Estatísticas da Wikiversity inglês

Zoom           
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist
 
Monthly counts & Quarterly rankings
 
DataContributorsArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
out 2009+1% -23% +1%   -42%+1%+1%+1%0%0%+3%+2%
set 2009+3% +47% +4%   +40%+3%+4%+5%+16%+1%+4%+2%
ago 2009+2% +51% +2%   +26%+3%+2%+2%+3%+1%+3%+1%
jul 2009+1% -27% +2%   +10%+1%+2%+3%-32%+1%+5%+1%
jun 2009+2% -2% +1%   +3%+2%+2%+1%+17%+2%-10%+1%
mai 2009+2% -47% +1%   -31%+2%+2%+2%0%+7%0%+1%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
out 200912651870412 k316,333913,3 k55 Mb6,7 M28 k87112 k22 k3,4 k
set 200912473591712 k1516,133775,7 k55 Mb6,6 M27 k86812 k21 k3,4 k
ago 200912122362411 k716,333804,1 k53 Mb6,4 M26 k74611 k20 k3,3 k
jul 200911891141511 k816,233673,2 k51 Mb6,2 M25 k72211 k19 k3,3 k
jun 200911782356211 k516,333802,9 k51 Mb6,1 M24 k1,1 k11 k18 k3,3 k
mai 200911551957410 k416,333762,9 k50 Mb6,0 M24 k90511 k20 k3,2 k
abr 2009113665108410 k516,233504,2 k49 Mb5,9 M24 k90310 k20 k3,2 k
mar 200910711860410 k416,033022,6 k48 Mb5,8 M23 k86110 k19 k3,2 k
fev 200910531976810 k815,932973,9 k47 Mb5,7 M23 k85210 k19 k3,2 k
jan 200910342380129,9 k815,932654,3 k46 Mb5,5 M22 k8619,9 k19 k3,1 k
dez 20081011165859,6 k515,932393,6 k44 Mb5,3 M22 k8339,9 k18 k3,0 k
nov 2008995307689,4 k615,831944,8 k43 Mb5,2 M22 k8279,8 k18 k2,9 k
out 200912651870412 k316,333913,3 k55 Mb6,7 M28 k87112 k22 k3,4 k
set 200912473591712 k1516,133775,7 k55 Mb6,6 M27 k86812 k21 k3,4 k
ago 200912122362411 k716,333804,1 k53 Mb6,4 M26 k74611 k20 k3,3 k
jul 200911891141511 k816,233673,2 k51 Mb6,2 M25 k72211 k19 k3,3 k
jun 200911782356211 k516,333802,9 k51 Mb6,1 M24 k1,1 k11 k18 k3,3 k
mai 200911551957410 k416,333762,9 k50 Mb6,0 M24 k90511 k20 k3,2 k
abr 2009113665108410 k516,233504,2 k49 Mb5,9 M24 k90310 k20 k3,2 k
mar 200910711860410 k416,033022,6 k48 Mb5,8 M23 k86110 k19 k3,2 k
fev 200910531976810 k815,932973,9 k47 Mb5,7 M23 k85210 k19 k3,2 k
jan 200910342380129,9 k815,932654,3 k46 Mb5,5 M22 k8619,9 k19 k3,1 k
dez 20081011165859,6 k515,932393,6 k44 Mb5,3 M22 k8339,9 k18 k3,0 k
nov 2008995307689,4 k615,831944,8 k43 Mb5,2 M22 k8279,8 k18 k2,9 k
out 2008965248769,2 k815,631995,1 k42 Mb5,1 M21 k8099,4 k17 k2,9 k
set 20089414211279,0 k915,532095,3 k41 Mb5,0 M21 k7549,3 k17 k2,7 k
ago 2008899156398,7 k1115,432376,1 k40 Mb4,9 M20 k7529,0 k16 k2,5 k
jul 2008884176788,4 k715,332465,1 k39 Mb4,7 M20 k7418,8 k15 k2,4 k
jun 20088671654128,1 k1115,132765,8 k38 Mb4,6 M19 k6988,6 k14 k2,2 k
mai 20088511267117,8 k1214,933436,7 k37 Mb4,5 M19 k6678,5 k14 k2,1 k
abr 2008839133202227,4 k1514,8343313 k36 Mb4,4 M18 k5278,3 k14 k1,9 k
mar 200870635109147,0 k1513,933997,7 k33 Mb4,1 M18 k4537,8 k12 k1,8 k
fev 2008671297736,5 k913,734793,5 k32 Mb3,9 M16 k3777,5 k11 k1,5 k
jan 2008642399286,2 k713,734865,2 k30 Mb3,8 M16 k3777,3 k10 k1,5 k
dez 2007603195466,0 k713,434183,6 k29 Mb3,6 M15 k3667,0 k9,7 k1,2 k
nov 20075842310065,8 k-513,233294,9 k27 Mb3,4 M14 k3446,7 k9,2 k1,2 k
out 200756132112106,0 k1512,131737,1 k26 Mb3,3 M15 k2836,9 k8,8 k1,1 k
set 200752950105115,5 k2411,832476,3 k24 Mb3,1 M14 k2276,6 k8,3 k902
ago 2007479338394,8 k1812,234805,3 k23 Mb2,9 M13 k2026,3 k7,7 k789
jul 2007446216544,2 k1112,635353,3 k20 Mb2,6 M12 k3035,8 k7,3 k733
jun 2007425195563,9 k1112,935883,5 k19 Mb2,5 M9,6 k2925,3 k6,8 k699
mai 2007406256393,6 k1413,137534,5 k18 Mb2,4 M8,8 k2244,8 k6,5 k635
abr 2007381359483,1 k1213,538575,4 k17 Mb2,1 M6,9 k1024,5 k6,1 k551
mar 20073464210872,7 k713,339564,6 k15 Mb1,9 M6,0 k984,0 k5,4 k468
fev 2007304319292,5 k1112,739154,1 k14 Mb1,8 M5,6 k1483,3 k4,7 k448
jan 2007273399072,2 k1912,640385,3 k13 Mb1,6 M4,9 k1482,7 k3,9 k368
dez 2006234398981,6 k713,945634,0 k11 Mb1,4 M4,3 k1442,1 k3,1 k321
nov 2006195237051,4 k813,446383,4 k9,7 Mb1,2 M3,0 k1111,6 k2,4 k260
out 2006172438461,2 k1013,149384,3 k8,5 Mb1,1 M2,5 k639401,9 k201
set 200612936621868612,755992,2 k7,2 Mb922 k1,4 k623541,3 k141
ago 20069325404693812,760532,4 k6,4 Mb806 k1,1 k5626886993
jul 200668 7 430 14,883553585,9 Mb702 k817492185544
jun 20066838 419114,484463665,7 Mb693 k762482145252
mai 20066569 400 14,287065125,6 Mb683 k769481985062
abr 2006598151390 13,285315275,4 Mb655 k757471935661
mar 200651715 379112,287273895,3 Mb641 k734461875461
fev 2006445111359211,891844655,2 Mb639 k726471635271
jan 20063926 313112,0104293095,1 Mb633 k695471124621
dez 200537481293111,8109405195,0 Mb623 k68048964311
nov 200533241266111,1116732664,8 Mb607 k58260743811
out 200531 41223 12,0133193484,7 Mb582 k51147713511
set 20053117 208111,2114651723,7 Mb463 k38833367334 
ago 200530581189111,496993192,7 Mb351 k36420962324 
jul 2005255111151212,22294651529 kb60 k322361273 
jun 20052069 94112,62040412315 kb33 k25538192 
mai 20051422 68 11,41939144221 kb23 k1822286 
abr 20051214 59 10,61920158183 kb20 k1552270 
mar 20051124 50 9,4148780130 kb14 k792148 
fev 2005923 43 9,1132398102 kb10 k442130 
jan 2005722 38 7,713465686 kb9,4 k39  20 
dez 20045   24 9,817963577 kb8,0 k38  6 
nov 20045   22 9,119103666 kb7,9 k34  6 
out 2004511 22 7,518114555 kb7,5 k34  4 
set 2004424 14 8,613758131 kb3,4 k12  2 
ago 20042   5 7,8682216,0 kb6749    
jul 200421  4 4,556984,3 kb5887    
jun 20041   2 5,0105174,0 kb56612   
mai 200411  1 3,0160032,1 kb3171    
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
The following table ranks this project in relation to projects in other languages with 1000+ articles
set 200911111121111121111
ago 200911111121111121111
jul 200911111121111121111
jun 200911121121111111111
mai 200912111121111121111
abr 200911111111111121111
mar 200911121211111121111
fev 200911111111111121111
jan 200911111111111121111
dez 200811121111111111111
nov 200811111111111111111
out 200811111111111111111
set 200811111111111111111
ago 200811111111111111111
jul 200811111111111111111
jun 200811111111111111111
mai 200811111111111111111
abr 200811111111111121111
mar 200811111111111131111
fev 200811121111111131111
jan 200811111111111131111
dez 200711111111111121110
nov 200711111511111121110
out 200711111111111131110
set 200711111111111131110
ago 200711111111211131110
jul 200712221211211121110
jun 200711111111111111110
mai 200711111111111121110
abr 20071111111111114119
mar 20071111121111115119
fev 20071111111111114119
jan 20071111111111114119
dez 20061111111111114119
nov 20061111111111114119
out 20061111111111114118
set 20061111111111112118
ago 20061111111111113118
jul 20061251111111123117
jun 20061151111111123117
mai 20061131111111123117
abr 20061141111111123117
mar 20061132111111123117
fev 20061131111111122117
jan 20062251111111122117
dez 20051131111111122116
nov 20052131111111122116
out 20052441111111122116
set 20051241111111121116
ago 20051141111111121116
jul 20052141111112225116
jun 20052141111112224316
mai 20052141111112224326
abr 20052241111112224326
mar 20052331211122223336
fev 20052251211123333335
jan 20052141211123333335
dez 20042261311133333335
nov 20042461221133323335
out 20042141211122222224
set 20042131211112222224
ago 20042251211122222224
jul 20042151211122232224
jun 20042241211122232223
mai 20042141211123332223
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100ediçõesbytes
 ContributorsArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

Contributors (usuários registrados)
A = Contributors que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de contributors que editaram pelo menos dez vezes desde que chegaram
C = Contributors que contribuíram cinco vezes ou mais este mês
D = Contributors que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Namespaces: Articles = 0   Talk = 1,3,5,7,9,..   Other = 2,4,6,8,..

