Estatísticas da Wikiversity inglês

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist

Metrics have been collected from a full archive dump, which contains all revisions of every article, meta data and raw content.
See also metrics definitions


 
Monthly counts & Quarterly rankings: abril 2013
 
DataContributorsArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
abr 2013+2% +27% +1%   -22%+2%+2%0%0%+2%+2%+1%
mar 2013+1% -22% +2%   0%+8%+2%+5%+1%+2%+2%0%
fev 2013+2% +126% +1%   +62%+2%+2%+2%+3%+2%+2%+3%
jan 2013+1% -36% +1%   -17%+1%+1%+1%0%+1%+1%+1%
dez 2012+1% -11% +1%   -2%+1%+1%+1%0%+1%+1%+2%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
abr 2013236456121819 k620,841124,9 k135 Mb13,2 M46 k1,5 k26 k51 k6,7 k
mar 2013230832951219 k1020,740736,2 k133 Mb12,9 M46 k1,5 k25 k49 k6,7 k
fev 2013227652122819 k720,740446,2 k123 Mb12,6 M44 k1,5 k25 k48 k6,7 k
jan 2013222419541118 k320,640023,8 k121 Mb12,3 M43 k1,5 k24 k47 k6,5 k
dez 201222051985418 k620,539874,6 k119 Mb12,2 M43 k1,5 k24 k46 k6,5 k
nov 201221861696518 k520,439824,7 k118 Mb12,1 M42 k1,5 k24 k46 k6,3 k
out 2012217050127618 k620,339675,4 k117 Mb11,9 M42 k1,5 k23 k45 k6,3 k
set 2012212063127818 k620,239625,6 k115 Mb11,8 M41 k1,5 k23 k44 k6,2 k
ago 201220571745418 k420,139523,2 k114 Mb11,6 M41 k1,5 k23 k43 k6,2 k
jul 201220401040518 k1220,139353,7 k112 Mb11,5 M40 k1,4 k22 k42 k6,1 k
jun 20122030627817 k620,339823,3 k110 Mb11,4 M40 k1,4 k20 k40 k6,0 k
mai 201220241775517 k520,339744,4 k109 Mb11,3 M39 k1,2 k19 k39 k6,0 k
abr 20122007181121617 k820,239286,8 k107 Mb11,1 M39 k1,2 k19 k38 k6,0 k
mar 2012198955146917 k920,139106,4 k105 Mb10,9 M38 k1,1 k18 k36 k5,9 k
fev 2012193471151616 k720,138765,9 k103 Mb10,6 M37 k1,1 k18 k34 k5,9 k
jan 201218635399816 k42038414,0 k101 Mb10,3 M36 k1,1 k18 k33 k5,9 k
dez 20111810965516 k319,937762,9 k99 Mb10,1 M36 k1,2 k17 k32 k5,8 k
nov 20111801571652716 k919,8369613 k96 Mb9,8 M35 k1,1 k16 k31 k5,8 k
out 20111744511331016 k1019,436217,3 k94 Mb9,5 M34 k1,1 k16 k30 k5,7 k
set 2011169363112815 k1119,335925,0 k91 Mb9,2 M34 k1,1 k15 k28 k5,6 k
ago 201116301751315 k419,435992,7 k89 Mb9,0 M33 k1,1 k15 k28 k5,6 k
jul 201116131341415 k519,435852,5 k89 Mb8,9 M33 k1,1 k15 k27 k5,5 k
jun 201116001040315 k719,435912,4 k88 Mb8,8 M32 k1,0 k15 k27 k5,4 k
mai 201115901675614 k819,535954,1 k87 Mb8,7 M32 k1,0 k14 k27 k5,4 k
abr 2011157418104814 k1319,635895,2 k85 Mb8,6 M32 k86014 k26 k5,4 k
mar 20111556331321314 k2219,835888,4 k83 Mb8,3 M32 k85114 k25 k5,3 k
fev 2011152380149713 k820,234747,2 k77 Mb7,7 M31 k84214 k24 k5,3 k
jan 201114433497513 k132034414,9 k75 Mb7,5 M30 k84013 k23 k5,1 k
dez 201014091980713 k1520,234915,3 k73 Mb7,4 M29 k81613 k22 k5,1 k
nov 20101390491312312 k320,535329,9 k72 Mb7,2 M29 k80813 k21 k4,8 k
out 2010134136108512 k319,933855,1 k69 Mb6,8 M29 k80112 k20 k4,8 k
set 201013055095512 k719,633334,1 k67 Mb6,7 M28 k79612 k20 k4,7 k
ago 201012551355312 k519,633184,0 k66 Mb6,5 M28 k79712 k19 k4,7 k
jul 201012421357211 k319,532912,4 k65 Mb6,4 M28 k79211 k19 k4,6 k
jun 201012292460311 k319,532862,7 k64 Mb6,3 M28 k78911 k19 k4,6 k
mai 201012051246311 k319,432673,3 k63 Mb6,3 M27 k78111 k18 k4,5 k
abr 201011932066611 k619,232625,5 k62 Mb6,2 M27 k77211 k18 k4,5 k
mar 201011732164511 k919,132405,3 k61 Mb6,1 M27 k77111 k17 k4,4 k
fev 201011523074411 k41932096,9 k59 Mb5,9 M26 k77311 k17 k4,3 k
jan 201011221746211 k318,631962,6 k58 Mb5,8 M26 k75011 k17 k4,3 k
dez 200911051551211 k218,531843,9 k57 Mb5,7 M24 k70711 k16 k4,2 k
nov 200910902059211 k318,331624,2 k56 Mb5,6 M24 k70711 k16 k4,2 k
out 200910701767310 k31831183,3 k55 Mb5,5 M23 k69511 k16 k4,1 k
set 200910533684610 k1317,931035,8 k54 Mb5,4 M23 k69810 k15 k4,1 k
ago 20091017165629,9 k51831214,0 k52 Mb5,3 M22 k64310 k14 k4,0 k
jul 20091001113739,8 k717,830943,1 k51 Mb5,2 M21 k64110 k14 k3,9 k
jun 2009990224819,6 k417,931222,9 k51 Mb5,1 M21 k90410 k13 k3,8 k
mai 2009968164949,5 k417,830922,7 k50 Mb5,0 M20 k76710,0 k15 k3,8 k
abr 2009952468119,3 k417,830634,1 k49 Mb4,9 M20 k7669,2 k14 k3,8 k
mar 2009906135239,2 k417,630322,6 k48 Mb4,8 M20 k7299,0 k14 k3,7 k
fev 2009893146179,1 k717,530263,9 k47 Mb4,7 M19 k7199,0 k13 k3,7 k
jan 2009879206498,9 k817,429934,2 k46 Mb4,6 M19 k7319,0 k13 k3,6 k
dez 2008859165268,7 k517,429563,6 k44 Mb4,4 M19 k7068,9 k13 k3,5 k
nov 2008843276568,5 k617,329504,8 k43 Mb4,3 M18 k7038,8 k12 k3,4 k
out 2008816176658,4 k617,129525,0 k42 Mb4,2 M18 k6908,5 k12 k3,3 k
set 2008799328868,2 k816,829615,1 k41 Mb4,2 M18 k6498,3 k12 k3,1 k
ago 2008767185687,9 k1016,729966,1 k40 Mb4,1 M17 k6488,1 k11 k2,9 k
jul 2008749165777,6 k616,630165,1 k39 Mb3,9 M17 k6377,9 k11 k2,8 k
jun 20087331249107,4 k1016,330495,8 k38 Mb3,9 M16 k6207,8 k10 k2,6 k
mai 2008721955107,1 k1116,231176,7 k37 Mb3,8 M16 k5807,7 k9,9 k2,5 k
abr 200871298150166,8 k1416,1320113 k36 Mb3,7 M15 k4837,5 k9,6 k2,3 k
mar 20086143184126,3 k1315,232037,7 k33 Mb3,5 M15 k4137,0 k8,2 k2,1 k
fev 2008583236035,9 k914,932753,4 k32 Mb3,4 M14 k3486,8 k7,6 k1,9 k
jan 2008560206175,7 k61532985,1 k31 Mb3,2 M13 k3436,7 k7,4 k1,8 k
dez 2007540184955,5 k614,632363,7 k29 Mb3,1 M13 k3336,5 k7,1 k1,5 k
nov 2007522229665,3 k-514,431525,2 k27 Mb2,9 M12 k3126,2 k6,8 k1,5 k
out 20075005110695,5 k141329847,2 k26 Mb2,8 M13 k2486,4 k6,4 k1,4 k
set 2007449268195,0 k2412,730536,3 k25 Mb2,7 M12 k1896,2 k6,0 k1,2 k
ago 2007423297384,3 k1813,333125,1 k23 Mb2,5 M11 k1645,9 k5,6 k1,0 k
jul 2007394175833,8 k1013,933263,3 k20 Mb2,2 M10,0 k2645,4 k5,3 k961
jun 2007377134853,5 k1014,234173,4 k19 Mb2,1 M8,0 k2554,9 k5,0 k909
mai 2007364255583,1 k1214,536194,4 k18 Mb2,0 M7,2 k1904,5 k4,8 k832
abr 2007339318582,8 k111537355,2 k17 Mb1,8 M5,5 k784,2 k4,5 k711
mar 2007308358632,4 k614,838464,5 k15 Mb1,7 M4,8 k813,7 k4,0 k604
fev 2007273298272,3 k91438134,0 k14 Mb1,6 M4,6 k1003,1 k3,6 k555
jan 2007244367952,0 k1613,939185,1 k13 Mb1,4 M3,9 k1002,5 k3,0 k461
dez 2006208328341,5 k715,144024,0 k11 Mb1,2 M3,4 k981,9 k2,3 k375
nov 2006176216341,3 k714,545053,3 k9,7 Mb1,1 M2,3 k691,5 k1,8 k309
out 2006155407551,1 k91448294,2 k8,6 Mb991 k2,1 k549111,5 k228
set 200611533571817613,554732,3 k7,3 Mb852 k1,1 k53330960157
ago 20068223353652813,559902,3 k6,5 Mb753 k87645247618112
jul 200659 6 419115,582343826,0 Mb677 k6534420741732
jun 20065948 401115,284613635,7 Mb668 k6004420139529
mai 20065558 384 14,986965095,6 Mb657 k6164418437727
abr 2006507151375 13,985165245,4 Mb631 k6084418138125
mar 200643310 364112,987213865,3 Mb617 k5864417536225
fev 200640591348212,491364675,2 Mb618 k5904515135621
jan 20063514 304112,6103913435,1 Mb614 k5644510332219
dez 200534471284112,3109375425,0 Mb605 k552458929417
nov 200530241257111,5117392594,8 Mb591 k479716826414
out 200528 41222112,2131463484,8 Mb572 k464456824010
set 20052827 206111,4113151603,7 Mb454 k3203316421110
ago 200526361187111,795443192,7 Mb342 k2962075920210
jul 2005235101151212,42224644540 kb58 k2551581728
jun 20051868 98112,51853459326 kb31 k19615967
mai 20051212 65 11,81961139218 kb22 k181 2782
abr 20051114 57 11,11971158185 kb20 k155 2642
mar 20051024 48 9,9153280132 kb13 k79 1422
fev 2005823 41 9,6137091104 kb10 k44 1242
jan 2005622 37 8,213775689 kb9,2 k39  182
dez 20044   23 10,718673580 kb7,8 k38  42
nov 20044   21 1019933669 kb7,7 k34  42
out 2004411 21 8,318994458 kb7,3 k34  42
set 2004323 13 10,114859234 kb3,2 k12  22
ago 20041   3 13168216,0 kb658   2
jul 20041   2 98684,3 kb226   2
jun 20041       74,0 kb     2
mai 200411      32,1 kb     1
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
The following table ranks this project in relation to projects in other languages with 1000+ articles
abr 201311111134111221113
jan 201311111434211221113
out 201211111234111221113
jul 201211111134211221113
abr 201211111134111221113
jan 201211111134111231113
out 201111111134111221113
jul 201111111135111221113
abr 201112111134111221113
jan 201111121123211221113
out 201011111123111231113
jul 201011121223111221113
abr 201011111122111121113
jan 201011131222111121113
out 200911121122111141113
jul 200911111122111141113
abr 200911121212111141113
jan 200911111111111141113
out 200811111111111131113
jul 200811111111111131113
abr 200811111111111151113
jan 200811111111111161113
out 200711111111111151111
jul 200712221211211141110
abr 20071111111111117119
jan 20071111111111116119
out 20061111111111116119
jul 20062411111111124219
abr 20062111111111124119
jan 20062121111111123119
out 20052411111111122128
jul 20052111111112227118
abr 20052221211122226347
jan 20052221211123334337
out 20042231211122223226
jul 20042321211123642236
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100ediçõesbytes
 ContributorsArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Contributors (usuários registrados)
A = Contributors que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de contributors que editaram pelo menos dez vezes desde que chegaram
C = Contributors que contribuíram cinco vezes ou mais este mês
D = Contributors que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  5  10  100  1000  1  3  5  10  25  100  250  1000  2500  5  10  100  1  3  5  10  25  100  250  1000  5  10  100  1000 
mai 2013                                  
abr 2013221154121912983 1   611911531      1961048360323  33  
mar 2013206119957336124 1   461613832      236129102835381 33  
fev 2013229151122803682 1   7225191071      227145126105695  44  
jan 201313079543922111 21  662414821   11 160775130131  54  
dez 201216611185622243 2   81311684       2131229564345  441 
nov 201218411096623452 11  10640311331      235133119103645  32  
out 2012224151127943862 21  111593825311  11 27017615212374121 441 
set 2012245163127823382 22  10658362393   11 2871781531186112  54  
ago 20121235745331742 22  71211352    11 1686544321121 43  
jul 2012975040251252 21  56181463    11 1204435191342143  
jun 20121013827221682 22  65211271    21 1384835231431 52  
mai 20121479075582953 22  742311411   11 19810288562843144  
abr 20121971331128644163 1   12454421651   11 262132997245101 44  
mar 20122271621461145793 2   13261401531   11 27013210484506  551 
fev 20122771861511003763     1264431146    11 3492301941517191 441 
jan 201219011299652782 11  92331610311  1  31117514511373171 65  
dez 20111558265431851 1   12152331172      2341068349243  4311
nov 201126719516513890275 1   20513295541551  21 34421218515892173 54  
out 201122415613310860102 33  18511387541562  11 30519516213993286 53  
set 2011240146112803981 11  1767451271231  2  39225321714976194 54  
ago 20111737751301631     7727177321     2307858331731 42  
jul 20111235841282041 31  692717962      1716441312261 53  
jun 20111125140261232 2   9929201154   1  2558255321761 33  
mai 20111679375553163 11  832714971      30015410044215  33  
abr 2011205124104763681 11  7123181361   1  3461321017853131 44  
mar 20112461671329854132 221 1144933231131     40121816010463151 43  
fev 20112601741491136172 11  1657550291662  21 42524718812173242 32  
jan 201122213197562651     163583919932     42921917211261133 42  
abr 2013221154121912983 1   611911531      1961048360323  33  
jan 201313079543922111 21  662414821   11 160775130131  54  
out 2012224151127943862 21  111593825311  11 27017615212374121 441 
jul 2012975040251252 21  56181463    11 1204435191342143  
abr 20121971331128644163 1   12454421651   11 262132997245101 44  
jan 201219011299652782 11  92331610311  1  31117514511373171 65  
out 201122415613310860102 33  18511387541562  11 30519516213993286 53  
jul 20111235841282041 31  692717962      1716441312261 53  
abr 2011205124104763681 11  7123181361   1  3461321017853131 44  
jan 201122213197562651     163583919932     42921917211261133 42  
out 2010243137108683551 1   15864371881   11 35916911371347  32  
jul 2010155765735122  11  96332317124   11 2428355321481 43  
abr 20101397866573161 1   144704421102   11 295143105732781 53  
jan 20101456346291321 111 1285130177    111395186127622552 551 
out 20091778567401731     1376239197    221512227130592771 33  
jul 20091365037251431 222 109372817112      3541488232168  321 
abr 2009191988157291  11  953518112       3641407337144  55  
jan 20091517964452092 21  124563823134      38917911258247  331 
out 20081589066421952 321 1487252261981  111532312250200128266 321 
jul 200813272573215741    114523522154   11 3149856311574 33  
abr 200825017215012482165 221 1114329171352  311302126925427125 441 
jan 20081667661442172 11  119493022154   11 32612785532375 431 
out 2007201121106803092222  1044129171131  1  28710066442483 431 
jul 20071588058331531     11241301592      32111258271451 11  
abr 20071709785583782 11  136624325145   1  35414083532192 32  
jan 2007196106795526521    15360402610431111 34113389512842111  
out 200617011075512352 1   133583423144      368168100522591 2   
jul 2006308632      17851        1354228103       
abr 2006291715821      153          1103928154       
jan 2006269431      17621        95271591       
out 20052084211      6321        56121052       
jul 2005321410841      81          71251481       
abr 2005197421      81          932719102       
jan 200552221      7211        48231131       
out 20043111       42          5316931       
jul 2004          1           41139411      

