mb  
2759%77Daniel Lewin< 1 Mb  
2548%96Donald Adams< 1 Mb  

 

ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

fev 2002: 1 2 Personal experiences

ago 2002: 1 3 Personal experiences

set 2002: 1 3 Personal experiences

out 2002: 1 4 Personal experiences

fev 2003: 1 1 Peter Carroll

mar 2003: 1 1 Thomas McGuinness, Jr.

jun 2003: 1 1 New York Times stories/September 19

jul 2003: 1 1 Anthony Starita

set 2003: 1 1 Joseph Vilardo

nov 2003: 1 1 John Murray

dez 2003: 1 2 Tributes to individuals , 2 1 Rahma Salie

jan 2004: 1 1 James Ferguson

fev 2004: 1 1 John Talignani

mar 2004: 1 2 Deora Bodley , 2 2 Candace Williams , 3 2 David Brandhorst , 4 2 Tributes to individuals , 5 1 Maudlyn White

abr 2004: 1 3 Tributes to individuals , 2 2 Chuck Zion , 3 2 Joseph Zaccoli , 4 2 Ralph Gerhardt , 5 1 Dennis Cross

mai 2004: 1 3 In Memoriam , 2 2 World Trade Center victims , 3 2 Georgine Corrigan , 4 2 Pentagon , 5 2 Karen Martin , 6 2 Robert Curatolo , 7 2 Alfred Marchand , 8 2 Touri Bolourchi , 9 2 Patrick Currivan , 10 2 Neilie Casey , 11 1 Thomas McGuinness, Jr.

jun 2004: 1 1 Edward Hennessey, Jr.

jul 2004: 1 2 Kathleen Shearer

ago 2004: 1 1 Personal experiences

set 2004: 1 2 Tributes to companies and organizations , 2 1 New York State Department of Taxation and Finance

out 2004: 1 2 Paul Innella

nov 2004: 1 1 Casualties of the September 11, 2001 Attacks: City of New York

dez 2004: 1 1 John Crisci

jan 2005: 1 1 Steven Jacoby

fev 2005: 1 1 Karen Kincaid

mar 2005: 1 1 Raymond Murphy

abr 2005: 1 2 Paul Innella , 2 1 Richard Guadagno

mai 2005: 1 1 Garnet Bailey

jun 2005: 1 4 In Memoriam , 2 2 New York Times stories/September 19 , 3 2 Richard Guadagno , 4 2 Robert Evans , 5 2 Rolling Memorial , 6 2 William Caswell , 7 2 Norma Steuerle , 8 2 Hector Tirado , 9 2 Maudlyn White , 10 2 Douglas Stone

jul 2005: 1 2 Paul Innella , 2 2 In Memoriam , 3 1 Alan Beaven

ago 2005: 1 1 Alicia Titus

set 2005: 1 1 Amy Jarret

out 2005: 1 1 Dorothy DeAraujo

nov 2005: 1 2 Casualties of the September 11, 2001 attacks: plane passengers , 2 2 Joseph Coppo , 3 2 Kathleen Shearer , 4 2 New York Times stories/September 26 , 5 1 Michael Simon

dez 2005: 1 1 John Works

jan 2006: 1 1 Thomas McGuinness, Jr.

mar 2006: 1 2 Alan Linton , 2 2 Candace Williams , 3 2 United Airlines Flight 175 , 4 2 Tributes to individuals , 5 1 Sarah Redheffer

abr 2006: 1 2 Marie Pappalardo , 2 2 Personal experiences , 3 1 Shreyas Ranganath

mai 2006: 1 3 Michael Horrocks , 2 3 Phil Rosenzweig , 3 3 Casualties of the September 11, 2001 attacks: Pentagon , 4 3 Fayez Banihamed , 5 3 Lauren Grandcolas , 6 3 American Airlines Flight 11 , 7 3 Tributes to plane victims , 8 3 Tributes to individuals , 9 2 Lisa Egan , 10 2 Mark Zangrilli , 11 2 Yudh Jain , 12 2 Heinz Ackermann , 13 2 John Keohane , 14 2 Aram Iskendarian , 15 2 Shreyas Ranganath , 16 2 Gricelda James , 17 2 Joseph Lovero , 18 2 Eugene Lazar , 19 2 Marie Pappalardo , 20 2 Waleed Iskandar , 21 2 Brian Williams , 22 2 Sarah Redheffer , 23 2 Jeffrey Goldflam , 24 2 Ronald Bucca , 25 2 Vincent Abate

jun 2006: 1 3 Personal experiences , 2 1 Farah Jeudy

jul 2006: 1 3 Joshua Rosenblum , 2 3 Sarah Redheffer , 3 2 Eric Hartono , 4 2 Barbara Arestegui , 5 2 Yin Wong , 6 2 Paul Benedetti

ago 2006: 1 2 Sarah Redheffer , 2 2 Graham Berkeley , 3 1 Howard Kane

set 2006: 1 5 Tributes to individuals , 2 3 Cantor Fitzgerald Securities , 3 3 Personal experiences , 4 2 Kevin Cosgrove , 5 2 Barbara Arestegui , 6 2 Phil Rosenzweig , 7 2 Colleen Fraser , 8 2 Gerald Hardacre , 9 2 Carolyn Beug , 10 2 Christopher Zarba, Jr. , 11 2 Elizabeth Wainio , 12 2 United Airlines Flight 93 , 13 2 United Airlines Flight 175 , 14 2 American Airlines Flight 11 , 15 2 Tributes to companies and organizations , 16 2 Sara Low , 17 1 Adam White

out 2006: 1 5 Marwan al-Shehhi , 2 5 United Airlines Flight 93 , 3 5 American Airlines Flight 77 , 4 5 Tributes to individuals , 5 5 In Memoriam , 6 4 September 11, 2001 , 7 4 David Charlebois , 8 4 Casualties of the September 11, 2001 attacks , 9 4 Norma Steuerle , 10 4 Graham Berkeley , 11 4 Jason Dahl , 12 4 Jean Roger , 13 4 Joseph Keller , 14 4 World Trade Center victims , 15 4 Pentagon , 16 4 Barbara Edwards , 17 4 Gerard Barbara , 18 4 Lisa King-Johnson , 19 4 Leonard Taylor , 20 4 Douglas Stone , 21 4 Donald Adams , 22 4 Betty Ong , 23 4 American Airlines Flight 11 , 24 4 Ruth McCourt , 25 3 World Trade Center

Estatísticas geradas em Terça-feira, 22 de setembro 2009 a partir de cópias do banco de dados SQL de Segunda-feira, 31 de agosto 2009
Versão do script:2.5
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
For documentation see meta
Scripts: scripts.zip

All data and images on this page are in the public domain.