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 5  10  25  100  250  1000  5  10  100  5  10  25  100  250  1000  2500  5  10  100  5  10  25  100  250  1000  5  10  100 
out 200970431942    39197    221131602871 33 
set 200991522472 2222517931  221100623693 442
ago 200962432241 2213121132   11182442272 331
jul 200941251651 3322817112      78351791 321
jun 20095639172  11127142       8144212  221
mai 200957391641 11 2097       74452061 431
abr 200910878444  21 18112       7141176  44 
mar 200960321442 21 201161      83441463132 
fev 200976482482 11 33158    11 89491943133 
jan 2009805324122 21 3823134      11060247  331
dez 200858372553    27198       15511452113133 
nov 200876502683    36231332     251202128153 32 
out 200970431942    39197    221131602871 33 
set 200991522472 2222517931  221100623693 442
ago 200962432241 2213121132   11182442272 331
jul 200941251651 3322817112      78351791 321
jun 20095639172  11127142       8144212  221
mai 200957391641 11 2097       74452061 431
abr 200910878444  21 18112       7141176  44 
mar 200960321442 21 201161      83441463132 
fev 200976482482 11 33158    11 89491943133 
jan 2009805324122 21 3823134      11060247  331
dez 200858372553    27198       15511452113133 
nov 200876502683    36231332     251202128153 32 
out 200887522162132152271981  111253202131266 321
set 2008112783872 11 573121102     220185118307 43 
ago 200863382896122 37271871     93593195 32 
jul 2008673718841   3522154   11 51291574 33 
jun 2008544225124 1  2822105   111593721981321
mai 2008673828115122 28161251  111673322962441
abr 2008202168112226 22129181352  311895726125 441
mar 20081097937148 11 39231341  21 845228105 331
fev 200877601931    281692      7941254  221
jan 200892663382 21 3022154   11 83532475 431
dez 200754361863 11 3019112      60422481 221
nov 2007100602161121 271783      6342214  331
out 20071128133102222 29171131  1  64432583 331
set 20071057332113111 27191131  1  58392473 221
ago 200783613093 11 331871      76462164 22 
jul 200765381642    301592      63281551 11 
jun 200755341563    2920721  1  68402152 11 
mai 200763482693 11 3920931  11 89481885 32 
abr 200794674382 11 4325145   1  72462072 32 
mar 2007108662972    372210411 11 101552542 21 
fev 200792522791    483314411 11 89512564 11 
jan 2007906228721   402710431111 82502752111 
dez 200689623081    44271531111  91633353 11 
nov 200670462152    362518       644321101    
out 200684552662    3423144      94502491 1  
set 200662401511    442912211    94512141    
ago 200640302341    48291872     1026026126111 
jul 2006732      51        1371      
jun 2006875      3         1494      
mai 2006964      1         1461      
abr 200615821               1392      
mar 20061573      11        188       
fev 200611731     31        1153      
jan 2006642      21        63       
dez 20058421     872       1241      
nov 20054421     51        964      
out 20054221     21        421      
set 2005742                2        
ago 20058711     42        63       
jul 200511851               841      
jun 2005961      1         721      
mai 200522                 511      
abr 2005421                1262      
mar 200542       21        542      
fev 200533       3         7431     
jan 2005221      11        411      
dez 2004                   1        
nov 2004                   2        
out 200411                 31       
set 200441       1         411      
ago 2004                   322      
jul 2004                   3211     
jun 2004                   111      
mai 2004                   1        

 

Distribuição de edições de artigos por contributors
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=ContributorsEdições total
15415100.0%155177100.0%
3215739.8%15021596.8%
10127623.6%14511293.5%
3260411.2%13323385.9%
1002144.0%11201172.2%
316631.2%8627355.6%
1000180.3%6351440.9%
316270.1%4486428.9%
1000020.0%2358515.2%

 

50 contributors recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesPrimeira edição
ArtigosOutros
 posiçãoúltimos
30 dias
totaltotalúltimos
30 dias
datadias
atrás
agoraΔ
SB_Johnny1 0512226404831ago 17, 20061170
Jtneill2 0542113597857315mar 06, 2008603
Jomegat7 09339099 mar 21, 2007954
Fasten11 0311898117320fev 14, 2007989
Recovery_Psychology12 01918783166jan 06, 2008663
Mu30114 0131535457565dez 01, 20061064
Ktucker16 061136406521jul 06, 2007847
Graeme_E._Smith21+13807424069jan 07, 2009296
Gbaor23+113767255336dez 15, 2007685
Snoozebob29+29347689139ago 07, 200984
AFriedman30-112679168644out 13, 2008382
Leighblackall34 0451119417set 27, 20051494
Trinity50744+75141795883dez 14, 2008320
Enlil_Ninlil62+16318173 dez 20, 20061045
Mats63+213318361fev 24, 2008614
Eadthem78 022696681set 27, 2007764
Gmasterman92+37223  jun 04, 2009148
Crochet.david107+112012511105jun 19, 2008498
Adambro113+2846194609190jul 14, 2008473
Mikk133-111611 ago 26, 200965
Lysander89136+593135159132101ago 22, 200969
Mange01139-2115579 nov 08, 2008356
GorkoTheDuck149+19691381423 set 18, 200942
Relledge156...13713744out 02, 200928
Sigma_7170+119128503jan 21, 2009282
Jmaustin204-21108  set 08, 200952
Sfan00_IMG210-31103721nov 05, 2008359
Jewers211+23859102  set 16, 200944
ConIoan240+652088  set 17, 200943
KVDP252-418432 ago 20, 2008436
Proxima_Centauri256+2110824818mar 08, 2009236
Rsaid0312981263+1078718011set 25, 200935
Satun291+1337111 ago 17, 200974
Mlarthur299+30839702926ago 06, 200985
Genezistan312+15627684228set 11, 200949
Millosh330+31965352dez 10, 2007690
Kgaipo_5790332+4364365  set 21, 200939
Alexlister337+7945264  set 23, 200937
Sajo347-12611042out 23, 20061103
Bdylan823374+323305653set 18, 200942
Dean.jenkins384+2145462set 17, 200943
Mickraus387-51535 jan 29, 20071005
Abrothers_0603393+6814053169set 23, 200937
Sarahtrueblood419+286492 set 09, 200951
Ukuli420+2864922set 16, 200944
Hinashafique421+7310495 set 25, 200935
Swift435+2712247567jun 29, 2008488
SarahStewart438+13114471615jul 10, 2009112
Baby_Blue446-111462412set 20, 200940
Mattyb2024470+4382542  set 25, 200935

 

20 contributors recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesPrimeira ediçãoúltima edição
 posiçãototaldatadias
atrás
datadias
atrás
Robert_Elliott34732set 23, 20061133jun 18, 2008499
Mike's_bot_account44507set 26, 2007765nov 19, 2008345
Remi54344mai 06, 2007908out 17, 2008378
JWSchmidt64306ago 17, 20051535set 16, 200944
Erkan_Yilmaz82873nov 27, 20061068ago 05, 200986
McCormack92268abr 08, 2007936set 18, 2008407
Emesee102024mar 31, 2008578jan 10, 2009293
Remi0o131648dez 11, 20061054jun 21, 2008496
Open_Research151278jun 14, 2007869mai 12, 2009171
Mirwin171075ago 18, 20061169jan 12, 2008657
Michaelnelson181037jun 29, 20051584nov 19, 2007711
CQ19961out 10, 20061116set 17, 200943
Thuvack20890abr 02, 2008576set 22, 200938
Jade_Knight22806out 08, 20061118set 28, 200932
Banerjee24763jul 19, 2007834jun 16, 2009136
Juan_de_Vojníkov25752dez 06, 20061059set 24, 200936
Hillgentleman26726out 22, 20061104jun 17, 2009135
TWFred27726jul 19, 2007834jul 16, 2008471
HenkvD28690jan 26, 2009277set 03, 200957
Rayc31640ago 17, 20061170out 21, 2007740

 

usuários anônimos, ordenados por número de contribuições
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
128.130.60.129391
155.232.128.10358
24.185.10.97339
205.152.15.232278
155.98.7.85242
80.95.102.226205
75.36.138.190189
75.36.88.32186
192.133.12.108179
147.122.11.127143

No total 29.605 edições foram feitas por usuários anônimos, de um total de 189.541 edições ( 15e %)
  


9 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesPrimeira ediçãoúltima edição
 posiçãototaldatadias
atrás
datadias
atrás
Crochet.david.bot13126ago 10, 2007812set 15, 200945
Mu301Bot2719ago 31, 200960set 25, 200935
CommonsDelinker3284abr 30, 2007914set 23, 200937
AdambroBot4257jul 03, 2009119jul 06, 2009116
タチコマ_robot5112mar 16, 2008593mar 16, 2008593
ArchiveBot652out 08, 2008387set 23, 200937
RussBot740abr 22, 2009191abr 22, 2009191
ArthurBot832jan 01, 2009302abr 07, 2009206
MichaelFreyTool91jan 27, 2008642jan 27, 2008642