 

Distribuição de edições de artigos por contributors
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=ContributorsEdições total
18,151100.0%316,777100.0%
33,93148.2%310,29498.0%
102,52831.0%302,06995.4%
321,36016.7%281,02488.7%
1005166.3%233,86473.8%
3161271.6%169,15553.4%
1000340.4%120,56138.1%
3162120.1%81,17825.6%
1000020.0%37,38611.8%

 

50 contributors recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions
agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
JtneillUC1 025,10652613,09789mar 06, 200818801,08015--
MarshallsumterUC3 07,4524332,08770ago 24, 20116142089--
Nobody60UC8 04,018691955mar 24, 2011767412--
LeighblackallUC9 04,0141582,66142set 27, 200527711754--
FastenUC11 03,453361,498-fev 14, 200722661852--
LeuthaUC14 02,692252,74428ago 08, 20109951261--
LbeaumontUC15 02,636741717fev 09, 2011810941--
Dave BraunschweigUC16+12,48527957919out 24, 201218710915--
HAPE3512UC17+22,45737924-mar 20, 20124055613--
1sfoersterUC24 01,6941054,216137ago 19, 20116192141--
Young1limUC27+21,348761,37190jun 18, 20081776321--
Mate2codeUC35 097611,0967mai 29, 2010106634---
DrofletUC40+58718749927fev 29, 20124251172--
ErtuncUC48+177520165-out 07, 2010935113--
Sidelight12UC52 071734471out 01, 2012210311--
HaplologyUC57 06563430-jan 18, 201183290---
GlimmerguardUC63+11558561464fev 01, 201387181--
Charles Jeffrey DanoffUC75+150013695fev 22, 2010116262---
James500UC86+334411021042nov 11, 201153583--
GustableUC109-13662576-ago 26, 2007207325---
Candyangel43UC110+33611154-fev 10, 200819055---
AlsirajmamunUC122+113343411518dez 26, 2012124----
Lucy346UC179+172361211-out 20, 201219110---
SiefmanUC198+22224184-jan 27, 20139241--
JbeyerlUC206+52165841jan 01, 20131189---
BrylieUC317+14153434915ago 06, 200720935---
Nick8juneUC322+12153415-dez 14, 201213611---
Eml4507.s13.team3.bucklesUC351+871442729634fev 06, 201382----
Eml4507.s13.team7.gidelUC382+4213413406fev 05, 2013833---
Egm3520.s12.team5.lindsayUC405+131264285fev 06, 201382----
BobmathUC437+2291184321set 14, 201159321--
Eml4507.s13.team3.steinerUC447+72115178915fev 06, 20138262--
JaclynsquizzatoUC483+53108131-mar 14, 20134639---
Bron766UC496...10510566abr 21, 201381111--
JorisvSUC509+5410211786mai 30, 20117007---
MathoniusUC512+1210142587jul 06, 2011663----
DavidMCEddyUC525+709812283fev 19, 20136951--
GlennHomburgUC552+739413218fev 25, 20124291---
Egm4507.s13.team07.plicqueUC619+1063836143fev 20, 201368----
EML4507.s13.team4ever.BonnerUC640+1467915422fev 19, 2013692---
Egm3520.s13.team5.moffattUC648+3087827--jan 29, 201390----
EML4507.s13.team4ever.TobinUC671+4307533221jan 30, 2013895---
CpierceUC680+1377413--jan 16, 2013103----
Egm3520.s13.JeandonaUC681+2767423201jan 30, 201389----
ShortmanphilUC742+6681--jan 29, 201390----
RmjelleyUC756+125671117-fev 12, 2013762---
Lww11UC855+24582--jan 22, 201397----
Cjr100BUC866+76957343-mar 04, 201178732--
Egm3520.s13.galatesUC869+115712-jan 29, 201390----
NilsjanssensUC933+875365-fev 13, 2013751---

 

20 contributors recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
SB JohnnyUC212,280ago 17, 20062447mai 28, 2011702
Robert ElliottUC44,732set 23, 20062410jun 18, 20081776
JWSchmidtUC54,512ago 17, 20052812abr 16, 2011744
Mike's bot accountUC64,504set 26, 20072042nov 19, 20081622
RemiUC74,195mai 06, 20072185out 17, 20081655
JomegatUC103,580mar 21, 20072231fev 17, 2012437
Erkan YilmazUC123,332nov 27, 20062345out 09, 2012202
GmastermanUC132,860jun 04, 20091425ago 20, 2011618
PCanoUC182,363dez 11, 2010870out 15, 2011562
McCormackUC192,140abr 22, 20072199set 11, 20081691
KYParkUC201,985jun 12, 20101052dez 08, 2012142
Recovery PsychologyUC211,912jan 06, 20081940mai 22, 20101073
EmeseeUC221,896mar 31, 20081855jan 10, 20091570
Mu301UC231,794dez 01, 20062341out 30, 2012181
Remi0oUC251,566dez 11, 20062331jun 21, 20081773
PlanotseUC261,387jul 02, 2012301set 29, 2012212
WikiresourcesUC281,293out 31, 20091276jul 17, 20101017
Open ResearchUC291,277jun 14, 20072146mai 12, 20091448
John BessaUC301,207jul 24, 20081740out 23, 2011554
AbdUC311,163out 25, 20091282nov 21, 2011525

 

usuários anônimos, ordenados por número de contribuições
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
97.77.103.50740
Egm6341.s10.team2.niki696
204.126.132.241601
Egm_3520.s13.team1.wcs587
193.191.9.29453
108.49.1.139395
128.130.60.129391
137.92.97.114370
192.133.12.123349
155.232.128.10347

No total 65.421 edições foram feitas por usuários anônimos, de um total de 397.498 edições ( 16e %)
  