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110DjvuGifJpgMidOggOgvPdfPngSvgSxwXcf
out 200917 k8,9 k1,1 k7,7 k993,1 k1815,0 k5452,8 k2,5 k   82%23564,0 k1942615062,3 k13712
set 200917 k8,6 k1,1 k7,6 k993,1 k1765,0 k5442,8 k2,4 k   81%23533,9 k1942614832,2 k13012
ago 200917 k8,2 k1,1 k7,4 k993,1 k1754,9 k5362,7 k2,4 k   79%23513,9 k1942614672,1 k12512
jul 200916 k8,0 k1,1 k7,4 k983,0 k1744,9 k5282,7 k2,4 k   79%23493,9 k19426 4622,1 k12512
jun 200916 k7,8 k1,0 k7,4 k953,0 k1744,8 k5262,7 k2,4 k   78%23493,9 k18426 4492,1 k12512
mai 200916 k7,6 k1,0 k7,3 k943,0 k1744,8 k5222,7 k2,4 k   78%23493,9 k18426 4412,1 k12512
out 200917 k8,9 k1,1 k7,7 k993,1 k1815,0 k5452,8 k2,5 k   82%23564,0 k1942615062,3 k13712
set 200917 k8,6 k1,1 k7,6 k993,1 k1765,0 k5442,8 k2,4 k   81%23533,9 k1942614832,2 k13012
ago 200917 k8,2 k1,1 k7,4 k993,1 k1754,9 k5362,7 k2,4 k   79%23513,9 k1942614672,1 k12512
jul 200916 k8,0 k1,1 k7,4 k983,0 k1744,9 k5282,7 k2,4 k   79%23493,9 k19426 4622,1 k12512
jun 200916 k7,8 k1,0 k7,4 k953,0 k1744,8 k5262,7 k2,4 k   78%23493,9 k18426 4492,1 k12512
mai 200916 k7,6 k1,0 k7,3 k943,0 k1744,8 k5222,7 k2,4 k   78%23493,9 k18426 4412,1 k12512
abr 200916 k7,4 k1,0 k7,3 k933,0 k1644,8 k5082,7 k2,3 k   79%23443,8 k18426 4292,1 k12512
mar 200916 k7,1 k1,0 k7,2 k913,0 k1644,7 k5062,7 k2,3 k   79%23303,8 k18425 4092,1 k12212
fev 200915 k6,9 k1,0 k7,1 k913,0 k1614,7 k5062,1 k2,3 k   79%23293,8 k18416 3972,1 k11712
jan 200915 k6,8 k1,0 k7,1 k912,9 k1594,6 k5051,3 k2,3 k   78%23283,7 k18416 3822,1 k11512
dez 200815 k6,5 k9927,0 k872,9 k1584,5 k5041,2 k2,3 k   78%23283,7 k18415 3622,0 k11411
nov 200814 k6,2 k9786,7 k872,8 k1574,5 k4869212,2 k   78%23063,5 k18415 3402,0 k10611
out 200814 k5,7 k9715,8 k792,8 k1534,5 k4849122,2 k   78%22632,9 k18413 3211,8 k8011
set 200814 k5,1 k9455,0 k752,7 k1524,4 k4629062,1 k   79%22402,3 k18409 2821,8 k5511
ago 200813 k4,4 k8814,4 k732,7 k1464,3 k4138982,0 k   80%22111,7 k18404 2331,7 k5411
jul 200813 k4,2 k8384,3 k702,5 k1444,2 k4088872,0 k   81%22081,7 k18391 2311,7 k5311
jun 200812 k4,0 k8204,3 k692,5 k1384,1 k4058792,0 k   81%22081,7 k18390 2311,7 k5311
mai 200812 k3,8 k7984,3 k682,4 k983,7 k3988741,9 k   83%22071,7 k18388 2211,7 k5311
abr 200811 k3,6 k7824,2 k672,2 k852,7 k3828351,8 k   86%22071,7 k18375 2191,7 k5011
mar 200810 k3,5 k7513,8 k652,1 k542,5 k3647891,7 k   88%22011,4 k18371 1941,6 k5011
fev 20089,4 k3,3 k7223,6 k641,9 k522,3 k3437571,6 k   88%21961,3 k18343 1821,6 k261 
jan 20088,9 k3,1 k7133,5 k641,9 k512,2 k3396881,5 k   89%21771,2 k18331 1681,6 k261 
dez 20078,4 k2,9 k6933,4 k621,8 k512,0 k3206421,5 k   90%21711,1 k18319 1661,5 k261 
nov 20078,0 k2,8 k6853,2 k511,7 k491,9 k3206331,4 k   91%21691,1 k18289 1541,5 k261 
out 20077,7 k2,7 k6793,1 k511,6 k491,9 k3186121,4 k   92%21571,0 k18271 1411,4 k231 
set 20076,9 k2,6 k6742,9 k511,5 k481,6 k2905051,3 k   92%215496718261 1211,3 k201 
ago 20076,0 k2,4 k6612,7 k471,5 k481,5 k2875051,2 k   91%215295118196 1041,3 k181 
jul 20075,3 k2,2 k6162,2 k461,4 k461,4 k2825031,1 k   90%214484118153 79978181 
jun 20074,8 k2,1 k6112,0 k451,4 k421,3 k2664831,1 k   91%213780518119 64851181 
mai 20074,4 k1,9 k6011,9 k441,2 k401,3 k260480982   92%2957801685 5781091 
abr 20073,9 k1,7 k5061,7 k371,0 k38981256463926   84%289757 66 4973091 
mar 20073,5 k1,5 k4951,5 k3794234840249459808   84%273655 61 4162481 
fev 20073,2 k1,3 k4861,2 k3588632817238458719   86%269543 59 2649881 
jan 20072,7 k1,1 k4638583155430721231431642   91%257441 24 2130281 
dez 20062,3 k925396610314552650318951532   70% 37394 9 1714461 
nov 20061,9 k775365448303652346617751462   72% 26289 5 1410661 
out 20061,5 k632332243303001838817248384   65% 22125 5 67941 
set 20061,1 k44729296302441631714843270   74% 1319 3 2553  
ago 200685725024432301761521413140175   69% 57   2161  
jul 200657914741521321522558   31%  2   1    
jun 200656514641501320502454   25%  2   1    
mai 200654612831461320441952   22%  2        
abr 200653012831421320421952   22%  2        
mar 200650512731411319411950   22%  2        
fev 200645212411371319341749   24%           
jan 200639412011361318311749   27%           
dez 200535912011351318301748   29%           
nov 200531011711351318271631   30%           
out 20052971111132618241629   2%           
set 20052771101129617221628   1%           
ago 20052521101127617211628   1%           
jul 2005208191124615211628   1%           
jun 2005144191122615181626   1%           
mai 2005115191120614171625   1%           
abr 200589191119613161623   2%           
mar 200573191117613141221   2%           
fev 200562191116613141016   0%           
jan 200554171146 13912               
dez 200446171146 11912               
nov 200443171146 1099               
out 200438171146 1099               
set 200425171146 886               
ago 2004817 146 774               
jul 2004415 136 461               
jun 2004215 115 34                
mai 2004114 114  2                

 

50 most edited articles (> 25 edits)  More..
 

EdiçõesUnique usersArtigosArchived
TotalReg.Reg.Unreg.
726396%402184Wikiversity:Colloquium592.0 Mb  
148964%211275Wikiversity:Sandbox4.0 Mb  
144096%10129Wikiversity:Requests for Deletion67.4 Mb  
141173%212170Wiki farm27.4 Mb  
129090%18268User talk:JWSchmidt122.4 Mb  
114673%208151Wikiversity:Motto contest16.8 Mb  
108681%126148Wikiversity:Help desk37.4 Mb  
81659%340282Wikiversity:Introduction2.1 Mb  
77011%33397Teaching Assistant in France Survival Guide/Directory18.2 Mb  
74889%42529User:Stevenarntson/Student Hub2.8 Mb  
72877%116116Wikiversity talk:Main Page19.0 Mb  
72095%15416User talk:Cormaggio20.0 Mb  
71697%8517User talk:Erkan Yilmaz19.5 Mb  
67997%7413Wikiversity:Request custodian action/Archive/522.7 Mb  
65497%9114User talk:SB Johnny/Archive25.9 Mb  
60895%2820English Language Reference Desk18.8 Mb  
59698%776Wikiversity:Candidates for Custodianship5.6 Mb  
519100%1 User:B9 hummingbird hovering/Blog/Learning Tibetan Weblog27.5 Mb  
496100%2 User:Thuvack/Testing page5.2 Mb  
48759%102132Wikiversity:Wikiversity3.6 Mb  
478100%91User:Jtneill3.0 Mb  
47796%63Recovery psychology8.1 Mb  
46879%35User:Menelaos Pappas14.8 Mb  
46680%2913Technical writing4.2 Mb  
45498%756User talk:Jtneill7.9 Mb  
452100%15 Bloom Clock/2007 part two16.2 Mb  
452100%11User:AFriedman1.1 Mb  
43288%709Introduction to Computers/Peripherals10.1 Mb  
41398%536User talk:McCormack18.6 Mb  
41396%627Introduction to Computers/Personal9.0 Mb  
41089%7020Introduction to Computers/Processor8.0 Mb  
4010%13User:Egm6322.s09.three.liu3.5 Mb  
39088%3840Wikiversity:FAQ/Categorization7.0 Mb  
38992%86DFE2008 Automobile engines9.9 Mb  
38613%77Data Analysis using the SAS Language8.4 Mb  
38598%83Recovery psychology/Lesson311.0 Mb  
3821%21User:Egm6322.s09.Three.nav7.6 Mb  
37925%715Spanish 110.2 Mb  
37182%12352Topic:Foreign Language Learning5.6 Mb  
37099%103DFE2008 Institutional Cogeneration11.2 Mb  
36787%499Introduction to Computers/Introduction3.8 Mb  
366100%131Bloom Clock/Master List9.0 Mb  
36296%274Talk:Wikimedia Ethics32.6 Mb  
36082%10641School:Computer science4.2 Mb  
35899%51Social psychology (psychology)/Assessment/Essay/Topics10.1 Mb  
35797%124DFE2008 Office Chair Foam11.9 Mb  
35480%16758French stream5.3 Mb  
354100%42 Wikiversity:Vision/200913.5 Mb  
35180%2816User:Eml4500.f08/HW report table5.6 Mb  
34992%94DFE2009 Power Generation for Ontario11.1 Mb  

 

ZeitGeist

For each month articles with most contributors in that month are shown.
Sometimes an article has been renamed repeatedly. For this reason the English Wikipedia article 'October 2003' features as article with most editors for many months.

x y z    ⇐    x = rank, y = contributors in that month, z = article title

mai 2004: 1 2 Wikiversity-Translation practice course

jun 2004: 1 1 Teaching Assistant in France Survival Guide/Directory

jul 2004: 1 1 Teaching Assistant in France Survival Guide/Directory

ago 2004: 1 2 Wikiversity-Translation practice course , 2 1 General assistance with mathematics

set 2004: 1 2 Operating system , 2 2 Wikiversity-Translation practice course

out 2004: 1 1 General assistance with mathematics

nov 2004: 1 3 Wikiversity-Translation practice course , 2 2 General assistance with mathematics

dez 2004: 1 3 Wikiversity-Translation practice course , 2 2 Embedded System Engineering , 3 1 Workplace communication

jan 2005: 1 2 Wikiversity-Translation practice course , 2 2 Mathematics software , 3 1 Workplace Communication/Course Evaluation

fev 2005: 1 3 Wikiversity-Translation practice course , 2 3 Literary studies reading lists , 3 1 Becoming a teacher

mar 2005: 1 3 Wikiversity-Translation practice course , 2 2 Wiki farm

abr 2005: 1 2 Artificial intelligence/prospects , 2 2 Wikiversity-Translation practice course , 3 2 Primary mathematics/Factors and primes , 4 2 Basic economics , 5 2 Motion - Dynamics , 6 2 Rhetoric and Composition I , 7 1 Wiki farm

mai 2005: 1 4 Wikiversity-Translation practice course , 2 2 Basic economics , 3 2 Mathematics software , 4 1 Computer science projects

jun 2005: 1 3 Operating system , 2 3 Philosophy message board/Archive , 3 3 The Great War and Versailles , 4 2 Wiki farm , 5 2 The Advancement of Tertiary Teaching and Learning/E-Learning , 6 2 The Advancement of Tertiary Teaching and Learning , 7 2 Wikiversity-Translation practice course

jul 2005: 1 6 The Great War and Versailles , 2 3 Web Design/Useful Applications , 3 3 Build a basic web page , 4 2 Fire and emergency management/Rescuing victims of a building collapse , 5 2 Philosophy message board/Archive , 6 2 The Great War and Versailles/Further Reading , 7 2 Philosophy resources , 8 2 Initial questions in philosophy , 9 2 Basic economics , 10 2 Web Design/Using the Internet as a Learning Tool , 11 2 Build a small website , 12 2 Web Design/Basic HTML and CSS Tutorial , 13 1 Wiki farm

ago 2005: 1 5 Broken/About , 2 3 Wiki farm , 3 3 Study Group For Relativity , 4 2 Introduction to C programming/EnrollmentPage , 5 2 The Great War and Versailles/Lecture One

set 2005: 1 3 CSS challenges , 2 2 Web design , 3 1 Wiki farm

out 2005: 1 3 Wiki farm , 2 2 Introduction to Programming C/Lectures/Variables , 3 2 Introduction to C programming/Lectures/BooleanLogic , 4 2 Introduction to C programming

nov 2005: 1 4 Wiki farm , 2 3 Cell biology , 3 2 Introduction to C programming/Quizes/Variables , 4 2 Transwiki:Wikiversity-School of Computer Science/IntroProgramingCPP , 5 2 Operating system , 6 2 Study Group For Relativity , 7 2 Philosophy message board/Archive , 8 2 Embedded System Engineering , 9 2 Basic economics , 10 2 Christianity/Gospel 101 , 11 2 Fundamentals of Probability, Statistics, Experiments and Data

dez 2005: 1 6 Wiki farm , 2 5 Web design , 3 3 Fire and emergency management/Fire officer IV , 4 2 Jet engine performance , 5 2 Fire and emergency management/Fire officer IV/Inspections and Investigations , 6 2 Fire and emergency management/Fire officer IV/Human Resource Management

jan 2006: 1 9 Wiki farm , 2 2 Fire and emergency management/Personal Protective Equipment-Labeling and Information , 3 2 Fire and emergency management/Fire service instructor I/Instructional Development , 4 2 Wikiversity-Translation practice course , 5 2 Media literacy/notes , 6 2 Fire and emergency management/About Open Source Learning Project , 7 2 CSS challenges , 8 2 List of extinct languages

fev 2006: 1 7 Wiki farm , 2 4 Wikiversity-Translation practice course , 3 3 Jet engine performance , 4 3 Transwiki:Wikiversity-School of Fire and Emergency Management/Technical Rescue , 5 3 Fire and emergency management/Hazardous Materials , 6 3 Fire and emergency management/ARFF Driver Operator , 7 3 Fire and emergency management/Current Research Projects , 8 3 Fire and Emergency Management/Technical Rescue , 9 3 Fire and emergency management/Fire officer , 10 3 Fire and emergency management/Fire instructor , 11 3 Fire and emergency management/Fire Inspector , 12 2 Transwiki:Wikiversity-School of Fire and Emergency Management/Unattended Cooking and Teenagers Project Initiative , 13 2 Transwiki:Wikiversity-School of Fire and Emergency Management/Teenager Fire Safety Project Initiative , 14 2 Fire and emergency management/Pumping Apparatus Driver Operator , 15 2 Fire and emergency management/Promotional process , 16 2 Fire and emergency management/Lieutenant Recruitment Process , 17 2 Fire and emergency management/Leadership III: Strategies for Supervisory Success (H805)/Course Instructions , 18 2 Fire and emergency management/Leadership I:Strategies for Company Success (H803)/Running a Meeting , 19 2 Fire and emergency management/Leadership I:Strategies for Company Success (H803)/Decision-Making Styles , 20 2 Fire and emergency management/Health and Safety Policy , 21 2 Fire and emergency management/Hazardous Materials Operations Level/Additional Training Materials , 22 2 Fire and emergency management/Hazardous Materials Operations Level

mar 2006: 1 7 Wiki farm , 2 5 Introduction to political science , 3 5 Very Small Information Systems (Spring 2006) , 4 4 Wikiversity-Translation practice course , 5 4 Political theory , 6 2 Bible, English, King James, Documentary Hypothesis, Deuteronomist source, Secondary Deuteronomist Additions, Blessing of Moses , 7 2 Fire and emergency management/Wildland fire fighter I , 8 2 Transwiki:Wikiversity-School of Fire and Emergency Management/Water Rescue Awareness , 9 2 Fire and emergency management/Public Safety Telecommunicator II , 10 2 Fire and emergency management/Public safety telecommunicator I , 11 2 Fire and emergency management/Public Safety Telecommunicator , 12 2 Fire and emergency management/Fire and Life Safety Educator III , 13 2 Fire and emergency management/Fire service instructor I , 14 2 Fire and emergency management/Fire Inspector II , 15 2 Fire and emergency management/Fire inspector I , 16 2 Fire and emergency management/Fire fighter II

abr 2006: 1 5 Wikiversity-Translation practice course , 2 4 Wiki farm , 3 3 IB History Review Guide , 4 2 IB History Review Guide/Totalitarian Europe , 5 2 IB History Review Guide/The USSR and Stalin , 6 2 Bluetooth enabling JOP , 7 2 Web design group learning activities , 8 2 Philosophy of Mathematics/Structure

mai 2006: 1 6 Teaching Assistant in France Survival Guide/Directory , 2 5 Introduction to C programming/EnrollmentPage , 3 4 Hexpixel Code , 4 4 Introduction to Philosophy , 5 3 Wiki farm , 6 3 Romance of the Three Kingdoms , 7 2 Transwiki:Wikiversity-Data Structures , 8 2 The Atom , 9 2 Measurement , 10 2 Astronomy outline , 11 2 Cell biology

jun 2006: 1 6 Wiki farm , 2 3 Wikiversity-Translation practice course , 3 3 Fire and emergency management/Fire Investigator/Psychomotor Applications , 4 2 Hexpixel Code , 5 2 Thought-Experimental Principles of Relativity , 6 2 Introduction to political science , 7 2 Wiki 101

jul 2006: 1 3 Introduction to C programming/EnrollmentPage , 2 3 Teaching Assistant in France Survival Guide/Directory , 3 3 Computer Architecture Lab/Summer2006 , 4 2 Wiki farm , 5 2 IB History Review Guide/The USSR and Stalin , 6 2 Speech fundamentals , 7 2 Cob Construction , 8 2 Introduction to political science , 9 2 Computer Architecture Lab , 10 2 Basic computer forensics and security , 11 2 Web Design/Dynamic websites , 12 2 CSS challenges , 13 2 Build a basic web page

ago 2006: 1 11 Hello, world! , 2 10 Wiki farm , 3 7 College Algebra , 4 7 Physics Bachelor of Science , 5 6 Wikiversity the Movie , 6 6 Introduction to physics , 7 5 Hitler's Germany , 8 5 Network cabling , 9 5 Introduction to German , 10 4 Astronomy Project , 11 4 Basic thermodynamics , 12 4 English as a second language , 13 4 Engineering Help Desk , 14 4 Saxophone , 15 4 Abnormal psychology , 16 4 Psychology , 17 4 SLS Reading List , 18 4 Financial Accounting , 19 4 Freelance academics , 20 4 Getting a degree , 21 3 Teaching Assistant in France Survival Guide/Directory , 22 3 Measurement , 23 3 Web Design/Accessibility , 24 3 XML challenges , 25 3 Web Design/New Structure

set 2006: 1 11 Media literacy , 2 9 Hitler's Germany , 3 7 Wiki farm , 4 7 Chain mail , 5 7 Hello, world! , 6 6 Computer science program , 7 6 Arabic stream , 8 5 Wikiversity the Movie/Interviews , 9 5 Introduction to Computer Science , 10 5 Plagiarism , 11 5 Calculus/Limits , 12 5 Wikiversity the Movie , 13 5 Great Debates in Media Literacy , 14 5 Ohm's law , 15 4 IRColloquium , 16 4 Types and variables , 17 4 Hedonic modelling , 18 4 Chain mail/Getting Rings , 19 4 Political science , 20 4 Cell biology , 21 4 Introduction to Real Analysis , 22 3 Initial Questions , 23 3 Organic Chemistry/Stereochemistry , 24 3 Music theory , 25 3 What is \"programming\"

out 2006: 1 11 Computer Architecture Lab/WS2006 , 2 9 Hello, world! , 3 8 French stream , 4 7 Media literacy , 5 6 Introduction to PHP , 6 6 Great Debates in Media Literacy , 7 5 Wiki farm , 8 5 Philosophy message board , 9 4 Computer Architecture Lab/Winter2006/PoettschacherRosenblattlWolf/iMISC , 10 4 Computer Architecture Lab/Winter2006/JeitMossFrühRamb/ThreeMicroDiscussion , 11 4 Free online peer reviewed journals , 12 4 Basic Java Language , 13 4 Fundamentals of Music , 14 4 Hitler's Germany , 15 3 Computer Architecture Lab/Winter2006/PoettschacherRosenblattlWolf/ThreeMicroDiscussion , 16 3 Computer Architecture Lab/Winter2006/LechnerWalterStadlerTrinkl/Workplace , 17 3 Computer Architecture Lab/Winter2006/LechnerWalterStadlerTrinkl/ThreeMicroDiscussion , 18 3 Computer Architecture Lab/FPGA Hello World Example , 19 3 Computer Architecture Lab , 20 3 Quenya lesson 0 , 21 3 Quenya , 22 3 Introduction to Strategic Studies/Nuclear Strategy , 23 3 Policy by other means , 24 3 Seminar in Information Warfare , 25 3 Initial questions in philosophy