23 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
Crochet.david.botUC15,928ago 10, 20072089fev 28, 201360--
Mu301BotUC21,197ago 31, 20091337mar 31, 2011760--
CommonsDelinkerUC3891abr 30, 20072191abr 30, 2013---
AdambroBotUC4507jul 03, 20091396mar 22, 20101134--
タチコマ robotUC5187out 01, 2012210out 01, 2012210--
JackBotUC6173nov 12, 2010899set 15, 2012226--
ArthurBotUC776jan 01, 20091579dez 01, 20091245--
ArchiveBotUC860out 08, 20081664mai 25, 20117054-
RussBotUC936abr 22, 20091468abr 22, 20091468--
VolkovBotUC1036mai 14, 20091446mar 15, 201345--
AvocatoBotUC1129out 22, 2011555mai 10, 2012354--
Aiman titiBotUC1219jul 13, 2011656jul 13, 2011656--
DinybotUC1311mar 27, 20072225mar 27, 20072225--
SmackBotUC149jan 31, 20081915fev 19, 20091530--
MetalrobotUC158ago 19, 20062445out 22, 200623812-
MerlLinkBotUC168out 12, 20091295fev 04, 2011815--
JAnDbotUC172dez 18, 20081593dez 18, 20081593--
AlexbotUC182jun 12, 20091417jun 12, 20091417--
YobotUC192set 03, 2010969dez 28, 2010853--
MichaelFreyToolUC201jan 27, 20081919jan 27, 20081919--
BamboobotUC211abr 10, 20091480abr 10, 20091480--
FrescoBotUC221abr 26, 20101099abr 26, 20101099--
EdwardsBotUC231abr 09, 201320abr 09, 20132011

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110DjvuGifJpgMidOggOgvPdfPngSvgSxwTifTiffXcf
abr 201330 k18 k1,8 k15 k1816,4 k2496,2 k7403,0 k2,8 k11  42373807186,3 k16465462,2 k4,2 k563112424
mar 201330 k18 k1,8 k15 k1816,4 k2496,1 k7403,0 k2,8 k11  50833796886,2 k16465462,1 k4,2 k552112224
fev 201329 k18 k1,8 k14 k1806,3 k2496,1 k7403,0 k2,8 k11  49843746356,1 k16465431,9 k4,1 k545112224
jan 201329 k18 k1,8 k14 k1796,3 k2496,1 k7393,0 k2,8 k11  33273716336,1 k16465431,8 k4,0 k519112224
dez 201229 k17 k1,8 k14 k1776,3 k2496,1 k7393,0 k2,8 k10  41863616306,0 k16465431,8 k4,0 k517112224
nov 201228 k17 k1,8 k14 k1766,3 k2496,0 k7393,0 k2,8 k10  41283616295,9 k16465431,7 k4,0 k514112224
out 201228 k17 k1,8 k13 k1766,3 k2485,9 k7382,9 k2,8 k10  45493526235,7 k16465431,7 k3,9 k51311223
set 201228 k17 k1,8 k13 k1766,3 k2485,9 k7372,9 k2,8 k9  48373426175,6 k16465431,6 k3,8 k51311223
ago 201227 k16 k1,8 k13 k1766,2 k2485,9 k6942,9 k2,7 k8  25963166155,6 k16465431,5 k3,8 k51311223
jul 201227 k16 k1,8 k13 k1766,2 k2235,9 k6182,9 k2,7 k8  30873126155,6 k16465431,5 k3,8 k51111223
jun 201227 k16 k1,8 k13 k1766,0 k2115,8 k5792,9 k2,7 k8  27993126145,6 k16465431,4 k3,8 k48911223
mai 201226 k16 k1,8 k13 k1766,0 k2115,8 k5782,9 k2,7 k7  38483126145,5 k16465431,3 k3,8 k48911223
abr 201226 k16 k1,8 k12 k1764,2 k2115,7 k5782,9 k2,7 k7  57903126125,4 k16465431,3 k3,8 k48611223
mar 201226 k16 k1,8 k12 k1724,2 k2115,7 k5782,9 k2,6 k7  54423066045,3 k16465431,2 k3,7 k48511223
fev 201226 k16 k1,8 k12 k1724,2 k2115,7 k5782,9 k2,6 k7  47892966035,1 k16465431,1 k3,6 k48511223
jan 201225 k15 k1,7 k11 k1614,1 k2115,7 k5702,9 k2,6 k6  33642836004,9 k16465431,0 k3,4 k48211223
dez 201125 k15 k1,7 k11 k1394,1 k2085,6 k5672,9 k2,6 k6  25212715994,8 k16465431,0 k3,3 k46911223
nov 201125 k15 k1,7 k11 k1394,1 k2085,6 k5652,9 k2,6 k5  108582715994,8 k16465439953,3 k46311223
out 201124 k15 k1,7 k11 k1393,9 k2075,6 k5642,9 k2,6 k4  60622625954,6 k16458379403,3 k44011223
set 201124 k14 k1,7 k11 k1383,8 k2075,5 k5642,9 k2,6 k4  44482505894,6 k16457308903,3 k41311223
ago 201124 k14 k1,7 k10 k1313,8 k2075,5 k5642,9 k2,6 k4  20872355754,5 k16457308623,3 k38811223
jul 201123 k13 k1,7 k10 k1303,8 k2075,4 k5592,9 k2,6 k4  23362315754,5 k16455308143,3 k35611223
jun 201123 k13 k1,7 k10 k1303,7 k2075,4 k5592,9 k2,6 k4  19312305754,5 k16455307783,2 k32511223
mai 201123 k13 k1,7 k10 k1303,6 k2045,4 k5582,9 k2,6 k4  35952275754,5 k16455297623,2 k29511223
abr 201122 k13 k1,7 k9,8 k1303,6 k2035,3 k5572,9 k2,6 k4  43522265724,4 k16454296953,2 k23411223
mar 201122 k13 k1,7 k9,1 k1293,5 k2035,2 k5562,9 k2,6 k4  62112195634,1 k16454276742,9 k23211223
fev 201121 k12 k1,6 k8,2 k1263,5 k2035,2 k5562,9 k2,5 k4  59021945103,7 k16453275802,5 k21813 2
jan 201121 k12 k1,6 k7,8 k1263,5 k2035,2 k5562,9 k2,5 k2  37141715013,5 k16453275552,4 k21312 2
dez 201021 k11 k1,6 k7,4 k1183,4 k2035,1 k5562,9 k2,5 k2  43991453023,4 k16453275332,3 k19412 2
nov 201020 k11 k1,6 k7,3 k1183,4 k2015,1 k5532,9 k2,5 k2  81221422593,4 k16451275222,3 k18911 2
out 201020 k11 k1,6 k7,2 k1153,4 k2015,1 k5512,9 k2,5 k2  41111322593,3 k16451275172,3 k18911 2
set 201019 k11 k1,5 k7,0 k1113,3 k2005,1 k5502,9 k2,5 k1  3439952573,3 k16451275102,2 k1891  2
ago 201019 k11 k1,5 k7,0 k1113,3 k1995,0 k5502,9 k2,5 k1  3222772533,3 k16451275082,2 k1881  2
jul 201019 k10 k1,5 k6,9 k1103,3 k1975,0 k5472,9 k2,5 k1  1868632533,3 k16451275042,2 k1501  2
jun 201018 k10 k1,5 k6,8 k1083,3 k1965,0 k5452,9 k2,5 k   2232632493,3 k16450275002,1 k1421  2
mai 201018 k10 k1,4 k6,8 k1073,2 k1965,0 k5452,9 k2,5 k   2613612493,2 k16443274972,1 k1281  2
abr 201018 k10 k1,4 k6,8 k1073,2 k1965,0 k5452,9 k2,5 k   3610612493,2 k16443274882,1 k1281  2
mar 201018 k9,8 k1,4 k6,5 k1053,2 k1934,9 k5452,9 k2,4 k   3671552473,1 k16441114722,1 k1281  2
fev 201017 k9,7 k1,3 k6,5 k1013,2 k1934,8 k5452,8 k2,4 k   3815442463,1 k16440114632,1 k1271  2
jan 201017 k9,5 k1,3 k6,4 k983,2 k1934,8 k5442,8 k2,4 k   186622433,0 k16439114572,1 k1271  2
dez 200917 k9,1 k1,3 k6,3 k983,2 k1934,8 k5432,8 k2,4 k   192722413,0 k1642234242,0 k1271  2
nov 200917 k9,0 k1,2 k6,2 k983,2 k1934,8 k5432,8 k2,4 k   302122413,0 k16422 4192,0 k1271  2
out 200917 k8,8 k1,2 k6,2 k983,1 k1894,8 k5412,8 k2,4 k   264722403,0 k16422 4062,0 k1261  2
set 200917 k8,4 k1,2 k6,1 k983,1 k1844,7 k5412,8 k2,4 k   367322403,0 k16422 3882,0 k1241  2
ago 200916 k8,1 k1,1 k6,1 k983,1 k1824,7 k5342,7 k2,4 k   264122403,0 k16422 3772,0 k1191  2
jul 200916 k7,9 k1,1 k6,1 k973,1 k1814,6 k5282,7 k2,3 k   205922383,0 k16422 3742,0 k1191  2
jun 200916 k7,6 k1,1 k6,1 k943,0 k1814,6 k5262,7 k2,3 k   159922383,0 k16422 3702,0 k1191  2
mai 200915 k7,5 k1,1 k6,1 k933,0 k1804,6 k5232,7 k2,3 k   184522383,0 k16422 3702,0 k1191  2
abr 200915 k7,3 k1,1 k6,0 k923,0 k1704,5 k5092,7 k2,3 k   346322342,9 k16422 3651,9 k1191  2
mar 200915 k7,0 k1,1 k5,9 k903,0 k1704,5 k5072,7 k2,3 k   193122272,9 k16421 3471,9 k1171  2
fev 200915 k6,9 k1,1 k5,9 k903,0 k1674,5 k5072,1 k2,3 k   329222272,9 k16412 3351,9 k1131  2
jan 200915 k6,7 k1,1 k5,9 k902,9 k1654,4 k5061,3 k2,3 k   347622262,9 k16412 3201,9 k1111  2
dez 200814 k6,4 k1,1 k5,8 k862,9 k1644,3 k5051,2 k2,2 k   309222262,9 k16411 3001,9 k1101  1
nov 200814 k6,1 k1,1 k5,5 k862,8 k1624,3 k4919292,2 k   400722072,6 k16411 2861,8 k1021  1
out 200814 k5,7 k1,1 k4,8 k782,8 k1584,3 k4899202,1 k   400421752,1 k16409 2691,7 k761  1
set 200813 k5,1 k1,0 k4,2 k742,7 k1574,2 k4689142,1 k   450921671,7 k16405 2371,6 k521  1
ago 200813 k4,4 k9593,8 k722,6 k1514,1 k4199062,0 k   532921511,3 k16400 2021,6 k521  1
jul 200812 k4,2 k9123,7 k712,5 k1494,0 k4148952,0 k   448421481,3 k16387 2001,6 k511  1
jun 200812 k3,9 k8943,7 k702,5 k1443,9 k4078872,0 k   531421481,3 k16386 2001,6 k511  1
mai 200811 k3,8 k8733,7 k692,4 k1043,6 k4008821,9 k   604321481,3 k16384 1901,6 k511  1
abr 200811 k3,6 k8563,6 k682,2 k922,6 k3868441,8 k   1127721481,3 k16372 1881,6 k481  1
mar 20089,8 k3,5 k8243,3 k652,1 k602,3 k3637981,7 k   665321471,1 k16368 1641,5 k481  1
fev 20089,1 k3,3 k7863,2 k641,9 k582,2 k3427651,6 k   2723214499316341 1541,5 k241   
jan 20088,6 k3,1 k7763,1 k641,9 k562,1 k3386961,5 k   4266213395416329 1451,5 k241   
dez 20078,1 k2,9 k7543,0 k621,8 k561,9 k3196491,4 k   2887212989416317 1431,4 k241   
nov 20077,8 k2,8 k7472,8 k501,7 k541,8 k3196401,4 k   4144212982816287 1311,4 k241   
out 20077,4 k2,7 k7422,7 k501,7 k541,8 k3176191,4 k   6257211780116269 1211,4 k211   
set 20076,6 k2,5 k7372,5 k501,6 k541,5 k2895101,3 k   5341211474716259 1051,3 k181   
ago 20075,8 k2,4 k7252,4 k461,5 k531,4 k2865101,2 k   4185211373616194 971,2 k161   
jul 20075,0 k2,2 k6791,9 k451,4 k511,3 k2815081,1 k   2824210865316151 73917161   
jun 20074,5 k2,0 k6741,7 k441,4 k471,3 k2654891,0 k   2848210263416117 58791161   
mai 20074,1 k1,9 k6621,6 k431,2 k451,2 k259486973   36112606141483 5275191   
abr 20073,7 k1,7 k5621,4 k371,1 k42936255469919   4329257597 64 4467291   
mar 20073,3 k1,5 k5481,3 k3797438799248465801   3641245524 59 3857481   
fev 20073,0 k1,3 k5381,0 k3591134779236464712   3366243459 57 2545381   
jan 20072,6 k1,1 k5127193257732684228437637   4350235369 23 2126081   
dez 20062,2 k922446515324852848219150530   3458 18340 8 1712561   
nov 20061,8 k772414394313932544717850462   2790 14265 4 149061   
out 20061,5 k629378198313302037117347384   3402 12107 4 66441   
set 20061,1 k44433171312741830114942269   1822 512 3 2463    
ago 200682725027620312081620513239174   2014 23   2121    
jul 200658815013831421532457   251      1      
jun 200657414913771420512353   258      1      
mai 2006555131 3731420441951   330             
abr 2006539131 3631420421951   348             
mar 2006513130 3561419411949   284             
fev 2006460127 3511419341748   403             
jan 2006401123 3491418311748   213             
dez 2005363123 3461418301747   326             
nov 2005309120 3441418271630   194             
out 2005296114 341718241628   197             
set 2005275113 338717221627   123             
ago 2005251113 335717211627   239             
jul 2005207112 332715211627   471             
jun 2005147112 330715181625   232             
mai 2005110112 328714171624   59             
abr 200588112 327713161622   105             
mar 200572112 321713141220   50             
fev 200561112 319713141016   66             
jan 200554110 377 13912                 
dez 200446110 377 11912                 
nov 200443110 367 1099                 
out 200438110 367 1099                 
set 200425110 367 886                 
ago 20048110 366 774                 
jul 2004418 346 461                 
jun 2004218 315 34                  
mai 2004117 214  2                  