nov 2006: 1 10 French stream , 2 7 Spanish/Students , 3 6 Football (soccer) , 4 6 Facilitating Online , 5 5 Control Structures and Logical Expressions in VB6 , 6 4 Wiki farm , 7 4 UFO research , 8 4 Introduction to Calculus/Quiz 1 , 9 4 Introduction to game design and production processes , 10 4 Spanish , 11 4 Networked learning , 12 4 Introductory Ancient Greek Language/Lesson 1 , 13 4 Introduction to Java , 14 4 Japanese stream , 15 4 Political science , 16 4 Wikiversity translations , 17 4 Wiki , 18 4 Hello, world! , 19 4 Other Free Learning Resources , 20 3 The Special Cubic Formula , 21 3 School of Mathematics Help Desk , 22 3 Japanese numbers , 23 3 Japanese Roman Character Pronunciation Guide , 24 3 Free content , 25 3 Half-life

dez 2006: 1 13 Spanish/Students , 2 12 Learning to learn a wiki way , 3 10 French stream , 4 8 Wiki farm , 5 6 One Laptop Per Teacher , 6 5 Convolution , 7 5 Historical Introduction to Philosophy/Arguments for God , 8 5 Historical Introduction to Philosophy/Faith and Reason , 9 5 UFO research , 10 5 Screensaver Project , 11 5 Russian Revolution , 12 4 Learning the basics of French , 13 4 Collaborate and Create In-service , 14 4 C++ , 15 4 Historical Introduction to Philosophy/General Introduction , 16 4 Computer Communications , 17 4 PreClinical Medicine , 18 3 School of Information Technology Registration Center/IT-160 (Fundamentals of Programing) , 19 3 Wikimedia , 20 3 Historical Introduction to Philosophy/Formalism and Deontological Ethics , 21 3 Evolution of the Cytoskeleton , 22 3 Genetics of cancer , 23 3 Introductory Discrete Mathematics for Computer Science , 24 3 Game Maker , 25 3 Nerd project

jan 2007: 1 17 Spanish/Students , 2 12 French stream , 3 10 C++ , 4 9 Hitler's Germany , 5 7 School of Information Technology Registration Center/IT-101 (IT vs CS) , 6 6 Wiki farm , 7 6 Introduction to Arabic/Roster , 8 6 Learning the Basics of French/Lesson:Introducing Yourself/1 , 9 4 Project proposal:global warming/Brainstorming , 10 4 Skype , 11 4 Web Page/Dreamweaver/links , 12 4 Web Page/Flash/Project 1 , 13 4 Variables and Expressions , 14 4 Everyday Japanese phrases , 15 4 WINAPI Programming , 16 4 Toward a theory of corporate governance in China's socialist market economy , 17 4 Boolean algebra , 18 4 Introductory Ancient Greek Language/Review , 19 4 Flow control in C , 20 4 C/Before you start , 21 4 Sunken relief , 22 4 Historical Introduction to Philosophy/Ethics , 23 4 Historical Introduction to Philosophy/Personal Identity , 24 4 Historical Introduction to Philosophy/The Problem of Evil , 25 4 Historical Introduction to Philosophy/General Introduction

fev 2007: 1 29 Spanish/Registration , 2 9 Spanish/Students , 3 8 Wiki farm , 4 7 French stream , 5 5 Affective behaviors , 6 5 Psychomotor behaviors , 7 5 C++ , 8 5 Conic sections , 9 5 Science teaching materials for creationism , 10 4 Historical Introduction to Philosophy/Theories of Mind , 11 4 Historical Introduction to Philosophy/General Introduction , 12 4 Getting started with sound recording , 13 4 Philosophy message board , 14 3 WikiCast , 15 3 Developing Scripts and Case Studies for cisLunarFreighter/Radio Communications/STC/implementation , 16 3 Science and the nonphysical , 17 3 CisLunarFreighter/Scripts and case studies/Radio communications/Space traffic control , 18 3 Fundraising , 19 3 Lunar Boom Town , 20 3 Self Paced Reading Labs , 21 3 Web development tools , 22 3 Word processing challenges , 23 3 Karl Marx , 24 3 Northern Arizona University: Environmental Ethics/Bibliography and Links to Other Resources , 25 3 Learning JAVA

mar 2007: 1 25 Spanish/Students , 2 14 Wiki farm , 3 12 Spanish/Registration , 4 9 Teletraffic engineering , 5 7 Action research/AREOL25 , 6 7 C++ , 7 6 Spanish: An Introduction , 8 6 French stream , 9 5 Affective behaviors , 10 5 Japanese I/Vocabulary/Intro , 11 4 Concept Classification, Page 4 , 12 4 Concept Classification, Page 2 , 13 4 Limited availability , 14 4 What is Congestion control? , 15 4 Psychomotor behaviors , 16 4 Descartes Scratch Page , 17 3 Introduction to Algebra; Introduction to Calculus. , 18 3 Concepts and the Nature of Knowledge , 19 3 Spanish: An Introduction/About Spanish , 20 3 Thumbnail storyboard sheet:SBTDS:Forbe , 21 3 Blocking , 22 3 How does Internet telephony traffic differ , 23 3 Dark matter , 24 3 Teletraffic grading , 25 3 University of Asia Pacific

abr 2007: 1 12 French stream , 2 7 War and Iran , 3 7 Spanish: An Introduction , 4 6 Wiki farm , 5 6 German stream , 6 5 Quiz , 7 5 English Language Reference Desk , 8 5 Legendre differential equation , 9 4 Invariant Tasks: Skill Builder Practice , 10 4 Bloom clock project/Seen Lately (Northern Hemisphere) , 11 4 Spanish/Bilingual Spanish-English Dictionary , 12 4 Introduction to the Psychomotor Behaviors , 13 4 Skill Builder: Invariant Tasks Synthesis , 14 4 Introduction - What is the Affective Domain? , 15 4 Web Design/Embedded CSS Embedded CSS , 16 4 Wikimania 2007 , 17 4 Cognitive behaviors , 18 4 Requested kanji diagrams , 19 4 Japanese I/Vocabulary/Intro , 20 4 Research grant collaboration group , 21 4 Humane Quality , 22 3 WikiCast , 23 3 Wiki Campus Radio/Users , 24 3 Structural design , 25 3 Wikimania 2007/coordination

mai 2007: 1 9 French stream , 2 7 German stream , 3 7 Spanish/Students , 4 6 Spanish: An Introduction , 5 5 C++ , 6 4 Wiki farm , 7 4 WikiCast , 8 4 Teaching Assistant in France Survival Guide/Directory , 9 4 Generating dynamic content with MediaWiki , 10 4 Debugging Challenges , 11 4 Introduction to Illustrator , 12 4 Ear training/Perfect pitch , 13 4 Classes and Inheritance , 14 4 Sundance Raphael/poem/Entfesselt , 15 4 Spanish: An Introduction/About Spanish , 16 4 Science and the nonphysical , 17 4 Fundraising , 18 4 Russia , 19 4 Bloom Clock/2007 part one , 20 4 School of Mathematics Help Desk , 21 4 Storyboarding answer b , 22 4 Wiki Campus Radio , 23 4 Test and Quiz , 24 4 Wikiversity the Movie , 25 4 Introduction to German

jun 2007: 1 7 German stream , 2 6 Wikipedia service-learning courses , 3 6 Bloom Clock/Contributors , 4 6 French stream , 5 4 Colonial America , 6 4 Introduction to Wikiversity , 7 4 Bloom Clock/2007 part one , 8 4 C++ , 9 3 Nursing , 10 3 BCP/Rudbeckia laciniata , 11 3 Lecture:Muhammad's Life and his political contributions to the first Islamic State , 12 3 BCP/Alliaria petiolata , 13 3 Quiz , 14 3 Lesson:Mad Max:Creating the sound of fear:GarageBand with Symphony Orchestra , 15 3 Mad Max's - Computer Set Up for Film Scoring , 16 3 Learning to learn a wiki way , 17 3 JavaScript Challenges , 18 3 Hitler's Germany , 19 3 Russian Revolution , 20 2 Wiki farm , 21 2 Hexpixel Code , 22 2 Teaching Assistant in France Survival Guide/Directory , 23 2 SSHC-U-LNC: Late Empire and Nationalist China , 24 2 Imperial China , 25 2 SSHC-U-ACH: Ancient China

jul 2007: 1 9 French stream , 2 8 German stream , 3 7 Technical writing Requirements analysis , 4 7 Bloom Clock/2007 part two , 5 6 Wiki farm , 6 6 English Language Reference Desk , 7 6 Bloom Clock/Contributors , 8 5 Photoproject , 9 5 College Algebra , 10 4 Main page project , 11 4 Spanish: An Introduction/About Spanish , 12 4 Spanish: An Introduction , 13 4 C++ , 14 3 The Christian Faith , 15 3 Spanish/Students , 16 3 Technical writing , 17 3 Darwinism as religion , 18 3 Adobe Photoshop , 19 2 Introduction to Science Journalism , 20 2 BCP/Eupatorium perfoliatum/Logs , 21 2 World War II , 22 2 Bloom Clock/How bloom clocks work , 23 2 BCP/Daucus carota/Logs , 24 2 The allegory of the lookout and post-exposure immunization , 25 2 Informatic Communication Technologies