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
Sometimes an article has been renamed repeatedly. For this reason the English Wikipedia article 'October 2003' features as article with most editors for many months.

x y z    ⇐    x = rank, y = contributors in that month, z = article title

mai 2004: 1 2 Wikiversity-Translation practice course

jun 2004: 1 1 Teaching Assistant in France Survival Guide/Directory

jul 2004: 1 1 Teaching Assistant in France Survival Guide/Directory

ago 2004: 1 2 Wikiversity-Translation practice course , 2 1 General assistance with mathematics

set 2004: 1 2 Wiki as a time saver for researchers , 2 2 Operating system

out 2004: 1 1 General assistance with mathematics

nov 2004: 1 3 Wikiversity-Translation practice course , 2 2 General assistance with mathematics

dez 2004: 1 3 Wikiversity-Translation practice course , 2 2 Embedded System Engineering , 3 1 Workplace communication

jan 2005: 1 2 Wikiversity-Translation practice course , 2 2 Mathematics software , 3 1 Workplace Communication/Course Evaluation

fev 2005: 1 3 Wikiversity-Translation practice course , 2 3 Literary studies reading lists , 3 1 Becoming a teacher

mar 2005: 1 3 Wikiversity-Translation practice course , 2 2 Wiki farm

abr 2005: 1 2 Artificial intelligence/prospects , 2 2 Wikiversity-Translation practice course , 3 2 Primary mathematics/Factors and primes , 4 2 Basic economics , 5 2 Motion - Dynamics , 6 2 Rhetoric and Composition I , 7 1 Wiki farm

mai 2005: 1 4 Wikiversity-Translation practice course , 2 2 Basic economics , 3 2 Mathematics software , 4 1 Computer science projects

jun 2005: 1 3 Operating system , 2 3 Philosophy message board/Archive , 3 3 The Great War and Versailles , 4 2 Ten Stupid Things Beginners Do to Mess Up Their Contradance Experience/Not Counting , 5 2 Ten Stupid Things Beginners Do to Mess Up Their Contradance Experience/Getting Too Fancy Too Quickly , 6 2 Wiki farm , 7 2 The Advancement of Tertiary Teaching and Learning/E-Learning , 8 2 The Advancement of Tertiary Teaching and Learning , 9 1 Ten Stupid Things Beginners Do to Mess Up Their Contradance Experience/Waiting to Be Asked

jul 2005: 1 6 The Great War and Versailles , 2 3 Web Design/Useful Applications , 3 3 Web Design/Build a basic web page , 4 2 Fire and emergency management/Rescuing victims of a building collapse , 5 2 Philosophy message board/Archive , 6 2 The Great War and Versailles/Further Reading , 7 2 Philosophy resources , 8 2 Initial questions in philosophy , 9 2 Basic economics , 10 2 Web Design/Using the Internet as a Learning Tool , 11 2 Web Design/Build a small website , 12 2 Web Design/Basic HTML and CSS Tutorial , 13 1 Ten Stupid Things Beginners Do to Mess Up Their Contradance Experience/Expecting Perfection

ago 2005: 1 5 Broken/About , 2 3 Wiki farm , 3 3 Study Group For Relativity , 4 2 Introduction to C programming/EnrollmentPage , 5 2 The Great War and Versailles/Lecture One

set 2005: 1 3 Web Design/CSS challenges , 2 2 Web design , 3 1 Wiki farm

out 2005: 1 3 Wiki farm , 2 2 Introduction to Programming C/Lectures/Variables , 3 2 Introduction to C programming/Lectures/BooleanLogic , 4 2 Introduction to C programming , 5 1 Molecular Biology/Milestones

nov 2005: 1 4 Wiki farm , 2 3 Cell biology , 3 2 Introduction to C programming/Quizes/Variables , 4 2 Transwiki:Wikiversity-School of Computer Science/IntroProgramingCPP , 5 2 Operating system , 6 2 Study Group For Relativity , 7 2 Philosophy message board/Archive , 8 2 Embedded System Engineering , 9 2 Basic economics , 10 2 Christianity/Gospel 101 , 11 2 Fundamentals of Probability, Statistics, Experiments and Data

dez 2005: 1 6 Wiki farm , 2 5 Web design , 3 3 Fire and emergency management/Fire officer IV , 4 2 Jet engine performance , 5 2 Fire and emergency management/Fire officer IV/Inspections and Investigations , 6 2 Fire and emergency management/Fire officer IV/Human Resource Management , 7 1 Wiki as a time saver for researchers

jan 2006: 1 9 Wiki farm , 2 2 Fire and emergency management/Personal Protective Equipment-Labeling and Information , 3 2 Fire and emergency management/Fire service instructor I/Instructional Development , 4 2 Wikiversity-Translation practice course , 5 2 Media literacy/notes , 6 2 Fire and emergency management/About Open Source Learning Project , 7 2 Web Design/CSS challenges , 8 2 List of extinct languages , 9 1 Towards a better India/Major Problems/Corruption

fev 2006: 1 7 Wiki farm , 2 4 Wikiversity-Translation practice course , 3 3 Jet engine performance , 4 3 Transwiki:Wikiversity-School of Fire and Emergency Management/Technical Rescue , 5 3 Fire and emergency management/Hazardous Materials , 6 3 Fire and emergency management/ARFF Driver Operator , 7 3 Fire and emergency management/Current Research Projects , 8 3 Fire and Emergency Management/Technical Rescue , 9 3 Fire and emergency management/Fire officer , 10 3 Fire and emergency management/Fire instructor , 11 3 Fire and emergency management/Fire Inspector , 12 2 Transwiki:Wikiversity-School of Fire and Emergency Management/Unattended Cooking and Teenagers Project Initiative , 13 2 Transwiki:Wikiversity-School of Fire and Emergency Management/Teenager Fire Safety Project Initiative , 14 2 Fire and emergency management/Pumping Apparatus Driver Operator , 15 2 Fire and emergency management/Promotional process , 16 2 Fire and emergency management/Lieutenant Recruitment Process , 17 2 Fire and emergency management/Leadership III: Strategies for Supervisory Success (H805)/Course Instructions , 18 2 Fire and emergency management/Leadership I:Strategies for Company Success (H803)/Running a Meeting , 19 2 Fire and emergency management/Leadership I:Strategies for Company Success (H803)/Decision-Making Styles , 20 2 Fire and emergency management/Health and Safety Policy , 21 2 Fire and emergency management/Hazardous Materials Operations Level/Additional Training Materials , 22 2 Fire and emergency management/Hazardous Materials Operations Level , 23 1 Towards a better India/Major Problems/Terrorism

mar 2006: 1 6 Wiki farm , 2 5 Introduction to political science , 3 5 Very Small Information Systems (Spring 2006) , 4 4 Wikiversity-Translation practice course , 5 4 Political theory , 6 2 Bible, English, King James, Documentary Hypothesis, Deuteronomist source, Secondary Deuteronomist Additions, Blessing of Moses , 7 2 Fire and emergency management/Wildland fire fighter I , 8 2 Transwiki:Wikiversity-School of Fire and Emergency Management/Water Rescue Awareness , 9 2 Fire and emergency management/Public Safety Telecommunicator II , 10 2 Fire and emergency management/Public safety telecommunicator I , 11 2 Fire and emergency management/Public Safety Telecommunicator , 12 2 Fire and emergency management/Fire and Life Safety Educator III , 13 2 Fire and emergency management/Fire service instructor I , 14 2 Fire and emergency management/Fire Inspector II , 15 2 Fire and emergency management/Fire inspector I , 16 2 Fire and emergency management/Fire fighter II

abr 2006: 1 5 Wikiversity-Translation practice course , 2 4 Wiki farm , 3 3 IB History Review Guide , 4 2 IB History Review Guide/Totalitarian Europe , 5 2 IB History Review Guide/The USSR and Stalin , 6 2 Bluetooth enabling JOP , 7 2 Web Design/Web design group learning activities , 8 2 Philosophy of Mathematics/Structure , 9 1 Towards a better India/Major Problems/Communalism

mai 2006: 1 6 Teaching Assistant in France Survival Guide/Directory , 2 5 Introduction to C programming/EnrollmentPage , 3 4 Hexpixel Code , 4 4 Introduction to Philosophy , 5 3 Wiki farm , 6 3 Romance of the Three Kingdoms , 7 2 Transwiki:Wikiversity-Data Structures , 8 2 The Atom , 9 2 Measurement , 10 2 Astronomy outline , 11 2 Cell biology