ago 2007: 1 15 Technical writing , 2 12 Technical writing tools , 3 8 Technical writing Requirements analysis , 4 8 French stream , 5 7 Bloom Clock/2007 part two , 6 7 Spanish/Students , 7 6 Bloom Clock/Contributors , 8 5 Social Entrepreneurship Curriculum , 9 5 BCP/Phlox paniculata , 10 5 C++ , 11 5 College Algebra , 12 4 Wiki farm , 13 4 BCP/Echinacea purpurea/Logs , 14 4 BCP/Linaria vulgaris/Logs , 15 4 Technical writing research , 16 4 Introduction to Art History-- M. Davis , 17 4 Spanish: An Introduction/About Spanish , 18 4 Media literacy , 19 3 Primary mathematics/Probability , 20 3 Primary mathematics/Negative numbers , 21 3 Blender/In Class 2 , 22 3 Types of GUI , 23 3 Introduction to Art History-- M. Davis/Reflections/Mr. Bishop , 24 3 Introduction to Art History-- M. Davis/Reflections/Ms. Davis , 25 3 Introduction to Art History-- M. Davis/Assignments/20 August 2007

set 2007: 1 43 Introduction to Computers/Processor , 2 42 Introduction to Computers/Peripherals , 3 32 Introduction to Computers/System software , 4 24 Introduction to Computers/Introduction , 5 8 Bloom Clock , 6 7 Wiki farm , 7 6 Bloom Clock/2007 part two , 8 6 C++ , 9 6 Technical writing , 10 6 French stream , 11 6 Media literacy , 12 5 Intellectual Traditions in Media Literacy , 13 4 Making sense of quantum mechanics , 14 4 Cow eye dissection , 15 4 The neurodiversity movement , 16 4 BCP/Asclepias curassavica/Logs , 17 4 Nonlinear finite elements , 18 4 BCP/Oxalis stricta/Logs , 19 4 BCP/Trifolium repens/Logs , 20 4 BCP/Daucus carota/Logs , 21 4 BCP/Impatiens capensis/Logs , 22 4 BCP/Securigera varia/Logs , 23 4 BCP/Galium aristatum , 24 4 BCP/Hemerocallis fulva , 25 4 Lecture: Ibn Khaldun

out 2007: 1 36 Introduction to Computers/Application software , 2 36 Introduction to Computers/Personal , 3 35 Introduction to Computers/Security , 4 33 Introduction to Computers/Networks , 5 32 Introduction to Computers/Internet , 6 8 Computer Architecture Lab/WS2007 , 7 8 Bloom Clock/2007 part two , 8 7 Wiki farm , 9 6 The Crafting Freedom Project , 10 5 BCP/Trifolium pratense , 11 5 BCP/Trifolium repens , 12 5 BCP/Linaria vulgaris , 13 5 BCP/Oxalis stricta , 14 5 French stream , 15 4 BCP/Rosa , 16 4 Harvard chart method , 17 4 Technical writing specification , 18 4 BCP/Aster divaricatus , 19 4 BCP/Solidago canadensis/Logs , 20 4 BCP/Solidago canadensis , 21 4 BCP/Oxalis stricta/Logs , 22 4 BCP/Linaria vulgaris/Logs , 23 4 BCP/Daucus carota , 24 4 BCP/Achillea millefolium , 25 4 BCP/Securigera varia

nov 2007: 1 34 Introduction to Computers/AI , 2 33 Introduction to Computers/Databases , 3 32 Introduction to Computers/Development , 4 22 Introduction to Computers/Personal , 5 11 Wiki farm , 6 7 Ivan Illich: Deschooling Society , 7 7 Computer Architecture Lab/WS2007 , 8 6 Reading the Linux Kernel Sources , 9 6 Introduction to Computers/Security , 10 4 BCP/Nepeta x faassenii , 11 4 Bloom Clock/2007 part two , 12 3 Composing free and open online educational resources , 13 3 Globalization , 14 3 Bash programming , 15 3 Kernewek Onan , 16 3 Introduction to Category Theory/Products and Coproducts , 17 3 Ivan Illich: Deschooling Society/Notes , 18 3 The Crafting Freedom Project , 19 3 BCP/Spiraea thunbergii/Logs , 20 3 BCP/Spiraea thunbergii , 21 3 BCP/Chrysanthemum x morifolium/Logs , 22 3 World War I , 23 3 BCP/Echinacea purpurea , 24 3 BCP/Achillea millefolium , 25 3 BCP/Trifolium pratense

dez 2007: 1 11 Wiki farm , 2 6 Wikipedia arbitration committee/Pedophilia userbox wheel war , 3 6 Wikipedia arbitration committee , 4 5 Participant of the composing free and open online educational resources course , 5 4 Main page learning project/QOTD , 6 4 Fairy Rings , 7 4 Composing free and open online educational resources , 8 4 Bloom Clock/Unknown Plants , 9 4 Learning to learn a wiki way , 10 3 Lunarpedia , 11 3 Museum photography , 12 3 Main page learning project , 13 3 Stanford Open Source Lab , 14 3 Holidays of Hope , 15 3 Ivan Illich: Deschooling Society , 16 3 The Crafting Freedom Project , 17 3 Smoking cessation , 18 3 Technical writing tools , 19 3 BCP/Taraxacum officinale/Logs , 20 3 Life of Alexander , 21 3 Lunar Boom Town , 22 3 Skype , 23 3 C++ , 24 3 French stream , 25 2 English sentence structure/Exercises

jan 2008: 1 21 Introduction to Computers/Peripherals , 2 19 Introduction to Computers/Introduction , 3 17 Introduction to Computers/System software , 4 16 Introduction to Computers/Processor , 5 13 Vital Ideation , 6 11 Participant of the composing free and open online educational resources course , 7 6 Wiki farm , 8 6 Future media class/Media Fads Versus Paradigm Shifts , 9 5 Main page learning project/QOTD , 10 5 French stream , 11 4 Biogeochemical Selectiveness of Cedars Over Metamorphic Rocks of the Escambray Complex, Sancti Spíritus, Cuba/Vegetation , 12 4 Future media class , 13 4 Museum photography , 14 4 Main page learning project , 15 4 Venus , 16 4 C++ , 17 3 Biogeochemical Selectiveness of Cedars Over Metamorphic Rocks of the Escambray Complex, Sancti Spíritus, Cuba/Study Area , 18 3 Biogeochemical Selectiveness of Cedars Over Metamorphic Rocks of the Escambray Complex, Sancti Spíritus, Cuba/Introduction , 19 3 Biogeochemical Selectiveness of Cedars Over Metamorphic Rocks of the Escambray Complex, Sancti Spíritus, Cuba , 20 3 Future media class/Media Convergence , 21 3 Future media class/Emerging Technologies: Preparing For The Next Job Market , 22 3 Future media class/Virtual Experiences: Now More Like Our Real World , 23 3 Augustine of Hippo/Introduction to Augustine of Hippo/Augustine's Spiritual Journey , 24 3 Augustine of Hippo/Augustine's Theory of Knowledge , 25 3 Recovery psychology/Lesson3

fev 2008: 1 36 Participant of the composing free and open online educational resources course , 2 18 Introduction to Computers/Application software , 3 17 Introduction to Computers/Networks , 4 15 Introduction to Computers/Personal , 5 5 Wiki farm , 6 5 World History , 7 5 Composing free and open online educational resources , 8 4 Agile software development , 9 4 Wikiversity learning model/Discussion group , 10 4 Main page learning project/QOTD , 11 4 Thucydides: The Peloponnesian War , 12 3 Wittgenstein reading group , 13 3 TEFL-TESOL , 14 3 PID Controller , 15 3 Third Law of Thermodynamics , 16 3 Radio Discussion/Living on Earth/2008.1.18/Segment 4 , 17 3 Radio Discussion/Living on Earth/2008.1.18 , 18 3 Principles of Electricity , 19 3 Breton stream , 20 3 Spanish/Spanish One , 21 2 Biology 11 , 22 2 FOSSlike collaboration in schools/Resources , 23 2 FLOSS and education , 24 2 Biology 12 , 25 2 Introduction to Topology/Lesson 2

mar 2008: 1 15 Introduction to Computers/Security , 2 14 Introduction to Computers/Databases , 3 14 Introduction to Computers/Internet , 4 12 Participant of the composing free and open online educational resources course , 5 11 Introduction to Computers/Development , 6 7 Wiki farm , 7 7 Learning the basics of French/Participants , 8 6 Open educational resources and globalization , 9 6 Composing free and open online educational resources , 10 6 French stream , 11 5 DFE2008 Office Chair Foam , 12 5 Education and collaboration , 13 5 BCP/Crocus/Logs , 14 5 Bloom Clock/Master List , 15 5 Thucydides: The Peloponnesian War , 16 5 BCP/Stellaria media/Logs , 17 5 Bloom Clock/Unknown Plants , 18 5 Bloom Clock/Contributors , 19 4 Workshop for Australian education policy , 20 4 Composing free and open online educational resources/Participants , 21 4 Introduction to Futures Studies , 22 4 Creating a Development Environment , 23 4 FLOSS and education , 24 4 BCP/Lamium purpureum/Logs , 25 4 BCP/Galanthus nivalis/Logs

abr 2008: 1 37 Design for the Environment , 2 16 Introduction to Computers/AI , 3 9 Wiki farm , 4 9 BCP/Forsythia x intermedia/Logs , 5 8 Writing discipline specific research papers , 6 8 BCP/Taraxacum officinale/Logs , 7 7 Introduction to Computers/Personal , 8 6 DFE2008 Metal Cleaning , 9 6 DFE2008 Bus Fuel Alternatives , 10 6 DFE2008 Oil Sands Extraction Technique , 11 6 DFE2008 Disposable Water Bottle , 12 6 DFE2008 Internal Combustion Engines , 13 6 DFE2008 Power Generation , 14 6 DFE2008 Grocery Bags , 15 6 DFE2008 Residential Roofing Materials , 16 6 Content Prioritization , 17 6 BCP/Narcissus/Logs , 18 6 BCP/Lamium purpureum/Logs , 19 6 BCP/Forsythia x intermedia , 20 6 BCP/Taraxacum officinale , 21 5 DFE2008 Residential Micro Cogeneration , 22 5 DFE2008 Power Generation Alternatives for Off-Grid Homes , 23 5 DFE2008 Residential Insulation , 24 5 DFE2008 Dry Cleaning Detergent , 25 5 DFE2008 Hydrogen Generation Methods