jun 2006: 1 6 Wiki farm , 2 3 Wikiversity-Translation practice course , 3 3 Fire and emergency management/Fire Investigator/Psychomotor Applications , 4 2 Hexpixel Code , 5 2 Thought-Experimental Principles of Relativity , 6 2 Introduction to political science , 7 2 Wiki 101

jul 2006: 1 3 Introduction to C programming/EnrollmentPage , 2 3 Teaching Assistant in France Survival Guide/Directory , 3 3 Computer Architecture Lab/Summer2006 , 4 2 Towards a better India/Major Problems , 5 2 Wiki farm , 6 2 IB History Review Guide/The USSR and Stalin , 7 2 Speech fundamentals , 8 2 Cob Construction , 9 2 Introduction to political science , 10 2 Computer Architecture Lab , 11 2 Basic computer forensics and security , 12 2 Web Design/Dynamic websites , 13 2 Web Design/CSS challenges , 14 2 Web Design/Build a basic web page , 15 1 Molecular Biology/Milestones

ago 2006: 1 11 Hello, world! , 2 10 Wiki farm , 3 7 College Algebra , 4 7 Physics Bachelor of Science , 5 6 Wikiversity the Movie , 6 6 Introduction to physics/lecture , 7 5 Hitler's Germany , 8 5 Network cabling , 9 5 Introduction to German , 10 4 Astronomy Project , 11 4 Basic thermodynamics , 12 4 English as a second language , 13 4 Engineering Help Desk , 14 4 Saxophone , 15 4 Abnormal psychology , 16 4 Psychology , 17 4 SLS Reading List , 18 4 Financial Accounting , 19 4 Freelance academics , 20 4 Getting a degree , 21 3 Teaching Assistant in France Survival Guide/Directory , 22 3 Measurement , 23 3 Web Design/Accessibility , 24 3 Web Design/XML challenges , 25 3 Web Design/New Structure

set 2006: 1 11 Media literacy , 2 9 Hitler's Germany , 3 7 Wiki farm , 4 7 Chain mail , 5 7 Hello, world! , 6 6 Computer science program , 7 6 Arabic stream , 8 5 Main Page/Concept/2006/August/Content , 9 5 Main Page/Concept/2006/August/Communications and community , 10 5 Wikiversity the Movie/Interviews , 11 5 Introduction to Computer Science , 12 5 Plagiarism , 13 5 Calculus/Limits , 14 5 Wikiversity the Movie , 15 5 Great Debates in Media Literacy , 16 5 Ohm's law , 17 4 IRColloquium , 18 4 Types and variables , 19 4 Hedonic modelling , 20 4 Chain mail/Getting Rings , 21 4 Political science , 22 4 Cell biology , 23 4 Introduction to Real Analysis , 24 3 Initial Questions , 25 3 Organic Chemistry/Stereochemistry

out 2006: 1 11 Computer Architecture Lab/WS2006 , 2 9 Hello, world! , 3 7 Media literacy , 4 6 Introduction to PHP , 5 6 Great Debates in Media Literacy , 6 5 Wiki farm , 7 5 Philosophy message board , 8 4 Computer Architecture Lab/Winter2006/PoettschacherRosenblattlWolf/iMISC , 9 4 Computer Architecture Lab/Winter2006/JeitMossFrühRamb/ThreeMicroDiscussion , 10 4 Free online peer reviewed journals , 11 4 Basic Java Language , 12 4 Fundamentals of Music , 13 4 Hitler's Germany , 14 3 Computer Architecture Lab/Winter2006/PoettschacherRosenblattlWolf/ThreeMicroDiscussion , 15 3 Computer Architecture Lab/Winter2006/LechnerWalterStadlerTrinkl/Workplace , 16 3 Computer Architecture Lab/Winter2006/LechnerWalterStadlerTrinkl/ThreeMicroDiscussion , 17 3 Computer Architecture Lab/FPGA Hello World Example , 18 3 Computer Architecture Lab , 19 3 Quenya lesson 0 , 20 3 Quenya , 21 3 Introduction to Strategic Studies/Nuclear Strategy , 22 3 Policy by other means , 23 3 Seminar in Information Warfare , 24 3 Initial questions in philosophy , 25 3 Introduction to Abstract Algebra/Lecture 1

nov 2006: 1 7 Spanish/Students , 2 6 Football (soccer) , 3 6 Facilitating Online , 4 5 Control Structures and Logical Expressions in VB6 , 5 4 Wiki farm , 6 4 UFO research , 7 4 Introduction to Calculus/Quiz 1 , 8 4 CisLunarFreighter/Introduction to game design and production processes , 9 4 Spanish , 10 4 Networked Learning , 11 4 Introductory Ancient Greek Language/Lesson 1 , 12 4 Introduction to Java , 13 4 Japanese stream , 14 4 Political science , 15 4 Wikiversity translations , 16 4 Wiki , 17 4 Hello, world! , 18 4 Other Free Learning Resources , 19 3 The Special Cubic Formula , 20 3 School of Mathematics Help Desk , 21 3 Japanese numbers , 22 3 Japanese Roman Character Pronunciation Guide , 23 3 Free content , 24 3 Half-life , 25 3 BoomCode

dez 2006: 1 13 Spanish/Students , 2 12 Learning to learn a wiki way , 3 8 Wiki farm , 4 6 One Laptop Per Teacher , 5 5 Convolution , 6 5 Historical Introduction to Philosophy/Arguments for God , 7 5 Historical Introduction to Philosophy/Faith and Reason , 8 5 UFO research , 9 5 Screensaver Project , 10 5 Russian Revolution , 11 4 Learning the basics of French , 12 4 Collaborate and Create In-service , 13 4 C++ , 14 4 Historical Introduction to Philosophy/General Introduction , 15 4 Computer Communications , 16 4 PreClinical Medicine , 17 3 School of Information Technology Registration Center/IT-160 (Fundamentals of Programing) , 18 3 Wikimedia , 19 3 Historical Introduction to Philosophy/Formalism and Deontological Ethics , 20 3 Evolution of the Cytoskeleton , 21 3 Genetics of cancer , 22 3 Introductory Discrete Mathematics for Computer Science , 23 3 Game Maker , 24 3 Nerd project , 25 3 Metacommunity

jan 2007: 1 17 Spanish/Students , 2 10 C++ , 3 9 Hitler's Germany , 4 7 School of Information Technology Registration Center/IT-101 (IT vs CS) , 5 6 Wiki farm , 6 6 Introduction to Arabic/Roster , 7 6 Learning the Basics of French/Lesson:Introducing Yourself/1 , 8 4 Project proposal:global warming/Brainstorming , 9 4 Skype , 10 4 Web Page/Dreamweaver/links , 11 4 Web Page/Flash/Project 1 , 12 4 Variables and Expressions , 13 4 Everyday Japanese phrases , 14 4 WINAPI Programming , 15 4 Toward a theory of corporate governance in China's socialist market economy , 16 4 Boolean algebra , 17 4 Introductory Ancient Greek Language/Review , 18 4 Flow control in C , 19 4 C/Before you start , 20 4 Sunken relief , 21 4 Historical Introduction to Philosophy/Ethics , 22 4 Historical Introduction to Philosophy/Personal Identity , 23 4 Historical Introduction to Philosophy/The Problem of Evil , 24 4 Historical Introduction to Philosophy/General Introduction , 25 4 Important Java classes

fev 2007: 1 29 Spanish/Registration , 2 9 Spanish/Students , 3 8 Wiki farm , 4 5 Affective behaviors , 5 5 Psychomotor behaviors , 6 5 C++ , 7 5 Conic sections , 8 5 Science teaching materials for creationism , 9 4 Historical Introduction to Philosophy/Theories of Mind , 10 4 Historical Introduction to Philosophy/General Introduction , 11 4 Getting started with sound recording , 12 4 Philosophy message board , 13 3 WikiCast , 14 3 Developing Scripts and Case Studies for cisLunarFreighter/Radio Communications/STC/implementation , 15 3 Science and the nonphysical , 16 3 CisLunarFreighter/Scripts and case studies/Radio communications/Space traffic control , 17 3 Fundraising , 18 3 Lunar Boom Town , 19 3 Self Paced Reading Labs , 20 3 Web development tools , 21 3 Word processing challenges , 22 3 Karl Marx , 23 3 Northern Arizona University: Environmental Ethics/Bibliography and Links to Other Resources , 24 3 Learning Java , 25 3 Descartes

mar 2007: 1 25 Spanish/Students , 2 14 Wiki farm , 3 12 Spanish/Registration , 4 9 Teletraffic engineering , 5 7 Action research/AREOL25 , 6 7 C++ , 7 6 Spanish: An Introduction , 8 5 Affective behaviors , 9 5 Japanese I/Vocabulary/Intro , 10 4 Concept Classification, Page 4 , 11 4 Concept Classification, Page 2 , 12 4 Teletraffic engineering/Limited availability , 13 4 Teletraffic engineering/What is Congestion control? , 14 4 Psychomotor behaviors , 15 4 Historical Introduction to Philosophy/Descartes Scratch Page , 16 3 Introduction to Algebra; Introduction to Calculus. , 17 3 Concepts and the Nature of Knowledge , 18 3 Spanish: An Introduction/About Spanish , 19 3 Thumbnail storyboard sheet:SBTDS:Forbe , 20 3 Teletraffic engineering/Blocking , 21 3 Teletraffic engineering/How does Internet telephony traffic differ , 22 3 Dark matter , 23 3 Teletraffic engineering/Teletraffic grading , 24 3 University of Asia Pacific , 25 3 Film School/About

abr 2007: 1 7 Spanish: An Introduction , 2 6 Wiki farm , 3 6 German stream , 4 5 Quiz , 5 5 English Language Reference Desk , 6 5 Legendre differential equation , 7 4 Invariant Tasks: Skill Builder Practice , 8 4 Bloom clock project/Seen Lately (Northern Hemisphere) , 9 4 Spanish/Bilingual Spanish-English Dictionary , 10 4 Introduction to the Psychomotor Behaviors , 11 4 Skill Builder: Invariant Tasks Synthesis , 12 4 Introduction - What is the Affective Domain? , 13 4 Web Design/Embedded CSS Embedded CSS , 14 4 Wikimania 2007 , 15 4 Cognitive behaviors , 16 4 Requested kanji diagrams , 17 4 Japanese I/Vocabulary/Intro , 18 4 Research grant collaboration group , 19 4 Humane Quality , 20 4 Main Page/Concept/2006/August/Communications and community , 21 3 WikiCast , 22 3 Wiki Campus Radio/Users , 23 3 Structural design , 24 3 Wikimania 2007/coordination , 25 3 Least squares/Calculation using Excel

mai 2007: 1 7 German stream , 2 7 Spanish/Students , 3 6 Spanish: An Introduction , 4 5 C++ , 5 4 Wiki farm , 6 4 WikiCast , 7 4 Teaching Assistant in France Survival Guide/Directory , 8 4 Generating dynamic content with MediaWiki , 9 4 Debugging Challenges , 10 4 Introduction to Illustrator , 11 4 Ear training/Perfect pitch , 12 4 Classes and Inheritance , 13 4 Sundance Raphael/poem/Entfesselt , 14 4 Spanish: An Introduction/About Spanish , 15 4 Science and the nonphysical , 16 4 Fundraising , 17 4 Russia , 18 4 Bloom Clock/2007 part one , 19 4 School of Mathematics Help Desk , 20 4 Storyboarding answer b , 21 4 Wiki Campus Radio , 22 4 Test and Quiz , 23 4 Wikiversity the Movie , 24 4 Introduction to German , 25 3 Analog electronics

jun 2007: 1 7 German stream , 2 6 Wikipedia service-learning courses , 3 6 Bloom Clock/Contributors , 4 4 Colonial America , 5 4 Introduction to Wikiversity , 6 4 Bloom Clock/2007 part one , 7 4 C++ , 8 3 Nursing , 9 3 BCP/Rudbeckia laciniata , 10 3 Lecture:Muhammad's Life and his political contributions to the first Islamic State , 11 3 BCP/Alliaria petiolata , 12 3 Quiz , 13 3 Lesson:Mad Max:Creating the sound of fear:GarageBand with Symphony Orchestra , 14 3 Mad Max's - Computer Set Up for Film Scoring , 15 3 Learning to learn a wiki way , 16 3 Web Design/JavaScript Challenges , 17 3 Hitler's Germany , 18 3 Russian Revolution , 19 2 Wiki farm , 20 2 Hexpixel Code , 21 2 Teaching Assistant in France Survival Guide/Directory , 22 2 SSHC-U-LNC: Late Empire and Nationalist China , 23 2 Imperial China , 24 2 SSHC-U-ACH: Ancient China , 25 2 Transmission lines

jul 2007: 1 8 German stream , 2 7 Technical writing Requirements analysis , 3 7 Bloom Clock/2007 part two , 4 6 Wiki farm , 5 6 English Language Reference Desk , 6 6 Bloom Clock/Contributors , 7 5 Photoproject , 8 5 College Algebra , 9 4 Main page project , 10 4 Spanish: An Introduction/About Spanish , 11 4 Spanish: An Introduction , 12 4 C++ , 13 3 The Christian Faith , 14 3 Spanish/Students , 15 3 Technical writing , 16 3 Darwinism as religion , 17 3 Adobe Photoshop , 18 3 Wiki , 19 2 Introduction to Science Journalism , 20 2 BCP/Eupatorium perfoliatum/Logs , 21 2 World War II , 22 2 Bloom Clock/How bloom clocks work , 23 2 BCP/Daucus carota/Logs , 24 2 The allegory of the lookout and post-exposure immunization , 25 2 Informatic Communication Technologies

ago 2007: 1 15 Technical writing , 2 12 Technical writing tools , 3 8 Technical writing Requirements analysis , 4 7 Bloom Clock/2007 part two , 5 7 Spanish/Students , 6 6 Bloom Clock/Contributors , 7 5 Social Entrepreneurship Curriculum , 8 5 BCP/Phlox paniculata , 9 5 C++ , 10 5 College Algebra , 11 4 Wiki farm , 12 4 BCP/Echinacea purpurea/Logs , 13 4 BCP/Linaria vulgaris/Logs , 14 4 Technical writing research , 15 4 Introduction to Art History-- M. Davis , 16 4 Spanish: An Introduction/About Spanish , 17 4 Media literacy , 18 3 Primary mathematics/Probability , 19 3 Primary mathematics/Negative numbers , 20 3 Blender/In Class 2 , 21 3 Types of GUI , 22 3 Introduction to Art History-- M. Davis/Reflections/Mr. Bishop , 23 3 Introduction to Art History-- M. Davis/Reflections/Ms. Davis , 24 3 Introduction to Art History-- M. Davis/Assignments/20 August 2007 , 25 3 Introduction to Art History-- M. Davis/Reflections/Yeshwanth

set 2007: 1 43 Introduction to Computers/Processor , 2 42 Introduction to Computers/Peripherals , 3 32 Introduction to Computers/System software , 4 24 Introduction to Computers/Introduction , 5 8 Bloom Clock , 6 7 Wiki farm , 7 6 Bloom Clock/2007 part two , 8 6 C++ , 9 6 Technical writing , 10 6 Media literacy , 11 5 Intellectual Traditions in Media Literacy , 12 4 Making sense of quantum mechanics , 13 4 Cow eye dissection , 14 4 The neurodiversity movement , 15 4 BCP/Asclepias curassavica/Logs , 16 4 Nonlinear finite elements , 17 4 BCP/Oxalis stricta/Logs , 18 4 BCP/Trifolium repens/Logs , 19 4 BCP/Daucus carota/Logs , 20 4 BCP/Impatiens capensis/Logs , 21 4 BCP/Securigera varia/Logs , 22 4 BCP/Galium aristatum , 23 4 BCP/Hemerocallis fulva , 24 4 Lecture: Ibn Khaldun , 25 4 Economic Classroom Experiments

out 2007: 1 36 Introduction to Computers/Application software , 2 36 Introduction to Computers/Personal , 3 35 Introduction to Computers/Security , 4 33 Introduction to Computers/Networks , 5 32 Introduction to Computers/Internet , 6 8 Computer Architecture Lab/WS2007 , 7 8 Bloom Clock/2007 part two , 8 7 Wiki farm , 9 6 The Crafting Freedom Project , 10 5 BCP/Trifolium pratense , 11 5 BCP/Trifolium repens , 12 5 BCP/Linaria vulgaris , 13 5 BCP/Oxalis stricta , 14 4 BCP/Rosa , 15 4 Harvard chart method , 16 4 Technical writing specification , 17 4 BCP/Aster divaricatus , 18 4 BCP/Solidago canadensis/Logs , 19 4 BCP/Solidago canadensis , 20 4 BCP/Oxalis stricta/Logs , 21 4 BCP/Linaria vulgaris/Logs , 22 4 BCP/Daucus carota , 23 4 BCP/Achillea millefolium , 24 4 BCP/Securigera varia , 25 4 BCP/Erigeron annuus

nov 2007: 1 34 Introduction to Computers/AI , 2 33 Introduction to Computers/Databases , 3 32 Introduction to Computers/Development , 4 22 Introduction to Computers/Personal , 5 9 Wiki farm , 6 7 Learning theories in practice/Project-Based Language Learning , 7 7 Learning theories in practice/Content-Based Learning , 8 7 Ivan Illich: Deschooling Society , 9 7 Computer Architecture Lab/WS2007 , 10 6 Learning theories in practice/Picture books , 11 6 Learning theories in practice , 12 6 Reading the Linux Kernel Sources , 13 6 Introduction to Computers/Security , 14 5 Learning theories in practice/WebQuests as Second Language contexts , 15 5 Learning theories in practice/Task-Based Learning , 16 5 Learning theories in practice/Self-Regulated Learning , 17 5 Learning theories in practice/Multiple Intelligences , 18 5 Learning theories in practice/Motivation , 19 5 Learning theories in practice/Language learning , 20 4 BCP/Nepeta x faassenii , 21 4 Bloom Clock/2007 part two , 22 3 Learning theories in practice/Integrative , 23 3 Learning theories in practice/Constructivism , 24 3 Learning theories in practice/Content-Based Instruction , 25 3 World War I

dez 2007: 1 11 Wiki farm , 2 6 Wikipedia arbitration committee/Pedophilia userbox wheel war , 3 6 Wikipedia arbitration committee , 4 5 Learning theories in practice , 5 5 Participant of the composing free and open online educational resources course , 6 4 Main page learning project/QOTD , 7 4 Fairy Rings , 8 4 Composing free and open online educational resources , 9 4 Bloom Clock/Unknown Plants , 10 4 Learning to learn a wiki way , 11 3 Lunarpedia , 12 3 Museum photography , 13 3 Main page learning project , 14 3 Stanford Open Source Lab , 15 3 Holidays of Hope , 16 3 Ivan Illich: Deschooling Society , 17 3 The Crafting Freedom Project , 18 3 Smoking cessation , 19 3 Technical writing tools , 20 3 BCP/Taraxacum officinale/Logs , 21 3 Life of Alexander , 22 3 Lunar Boom Town , 23 3 Skype , 24 3 C++ , 25 2 The Practice of Learning Theories/How can we end the POLT?

jan 2008: 1 21 Introduction to Computers/Peripherals , 2 19 Introduction to Computers/Introduction , 3 17 Introduction to Computers/System software , 4 16 Introduction to Computers/Processor , 5 13 Vital Ideation , 6 11 Participant of the composing free and open online educational resources course , 7 6 Wiki farm , 8 6 Future media class/Media Fads Versus Paradigm Shifts , 9 5 Main page learning project/QOTD , 10 4 Biogeochemical Selectiveness of Cedars Over Metamorphic Rocks of the Escambray Complex, Sancti Spíritus, Cuba/Vegetation , 11 4 Future media class , 12 4 Museum photography , 13 4 Main page learning project , 14 4 Venus , 15 4 C++ , 16 3 Biogeochemical Selectiveness of Cedars Over Metamorphic Rocks of the Escambray Complex, Sancti Spíritus, Cuba/Study Area , 17 3 Biogeochemical Selectiveness of Cedars Over Metamorphic Rocks of the Escambray Complex, Sancti Spíritus, Cuba/Introduction , 18 3 Biogeochemical Selectiveness of Cedars Over Metamorphic Rocks of the Escambray Complex, Sancti Spíritus, Cuba , 19 3 Future media class/Media Convergence , 20 3 Future media class/Emerging Technologies: Preparing For The Next Job Market , 21 3 Future media class/Virtual Experiences: Now More Like Our Real World , 22 3 Augustine of Hippo/Introduction to Augustine of Hippo/Augustine's Spiritual Journey , 23 3 Augustine of Hippo/Augustine's Theory of Knowledge , 24 3 Recovery psychology/Lesson3 , 25 3 Recovery psychology/Sociological

fev 2008: 1 36 Participant of the composing free and open online educational resources course , 2 18 Introduction to Computers/Application software , 3 17 Introduction to Computers/Networks , 4 15 Introduction to Computers/Personal , 5 5 Wiki farm , 6 5 World History , 7 5 Composing free and open online educational resources , 8 4 Agile software development , 9 4 Wikiversity learning model/Discussion group , 10 4 Main page learning project/QOTD , 11 4 Thucydides: The Peloponnesian War , 12 3 Wittgenstein reading group , 13 3 TEFL-TESOL , 14 3 Third Law of Thermodynamics , 15 3 Radio Discussion/Living on Earth/2008.1.18/Segment 4 , 16 3 Radio Discussion/Living on Earth/2008.1.18 , 17 3 Principles of Electricity , 18 3 Breton stream , 19 3 Spanish/Spanish One , 20 2 Learning theories in practice/Imaginary snapshots , 21 2 Biology 11 , 22 2 FOSSlike collaboration in schools/Resources , 23 2 FLOSS and education , 24 2 Biology 12 , 25 2 Introduction to Topology/Lesson 2

mar 2008: 1 15 Introduction to Computers/Security , 2 14 Introduction to Computers/Databases , 3 14 Introduction to Computers/Internet , 4 12 Participant of the composing free and open online educational resources course , 5 11 Introduction to Computers/Development , 6 7 Wiki farm , 7 7 Learning the basics of French/Participants , 8 6 Open educational resources and globalization , 9 6 Composing free and open online educational resources , 10 5 DFE2008 Office Chair Foam , 11 5 Education and collaboration , 12 5 BCP/Crocus/Logs , 13 5 Bloom Clock/Master List , 14 5 Thucydides: The Peloponnesian War , 15 5 BCP/Stellaria media/Logs , 16 5 Bloom Clock/Unknown Plants , 17 5 Bloom Clock/Contributors , 18 4 Workshop for Australian education policy , 19 4 Composing free and open online educational resources/Participants , 20 4 Introduction to Futures Studies , 21 4 Creating a Development Environment , 22 4 FLOSS and education , 23 4 BCP/Lamium purpureum/Logs , 24 4 BCP/Galanthus nivalis/Logs , 25 4 BCP/Forsythia x intermedia