mai 2008: 1 8 Composing free and open online educational resources/Critique and feedback , 2 7 Wiki farm , 3 6 Bloom Clock/Master List , 4 6 Bloom Clock/Unknown Plants , 5 6 BCP/Forsythia x intermedia , 6 6 BCP/Taraxacum officinale , 7 5 Arbitrary Hour , 8 5 BCP/Convallaria majalis , 9 5 BCP/Tulipa , 10 5 BCP/Syringa vulgaris/Logs , 11 5 BCP/Aesculus hippocastanum/Logs , 12 5 BCP/Taraxacum officinale/Logs , 13 5 Bloom Clock/Contributors , 14 4 BCP/Convallaria majalis/Logs , 15 4 Learning the basics of French/Introducing Yourself , 16 4 How to be a Wikimedia sysop , 17 4 BCP/Tulipa/Logs , 18 4 BCP/Rhododendron , 19 4 BCP/Forsythia x intermedia/Logs , 20 4 BCP/Syringa vulgaris , 21 4 BCP/Narcissus , 22 4 BCP/Aesculus hippocastanum , 23 3 IB History Review Guide , 24 3 Swedish definite forms , 25 3 Statistics 103

jun 2008: 1 6 Composing free and open online educational resources/Participants/Next start , 2 6 Arbitrary Hour , 3 6 Circuit Analysis Quiz 1 , 4 5 Collective learning , 5 5 Open educational resources and globalization , 6 5 Bloom Clock/Master List , 7 5 BCP/Iris/Logs , 8 4 Medical School Curriculum , 9 4 How to design programs , 10 4 Chess , 11 4 OpenOffice.org , 12 4 Brain Imaging , 13 4 Composing free and open online educational resources/Participants , 14 4 Bloom Clock/Unknown Plants , 15 4 Anthropomorphic Robotics Project , 16 4 CisLunarFreighter , 17 3 Wiki farm , 18 3 Creating Significant Learning Experiences (Dee Fink) , 19 3 Educative Assessment (Dee Fink) , 20 3 Creating significant learning outcomes (Dee Fink) , 21 3 Motivational interviewing , 22 3 Open Scientist/Related Projects , 23 3 List of all the GMAT Sentence Correction Quizes , 24 3 Essays , 25 3 How to design programs/Problem set 1

jul 2008: 1 14 Wikimedia Ethics , 2 8 Wiki farm , 3 7 Wikimedia Ethics/Brainstorming , 4 6 Wikimedia Ethics/Introduction , 5 6 Wikimedia Ethics/Suggested essays , 6 5 Horbury High School , 7 4 Genes to Cognition Project , 8 4 Wikimedia Ethics/Ethics on Wikipedia and the Internet , 9 4 Wikimedia Ethics/Overview , 10 4 Medieval History , 11 4 Composing free and open online educational resources/Participants/Next start , 12 4 Passive sign convention , 13 3 Democracy Project , 14 3 Wikiversity community blog , 15 3 Precipitation detection , 16 3 Optimal classification , 17 3 Lecture 2.0 , 18 3 Spanish 1 , 19 3 Firefox , 20 3 Circuit Analysis Quiz 2 , 21 3 WikiProject study before editing , 22 3 GNUmedia , 23 3 Open source chairs , 24 3 Educational Media Awareness Campaign/Information technology/POTD 1 , 25 3 How to be a Wikimedia sysop

ago 2008: 1 13 Wikipedia Ethics/Case Studies1 , 2 10 Wikimedia Ethics/Participants and objectives , 3 8 Expanding your professional vocabulary , 4 8 Wikimedia Ethics , 5 7 Teamspeak , 6 7 Wikimedia Ethics/Feedback 1 , 7 7 Composing free and open online educational resources/Participants/Next start , 8 6 Wikimedia Ethics/Case Studies , 9 6 OLPC peripheral development , 10 5 Wikimedia Ethics/Case Studies2 , 11 5 Follicular Dendritic Cells , 12 5 Wikimedia Ethics/List of questions , 13 4 Wiki farm , 14 4 Wikimedia Ethics/Moulton, JWSchmidt's investigation , 15 4 Wikimedia Ethics/Feedback 2 , 16 4 Lecture 2.0 , 17 4 Social psychology (psychology)/Assessment/Essay/Topics , 18 4 Wikimedia Ethics/Overview , 19 4 Wikimedia Ethics/Brainstorming , 20 3 Wikimedia Ethics/Social contract , 21 3 Wikiversity the Movie/Kickoff meeting , 22 3 Wikiversity participants who choose to leave , 23 3 Assuming good faith , 24 3 Social Innovation , 25 3 SSE Meeting of 20080807

set 2008: 1 19 Expanding your professional vocabulary , 2 11 Learning from conflict and incivility , 3 10 Wikimedia Ethics/Moulton, JWSchmidt's investigation , 4 8 Wikimedia Ethics/Case Studies/Concordances, Dossiers, Scathing Indictments, and Ethics , 5 8 Wikimedia Ethics , 6 7 Wikimedia Ethics/Case Studies/Biographies of Living People , 7 7 Wikipedia Ethics/Case Studies1 , 8 6 Ethical Management of the English Language Wikiversity/Case Studies/Deletionism , 9 6 Wikimedia Ethics/Case Studies , 10 5 Study project on Intelligent Design , 11 5 Wikimedia Ethics/Moulton, JWSchmidt's investigation/Final report , 12 5 Acrylic painting development ideas , 13 5 Web design , 14 5 Etiquette , 15 4 Wiki farm , 16 4 Loops in Matlab , 17 4 Getting Started , 18 4 Eml4500.f08.qwiki , 19 4 Eml4500.f08.FEABBQ/HW1 , 20 4 Eas4200c.f08.radsam/Structures and Materials , 21 4 Study Guide:Mathematical Mesoscopic Physics/Mesoscopic Physics Glossary , 22 4 Study Guide:Mathematical Mesoscopic Physics , 23 4 WikiProject study before editing , 24 4 How to be a Wikimedia sysop , 25 4 Albanian sea port history/Comparing with the growth of Wikiversity

out 2008: 1 57 Internet and Project Competence , 2 10 Computer Architecture Lab/WS2008 , 3 7 Expanding your professional vocabulary , 4 7 French stream , 5 6 Consensus in a wiki environment/An introduction to Consensus , 6 6 Open Source ERP/Executive Diploma , 7 5 Internet and Project Competence/groups , 8 5 Consensus in a wiki environment , 9 5 Random , 10 4 Wiki farm , 11 4 Consensus in a wiki environment/Measuring Consensus , 12 4 Managing a private wiki , 13 4 Introduction to US History/Justification , 14 4 Web 2.0 for Professional Use/Blogs and Blogging , 15 4 Introduction to US History , 16 4 Beowulf , 17 4 Wikimedia Ethics , 18 4 Introduction to German , 19 3 Wiki Campus Radio/Active audio stream/31-10 , 20 3 Computer Architecture Lab/WS2008/Group2/ISA comparison , 21 3 Earth-impact events , 22 3 SAR mission 2008 01 , 23 3 Asperger syndrome , 24 3 Introduction to US History/United We Stand:The History of the United States of America/America Before Columbus , 25 3 Introduction to US History/United We Stand:The History of the United States of America

nov 2008: 1 9 Wiki farm , 2 8 Internet and Project Competence , 3 6 Internet and Project Competence/group4 , 4 6 English Language Reference Desk , 5 5 7d Physics , 6 5 Internet and Project Competence/group3 , 7 5 Expanding your professional vocabulary , 8 5 Wiki Campus Radio , 9 4 Amateur astronomy/Initial experiences , 10 4 History of Europe to 1648 , 11 4 Stargazing , 12 4 Biomembrane Transport , 13 4 Internet and Project Competence/group6a , 14 4 Random , 15 4 Wikipedia , 16 4 Wikipedia service-learning courses , 17 3 Alternative ways to become an observer , 18 3 Wikipedia/Quizzes , 19 3 Colonial Haiti , 20 3 The Resting Membrane Potential , 21 3 Diffusion and osmosis , 22 3 Introduction to Biomembranes , 23 3 Internet and Project Competence/group5 , 24 3 Internet and Project Competence/group1 , 25 3 Introduction to US History

dez 2008: 1 9 Comparison between Roman and Han Empires , 2 7 Wiki farm , 3 5 7d Physics , 4 5 English Language Reference Desk , 5 5 French stream , 6 4 Ancient Innovations , 7 4 Pole jam , 8 4 Internet and Project Competence/group5 , 9 4 Internet and Project Competence/group1 , 10 3 Nonkilling Political Science , 11 3 Being a sustainable engineer , 12 3 The regeneration army , 13 3 Internet and Project Competence/group6a , 14 3 Internet and Project Competence/group3 , 15 3 Internet and Project Competence/group2 , 16 3 American J.D. Program , 17 2 Online graphics , 18 2 Getting to Know You , 19 2 Conservation Entrepreneurship/Definition , 20 2 Conservation Entrepreneurship , 21 2 Haven art , 22 2 Nonkilling Linguistics , 23 2 Nonkilling Anthropology , 24 2 Robotics Projects , 25 2 Textile information systems design

jan 2009: 1 14 Wiki farm , 2 5 HTML , 3 5 French stream , 4 4 Conservation Entrepreneurship/Resources , 5 4 Ancient Egyptian Monuments Project , 6 4 Wikipedia and the 2008 US elections , 7 4 Wikis in scholarly communication , 8 4 Museum photography , 9 4 Web design , 10 3 Evolutionary Synthesis , 11 3 Theology as Seen in Prophets and Psalms , 12 3 Djoser's Step Pyramid in Saqqara , 13 3 Conservation Entrepreneurship/Business Plans/Examples , 14 3 Artificial Consciousness/(AC) , 15 3 Conservation Entrepreneurship/Business Plans , 16 3 Appropedia , 17 3 Brezhoneg Unan/Lesson 1/Saludiñ/Quiz , 18 3 Conservation Entrepreneurship/Definition , 19 3 Radio Interferometer Telescope , 20 3 Ivan Illich: Deschooling Society , 21 3 Artificial Consciousness , 22 3 English Language Reference Desk , 23 3 Introduction to Programming in Java , 24 3 C++ , 25 3 Introduction to Computer Science