abr 2008: 1 37 Design for the Environment , 2 16 Introduction to Computers/AI , 3 9 Wiki farm , 4 9 BCP/Forsythia x intermedia/Logs , 5 8 Writing discipline specific research papers , 6 8 BCP/Taraxacum officinale/Logs , 7 7 Introduction to Computers/Personal , 8 6 DFE2008 Metal Cleaning , 9 6 DFE2008 Bus Fuel Alternatives , 10 6 DFE2008 Oil Sands Extraction Technique , 11 6 DFE2008 Disposable Water Bottle , 12 6 DFE2008 Internal Combustion Engines , 13 6 DFE2008 Power Generation , 14 6 DFE2008 Grocery Bags , 15 6 DFE2008 Residential Roofing Materials , 16 6 Content Prioritization , 17 6 BCP/Narcissus/Logs , 18 6 BCP/Lamium purpureum/Logs , 19 6 BCP/Forsythia x intermedia , 20 6 BCP/Taraxacum officinale , 21 5 DFE2008 Residential Micro Cogeneration , 22 5 DFE2008 Power Generation Alternatives for Off-Grid Homes , 23 5 DFE2008 Residential Insulation , 24 5 DFE2008 Dry Cleaning Detergent , 25 5 DFE2008 Hydrogen Generation Methods

mai 2008: 1 8 Composing free and open online educational resources/Critique and feedback , 2 7 Wiki farm , 3 6 Bloom Clock/Master List , 4 6 Bloom Clock/Unknown Plants , 5 6 BCP/Forsythia x intermedia , 6 6 BCP/Taraxacum officinale , 7 5 Arbitrary Hour , 8 5 BCP/Convallaria majalis , 9 5 BCP/Tulipa , 10 5 BCP/Syringa vulgaris/Logs , 11 5 BCP/Aesculus hippocastanum/Logs , 12 5 BCP/Taraxacum officinale/Logs , 13 5 Bloom Clock/Contributors , 14 4 BCP/Convallaria majalis/Logs , 15 4 Learning the basics of French/Introducing Yourself , 16 4 How to be a Wikimedia sysop , 17 4 BCP/Tulipa/Logs , 18 4 BCP/Rhododendron , 19 4 BCP/Forsythia x intermedia/Logs , 20 4 BCP/Syringa vulgaris , 21 4 BCP/Narcissus , 22 4 BCP/Aesculus hippocastanum , 23 3 IB History Review Guide , 24 3 Swedish definite forms , 25 3 Statistics 103

jun 2008: 1 6 Composing free and open online educational resources/Participants/Next start , 2 6 Arbitrary Hour , 3 6 Circuit Analysis Quiz 1 , 4 5 Open science , 5 5 Collective learning , 6 5 Open educational resources and globalization , 7 5 Bloom Clock/Master List , 8 5 BCP/Iris/Logs , 9 4 Medical School Curriculum , 10 4 How to design programs , 11 4 Chess , 12 4 OpenOffice.org , 13 4 Brain Imaging , 14 4 Composing free and open online educational resources/Participants , 15 4 Bloom Clock/Unknown Plants , 16 4 Anthropomorphic Robotics Project , 17 4 CisLunarFreighter , 18 3 Wiki farm , 19 3 Creating Significant Learning Experiences (Dee Fink) , 20 3 Educative Assessment (Dee Fink) , 21 3 Creating significant learning outcomes (Dee Fink) , 22 3 Motivational interviewing , 23 3 Open science/Related projects , 24 3 List of all the GMAT Sentence Correction Quizes , 25 3 Essays

jul 2008: 1 14 Wikimedia Ethics , 2 8 Wiki farm , 3 7 Wikimedia Ethics/Brainstorming , 4 6 Wikimedia Ethics/Introduction , 5 6 Wikimedia Ethics/Suggested essays , 6 5 Horbury High School , 7 4 Genes to Cognition Project , 8 4 Wikimedia Ethics/Ethics on Wikipedia and the Internet , 9 4 Wikimedia Ethics/Overview , 10 4 Medieval History , 11 4 Composing free and open online educational resources/Participants/Next start , 12 4 Passive sign convention , 13 3 Democracy Project , 14 3 Wikiversity community blog , 15 3 Precipitation detection , 16 3 Optimal classification , 17 3 Lecture 2.0 , 18 3 Spanish 1 , 19 3 Firefox , 20 3 Circuit Analysis Quiz 2 , 21 3 WikiProject study before editing , 22 3 GNUmedia , 23 3 Open source chairs , 24 3 Educational Media Awareness Campaign/Information technology/POTD 1 , 25 3 How to be a Wikimedia sysop

ago 2008: 1 13 Wikimedia Ethics/Case Studies/Case 1 , 2 10 Wikimedia Ethics/Participants and objectives , 3 8 Expanding your professional vocabulary , 4 8 Wikimedia Ethics , 5 7 Teamspeak , 6 7 Wikimedia Ethics/Feedback 1 , 7 7 Composing free and open online educational resources/Participants/Next start , 8 6 Wikimedia Ethics/Case Studies , 9 6 OLPC peripheral development , 10 5 Wikimedia Ethics/Case Studies2 , 11 5 Follicular Dendritic Cells , 12 5 Wikimedia Ethics/List of questions , 13 4 Wiki farm , 14 4 Wikimedia Ethics/Moulton, JWSchmidt's investigation , 15 4 Wikimedia Ethics/Feedback 2 , 16 4 Lecture 2.0 , 17 4 Social psychology (psychology)/Assessment/Essay/Topics , 18 4 Wikimedia Ethics/Overview , 19 4 Wikimedia Ethics/Brainstorming , 20 3 Wikimedia Ethics/Social contract , 21 3 Wikiversity the Movie/Kickoff meeting , 22 3 Wikiversity participants who choose to leave , 23 3 Assuming good faith , 24 3 Social Innovation , 25 3 SSE Meeting of 20080807

set 2008: 1 19 Expanding your professional vocabulary , 2 11 Learning from conflict and incivility , 3 10 Wikimedia Ethics/Moulton, JWSchmidt's investigation , 4 8 Wikimedia Ethics/Case Studies/Concordances, Dossiers, Scathing Indictments, and Ethics , 5 8 Wikimedia Ethics , 6 7 Wikimedia Ethics/Case Studies/Biographies of Living People , 7 7 Wikimedia Ethics/Case Studies/Case 1 , 8 6 Ethical Management of the English Language Wikiversity/Case Studies/Deletionism , 9 6 Wikimedia Ethics/Case Studies , 10 5 Study project on Intelligent Design , 11 5 Wikimedia Ethics/Moulton, JWSchmidt's investigation/Final report , 12 5 Acrylic painting development ideas , 13 5 Web design , 14 5 Etiquette , 15 4 Wiki farm , 16 4 Eml4500.f08.qwiki , 17 4 Eml4500.f08.FEABBQ/HW1 , 18 4 Eas4200c.f08.radsam/Structures and Materials , 19 4 Study Guide:Mathematical Mesoscopic Physics/Mesoscopic Physics Glossary , 20 4 Study Guide:Mathematical Mesoscopic Physics , 21 4 WikiProject study before editing , 22 4 How to be a Wikimedia sysop , 23 4 Albanian sea port history/Comparing with the growth of Wikiversity , 24 4 Bloom Clock/Master List , 25 4 Teaching Assistant in France Survival Guide/Directory

out 2008: 1 57 Internet and Project Competence , 2 10 Computer Architecture Lab/WS2008 , 3 7 Expanding your professional vocabulary , 4 6 Consensus in a wiki environment/An introduction to Consensus , 5 6 Open Source ERP/Executive Diploma , 6 5 Internet and Project Competence/groups , 7 5 Consensus in a wiki environment , 8 5 Random , 9 4 Wiki farm , 10 4 Consensus in a wiki environment/Measuring Consensus , 11 4 Managing a private wiki , 12 4 Introduction to US History/Justification , 13 4 Web 2.0 for Professional Use/Blogs and Blogging , 14 4 Introduction to US History , 15 4 Beowulf , 16 4 Wikimedia Ethics , 17 4 Introduction to German , 18 3 How to build a pykrete bong , 19 3 Wiki Campus Radio/Active audio stream/31-10 , 20 3 Computer Architecture Lab/WS2008/Group2/ISA comparison , 21 3 Earth-impact events , 22 3 SAR mission 2008 01 , 23 3 Asperger syndrome , 24 3 Introduction to US History/United We Stand:The History of the United States of America/America Before Columbus , 25 3 Introduction to US History/United We Stand:The History of the United States of America

nov 2008: 1 12 French/Mentoring/Participants , 2 8 Wiki farm , 3 8 Internet and Project Competence , 4 6 Internet and Project Competence/group4 , 5 6 English Language Reference Desk , 6 5 7d Physics , 7 5 Internet and Project Competence/group3 , 8 5 Expanding your professional vocabulary , 9 5 Wiki Campus Radio , 10 4 Amateur astronomy/Initial experiences , 11 4 History of Europe to 1648 , 12 4 Stargazing , 13 4 Biomembrane Transport , 14 4 Internet and Project Competence/group6a , 15 4 Random , 16 4 Wikipedia , 17 4 Wikipedia service-learning courses , 18 3 Alternative ways to become an observer , 19 3 Wikipedia/Quizzes , 20 3 Colonial Haiti , 21 3 The Resting Membrane Potential , 22 3 Diffusion and osmosis , 23 3 Introduction to Biomembranes , 24 3 Internet and Project Competence/group5 , 25 3 Internet and Project Competence/group1

dez 2008: 1 8 Comparison between Roman and Han Empires , 2 7 Wiki farm , 3 5 7d Physics , 4 5 English Language Reference Desk , 5 4 Ancient Innovations , 6 4 Pole jam , 7 4 Internet and Project Competence/group5 , 8 4 Internet and Project Competence/group1 , 9 3 Nonkilling Political Science , 10 3 Being a sustainable engineer , 11 3 The regeneration army , 12 3 Internet and Project Competence/group6a , 13 3 Internet and Project Competence/group3 , 14 3 Internet and Project Competence/group2 , 15 3 American J.D. Program , 16 2 Learning theories in practice , 17 2 Online graphics , 18 2 Getting to Know You , 19 2 Conservation Entrepreneurship/Definition , 20 2 Conservation Entrepreneurship , 21 2 Nonkilling Linguistics , 22 2 Nonkilling Anthropology , 23 2 Robotics Projects , 24 2 Textile information systems design , 25 2 Surrealist techniques