fev 2009: 1 19 Wiki farm , 2 7 Open Source ERP/Class01 , 3 6 Conservation Entrepreneurship/Local Initiatives , 4 5 Learning the basics of French/Participants , 5 4 Spacetime metrics explained for biologists , 6 4 Conservation Entrepreneurship/Resources , 7 4 Conservation Entrepreneurship , 8 4 Introduction to Programming/About Programming , 9 3 Conservation Entrepreneurship/Assignments/Projeto Iauaretê/Value Proposition , 10 3 Conservation Entrepreneurship/Community Projects , 11 3 Pandemic flu , 12 3 Introduction to Non-Genetic Darwinism/Physics of Self-Organization , 13 3 Introduction to Non-Genetic Darwinism/Darwin's Theory of Natural Selection , 14 3 Introduction to Non-Genetic Darwinism/Non-Biological Darwinism , 15 3 Introduction to Non-Genetic Darwinism/Darwinism, Culture and Philosophy , 16 3 Conservation Entrepreneurship/Assignments , 17 3 Introduction to Non-Genetic Darwinism , 18 3 Conservation Entrepreneurship/Class Outlines and Readings , 19 3 GreySmith Courseware Forum , 20 3 Neuropsychology Forum , 21 3 Conservation Entrepreneurship/Snack List , 22 3 Nonkilling Human Biology , 23 3 Open Source ERP/Executive Masters , 24 3 Network devices , 25 3 World History

mar 2009: 1 3 Software testing , 2 3 Basic filmmaking (pre-production) , 3 3 Design for the Environment , 4 2 Microprocessor learning project , 5 2 DIY UAS , 6 2 Karam Kriya , 7 2 C Programming , 8 2 Introduction to C programming/Hello World , 9 2 Introduction to C programming/What you need before you can learn , 10 2 Artificial Consciousness/Neural Correlates/Inter-Organ Connection Models/Cerebral Hippocampus Connections , 11 2 Chimpanzee , 12 2 Research Mentoring Program , 13 2 Om språk, språklärande, mångkultur och identitetsformationer , 14 2 Introduction to Partial Differential Equations , 15 2 Reflections on Feuer , 16 2 Conservation Entrepreneurship/Assignments/Projeto Iauaretê/Value Proposition/What needs will our product satisfy? How will it create value for the customer? , 17 2 Conservation Entrepreneurship/Assignments/Projeto Iauaretê/Value Proposition/Who are our customers? , 18 2 Conservation Entrepreneurship/Assignments/Projeto Iauaretê/Value Proposition/Mission Statement , 19 2 Conservation Entrepreneurship/mission and time , 20 2 Music Learning Project , 21 2 Conservation Entrepreneurship/Assignments/Projeto Iauaretê , 22 2 Autism awareness , 23 2 Introduction to Non-Genetic Darwinism/Non-Biological Darwinism , 24 2 Autism and Asperger's Syndrome: The Guide/Awareness Week , 25 2 Autism rights

abr 2009: 1 16 Design for the Environment , 2 6 DFE2009 Power Generation for Ontario , 3 5 DFE2009 Alternatives To Traditional Book Publishing , 4 5 DFE2009 Flashlights , 5 5 DFE2009 Energy Storage for Wind Power Generation , 6 5 DFE2009 Residential Heating and Cooling , 7 5 DFE2009 Disposable Coffee Cups , 8 5 DFE2009 Automobile Engines , 9 5 Random , 10 4 DFE2009 All Purpose Residential Cleaning , 11 4 DFE2009 Hydrogen Production , 12 4 DFE2009 Worldwide Package Cushioning , 13 4 DFE2009 Converting Garbage to Energy , 14 4 C++ , 15 4 French stream , 16 3 Jet engine performance , 17 3 Genes to Cognition Project , 18 3 Numerical Linear Algebra , 19 3 Binary Stars and Extrasolar Planets Learning Activity , 20 3 Seminarium 5, 2009-04-16 , 21 3 DFE2009 Street Lighting in Residential Region , 22 3 DFE2009 Residential Heating and Cooling in Ontario , 23 3 DFE2009 Scooter Transportation Alternatives , 24 3 DFE2009 Automobile Car Mats , 25 3 Engineering Help Desk

mai 2009: 1 5 Learning the basics of French/Participants , 2 4 Data Analysis using the SAS Language , 3 4 Wikiversity Reports , 4 4 French stream , 5 3 Jet engine performance , 6 3 Learning by failing , 7 3 Numerical Linear Algebra , 8 3 Wavevolution , 9 3 C++ , 10 2 Hexpixel Code , 11 2 Unidirectional propagation antenna , 12 2 Amateur radio , 13 2 BCP/Rubus sect. Eubatus , 14 2 Carlos Castaneda , 15 2 Numerical Linear Algebra/Invpower exercises , 16 2 Numerical Linear Algebra/Power exercises , 17 2 VB.NET Reusable Code , 18 2 REOPro Certification Training , 19 2 Ett pussel med många bitar , 20 2 French Wall Charts and Posters/Conjugation of Finir (Complete) , 21 2 CodeBase , 22 2 Staredit , 23 2 French Wall Charts and Posters/Conjugation of Aimer (Complete) , 24 2 French Wall Charts and Posters , 25 2 Analysis of variance/Calculators

jun 2009: 1 10 Web 2.0 , 2 4 NAU-POS254-Socialism , 3 4 NAU-POS254-Classical liberalism and conservatism , 4 4 Introduction to the Dutch language , 5 4 C++ , 6 3 Introduction to the Dutch language/Lesson 1: Greetings , 7 3 NAU-POS254-Radical challenges to Enlightenment Ideologies , 8 3 Carlos Castaneda , 9 3 NAU-POS254-Fascism , 10 3 Random , 11 3 Featured content/9 , 12 3 Learning the basics of French/Participants , 13 3 Zen koan quote , 14 3 English Language Reference Desk , 15 2 Jet engine performance , 16 2 Project 2: Sports , 17 2 Project 1: Dutch Holidays , 18 2 Lesson 2: To Be in Dutch , 19 2 Amateur radio/ Extremely high frequency , 20 2 Amateur radio/ Super high frequency , 21 2 Amateur radio/ Ultra high frequency , 22 2 Amateur radio/ Very high frequency , 23 2 Amateur radio/ High frequency , 24 2 Amateur radio/ Medium frequency , 25 2 Amateur radio/ Low frequency

jul 2009: 1 18 Great Repeal Bill , 2 17 Facilitating Online/Participants , 3 8 Great Repeal Bill/Debate , 4 4 Facilitating Online , 5 3 Cleverlearn English Language Institute (CELI) , 6 3 MediaWiki namespace , 7 3 Blogs , 8 3 Wikis , 9 3 Ejump nam socialmedia eportfolio , 10 3 Appropedia , 11 3 Wikis in scholarly communication , 12 3 Lecture 2.0 , 13 3 Assistant teacher course , 14 3 BCP/Thalictrum pubescens/Logs , 15 3 C++ , 16 3 Blues basics , 17 3 HTML , 18 3 Educational wikis , 19 2 PHP Story , 20 2 HHF , 21 2 How to play Poker , 22 2 Digital portfolio , 23 2 Hexpixel Code , 24 2 Vertical farming , 25 2 Perennial cutbacks

ago 2009: 1 11 Great Repeal Bill , 2 10 Facilitating Online/Participants , 3 6 Active learning , 4 6 Great Repeal Bill/Debate , 5 5 Facilitating Online/course mini conference , 6 5 French stream , 7 3 HHF/Biology , 8 3 Kommentarer till kurspaper , 9 3 The Inevitability of Globalism/From animism to objective language , 10 3 Comparative law and justice , 11 3 Facilitating Online/Meetings , 12 3 How to be a Wikimedia sysop/Wikiversity , 13 3 Learning the basics of French/Participants , 14 3 Why cats present dead mice to their owners , 15 3 Web 2.0 , 16 3 Facilitating Online , 17 3 Introduction to C++ , 18 2 Transclusion , 19 2 Biblical Studies (NT)/IV. THE SEVEN TRUMPETS , 20 2 Biblical Studies (NT)/III. THE SEVEN SEALS , 21 2 Biblical Studies (NT)/II. THE SEVEN ASIAN CHURCHES , 22 2 Biblical Studies (NT)/I. INTRODUCTION TO REVELATION , 23 2 HHF/Chemistry , 24 2 HHF/Physics , 25 2 HHF/Mathematics

set 2009: 1 43 AP Language: Education , 2 5 Egm6321.f09.Team2/HW2 , 3 4 Introduction to CAD , 4 4 Pollution Control and Monitoring , 5 4 Environmental Legislation and Management Systems , 6 3 Intro Emerging Tech , 7 3 Emerging tech Africa , 8 3 UV Sensitive Beads , 9 3 Preparation of Soap , 10 3 Polymers , 11 3 DNA Extraction , 12 3 Cold and Hot Packs , 13 3 Batteries From Coins , 14 3 Comments on the paper The Complexity of Identity , 15 3 Praise and Punishment at Wikiversity , 16 3 Google Search and Wikiversity , 17 3 Comments on the final paper , 18 3 Kommentarer till kurspaper , 19 3 Ett pussel med många bitar , 20 3 Writing discipline specific research papers , 21 3 Technical writing overview , 22 3 War Seminar/Art and War , 23 3 English Language Reference Desk , 24 2 Happiness , 25 2 Notes on The Myth of Mental Illness, by Thomas Szasz

out 2009: 1 22 AP Language: Education , 2 5 Facilitating Online/Participants , 3 3 Comparison of wiki farms , 4 3 Emerging tech Africa , 5 3 Pakistan clj , 6 3 Finland , 7 3 Canada , 8 3 Sweden , 9 3 Jordan , 10 3 Connectivism glossary , 11 3 Australia , 12 3 University of Canberra , 13 3 Ubuntu , 14 3 How to be a Wikimedia sysop , 15 3 Technical writing , 16 2 Health informatics , 17 2 Advanced projects in chemistry , 18 2 Usergroup:Parents , 19 2 Voice over Internet Protocol , 20 2 Arndell Special School , 21 2 Installing Linux/Ubuntu , 22 2 Social cognitive neuroscience , 23 2 Mapping my world , 24 2 ICT Literacy , 25 2 Magnet Theme Integration: Creating Public Service Announcements

Note: Before the official launch of Wikiversity as a project, in August 2006,
some course materials were already produced on Wikibooks.
Wikistats pages that show monthly trends include that early history.

Estatísticas geradas em Terça-feira, 24 de novembro 2009 a partir de cópias do banco de dados SQL de Sábado, 31 de outubro 2009
Versão do script:2.5
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
For documentation see meta
Scripts: scripts.zip

All data and images on this page are in the public domain.