jan 2009: 1 14 Wiki farm , 2 5 HTML , 3 4 Conservation Entrepreneurship/Resources , 4 4 Ancient Egyptian Monuments Project , 5 4 Wikipedia and the 2008 US elections , 6 4 Wikis in scholarly communication , 7 4 Museum photography , 8 4 Web design , 9 3 Evolutionary Synthesis , 10 3 Theology as Seen in Prophets and Psalms , 11 3 Djoser's Step Pyramid in Saqqara , 12 3 Conservation Entrepreneurship/Business Plans/Examples , 13 3 Artificial Consciousness/(AC) , 14 3 Conservation Entrepreneurship/Business Plans , 15 3 Appropedia , 16 3 Brezhoneg Unan/Lesson 1/Saludiñ/Quiz , 17 3 Conservation Entrepreneurship/Definition , 18 3 Radio Interferometer Telescope , 19 3 Ivan Illich: Deschooling Society , 20 3 Artificial Consciousness , 21 3 English Language Reference Desk , 22 3 Introduction to Programming in Java , 23 3 C++ , 24 3 Introduction to Computer Science , 25 2 Eukaryotic gene example

fev 2009: 1 17 Wiki farm , 2 7 Open Source ERP/Class01 , 3 6 Conservation Entrepreneurship/Local Initiatives , 4 5 Learning the basics of French/Participants , 5 4 Spacetime metrics explained for biologists , 6 4 Conservation Entrepreneurship/Resources , 7 4 Conservation Entrepreneurship , 8 4 Introduction to Programming/About Programming , 9 3 Conservation Entrepreneurship/Assignments/Projeto Iauaretê/Value Proposition , 10 3 Conservation Entrepreneurship/Community Projects , 11 3 Pandemic flu , 12 3 Introduction to Non-Genetic Darwinism/Physics of Self-Organization , 13 3 Introduction to Non-Genetic Darwinism/Darwin's Theory of Natural Selection , 14 3 Introduction to Non-Genetic Darwinism/Non-Biological Darwinism , 15 3 Introduction to Non-Genetic Darwinism/Darwinism, Culture and Philosophy , 16 3 Conservation Entrepreneurship/Assignments , 17 3 Introduction to Non-Genetic Darwinism , 18 3 Conservation Entrepreneurship/Class Outlines and Readings , 19 3 GreySmith Courseware Forum , 20 3 Neuropsychology Forum , 21 3 Conservation Entrepreneurship/Snack List , 22 3 Nonkilling Human Biology , 23 3 Open Source ERP/Executive Masters , 24 3 Network devices , 25 3 World History

mar 2009: 1 3 Software testing , 2 3 Basic filmmaking (pre-production) , 3 3 Design for the Environment , 4 2 Microprocessor learning project , 5 2 Karam Kriya , 6 2 C Programming , 7 2 Introduction to C programming/Hello World , 8 2 Introduction to C programming/What you need before you can learn , 9 2 Artificial Consciousness/Neural Correlates/Inter-Organ Connection Models/Cerebral Hippocampus Connections , 10 2 Chimpanzee , 11 2 Research Mentoring Program , 12 2 Introduction to Partial Differential Equations , 13 2 Reflections on Feuer , 14 2 Conservation Entrepreneurship/Assignments/Projeto Iauaretê/Value Proposition/What needs will our product satisfy? How will it create value for the customer? , 15 2 Conservation Entrepreneurship/Assignments/Projeto Iauaretê/Value Proposition/Who are our customers? , 16 2 Conservation Entrepreneurship/Assignments/Projeto Iauaretê/Value Proposition/Mission Statement , 17 2 Conservation Entrepreneurship/mission and time , 18 2 Music Learning Project , 19 2 Conservation Entrepreneurship/Assignments/Projeto Iauaretê , 20 2 Introduction to Non-Genetic Darwinism/Non-Biological Darwinism , 21 2 GreySmith Courseware Forum , 22 2 Asperger's Syndrome and autism: Dealing with outbursts , 23 2 Global warming , 24 2 University of Canberra , 25 2 Random

abr 2009: 1 16 Design for the Environment , 2 6 DFE2009 Power Generation for Ontario , 3 5 DFE2009 Alternatives To Traditional Book Publishing , 4 5 DFE2009 Flashlights , 5 5 DFE2009 Energy Storage for Wind Power Generation , 6 5 DFE2009 Residential Heating and Cooling , 7 5 DFE2009 Disposable Coffee Cups , 8 5 DFE2009 Automobile Engines , 9 5 Random , 10 4 DFE2009 All Purpose Residential Cleaning , 11 4 DFE2009 Hydrogen Production , 12 4 DFE2009 Worldwide Package Cushioning , 13 4 DFE2009 Converting Garbage to Energy , 14 4 C++ , 15 3 Jet engine performance , 16 3 Genes to Cognition Project , 17 3 Numerical Linear Algebra , 18 3 Binary Stars and Extrasolar Planets Learning Activity , 19 3 DFE2009 Street Lighting in Residential Region , 20 3 DFE2009 Residential Heating and Cooling in Ontario , 21 3 DFE2009 Scooter Transportation Alternatives , 22 3 DFE2009 Automobile Car Mats , 23 3 Engineering Help Desk , 24 2 Artificial Intelligence , 25 2 School of Mathematics:Introduction to Graph Theory:Problems 2

mai 2009: 1 5 Learning the basics of French/Participants , 2 4 Data Analysis using the SAS Language , 3 4 French/Mentoring/Participants , 4 4 Wikiversity Reports , 5 3 Jet engine performance , 6 3 Learning by failing , 7 3 Numerical Linear Algebra , 8 3 C++ , 9 2 Hexpixel Code , 10 2 Unidirectional propagation antenna , 11 2 Amateur radio , 12 2 BCP/Rubus sect. Eubatus , 13 2 Carlos Castaneda , 14 2 VB.NET Reusable Code , 15 2 REOPro Certification Training , 16 2 Ett pussel med många bitar , 17 2 French/Wall Charts and Posters/Conjugation of Finir (Complete) , 18 2 CodeBase , 19 2 Staredit , 20 2 French/Wall Charts and Posters/Conjugation of Aimer (Complete) , 21 2 French/Wall Charts and Posters , 22 2 Analysis of variance/Calculators , 23 2 Linear algebra/Determinant quiz , 24 2 Chapter 3: French and Indian War , 25 2 Chapter 2: The Colonists in 1750

jun 2009: 1 10 Web 2.0 , 2 4 NAU-POS254-Socialism , 3 4 NAU-POS254-Classical liberalism and conservatism , 4 4 Introduction to the Dutch language , 5 4 C++ , 6 3 Introduction to the Dutch language/Lesson 1: Greetings , 7 3 NAU-POS254-Radical challenges to Enlightenment Ideologies , 8 3 Carlos Castaneda , 9 3 NAU-POS254-Fascism , 10 3 Random , 11 3 Featured content/9 , 12 3 Learning the basics of French/Participants , 13 3 Zen sayings , 14 3 English Language Reference Desk , 15 2 Learning theories in practice/Behavioral changes , 16 2 Jet engine performance , 17 2 Lesson 2: To Be in Dutch , 18 2 Reefkeeping , 19 2 Diving , 20 2 Thorax , 21 2 Cardiovascular system , 22 2 HISTAM 202 CH1 L3 , 23 2 Nortel Certifications , 24 2 Engineering geology , 25 2 ATP mentor training/Computer game mentor

jul 2009: 1 18 Great Repeal Bill , 2 17 Facilitating Online/Participants , 3 8 Great Repeal Bill/Debate , 4 4 Facilitating Online , 5 3 MediaWiki namespace , 6 3 Blogs , 7 3 Wikis , 8 3 Ejump nam socialmedia eportfolio , 9 3 Appropedia , 10 3 Wikis in scholarly communication , 11 3 Lecture 2.0 , 12 3 Assistant teacher course , 13 3 BCP/Thalictrum pubescens/Logs , 14 3 C++ , 15 3 Blues basics , 16 3 HTML , 17 3 Educational wikis , 18 2 Martin Lohse , 19 2 HHF , 20 2 How to play Poker , 21 2 Digital portfolio , 22 2 Hexpixel Code , 23 2 Perennial cutbacks , 24 2 Pain , 25 2 Lesson Four: learning the script and associated phonemes

ago 2009: 1 11 Great Repeal Bill , 2 10 Facilitating Online/Participants , 3 6 Active learning , 4 6 Great Repeal Bill/Debate , 5 6 French/Mentoring/Participants , 6 5 Facilitating Online/course mini conference , 7 3 HHF/Biology , 8 3 The Inevitability of Globalism/From animism to objective language , 9 3 Comparative law and justice , 10 3 Facilitating Online/Meetings , 11 3 How to be a Wikimedia sysop/Wikiversity , 12 3 Learning the basics of French/Participants , 13 3 Why cats present dead mice to their owners , 14 3 Web 2.0 , 15 3 Facilitating Online , 16 3 Introduction to C++ , 17 2 How to build a pykrete bong , 18 2 Transclusion , 19 2 Biblical Studies (NT)/IV. THE SEVEN TRUMPETS , 20 2 Biblical Studies (NT)/III. THE SEVEN SEALS , 21 2 Biblical Studies (NT)/II. THE SEVEN ASIAN CHURCHES , 22 2 Biblical Studies (NT)/I. INTRODUCTION TO REVELATION , 23 2 HHF/Chemistry , 24 2 HHF/Physics , 25 2 HHF/Mathematics

set 2009: 1 43 AP Language: Education , 2 5 Egm6321.f09.Team2/HW2 , 3 4 The Use of English with Other Members of the Thai Academic Community among Dhurakij Pundit University’s Postgraduate Business Students , 4 4 Introduction to CAD , 5 4 Pollution Control and Monitoring , 6 4 Environmental Legislation and Management Systems , 7 3 The Use of English with Other Members of the Thai Academic Community among Dhurakij Pundit University’s Postgraduate Business Students/DBA Roundtable , 8 3 The Use of English with Other Members of the Thai Academic Community among Dhurakij Pundit University’s Postgraduate Business Students/MBA Roundtable , 9 3 The Use of English with Other Members of the Thai Academic Community among Dhurakij Pundit University’s Postgraduate Business Students/Appendices , 10 3 The Use of English with Other Members of the Thai Academic Community among Dhurakij Pundit University’s Postgraduate Business Students/References , 11 3 The Use of English with Other Members of the Thai Academic Community among Dhurakij Pundit University’s Postgraduate Business Students/Conclusions, Implications, and Recommendations , 12 3 The Use of English with Other Members of the Thai Academic Community among Dhurakij Pundit University’s Postgraduate Business Students/Findings and Discussion , 13 3 The Use of English with Other Members of the Thai Academic Community among Dhurakij Pundit University’s Postgraduate Business Students/Methodology , 14 3 The Use of English with Other Members of the Thai Academic Community among Dhurakij Pundit University’s Postgraduate Business Students/Literature Review , 15 3 The Use of English with Other Members of the Thai Academic Community among Dhurakij Pundit University’s Postgraduate Business Students/Introduction , 16 3 Intro Emerging Tech , 17 3 Emerging tech Africa , 18 3 UV Sensitive Beads , 19 3 Preparation of Soap , 20 3 Polymers , 21 3 DNA Extraction , 22 3 Cold and Hot Packs , 23 3 Comments on the paper The Complexity of Identity , 24 3 Praise and Punishment at Wikiversity , 25 3 Google Search and Wikiversity

out 2009: 1 22 AP Language: Education , 2 5 Facilitating Online/Participants , 3 3 Comparison of wiki farms , 4 3 Pakistan clj , 5 3 Finland , 6 3 Canada , 7 3 Sweden , 8 3 Jordan , 9 3 Connectivism glossary , 10 3 French/Mentoring/Participants , 11 3 Australia , 12 3 University of Canberra , 13 3 Ubuntu , 14 3 How to be a Wikimedia sysop , 15 3 Technical writing , 16 2 The Use of English with Other Members of the Thai Academic Community among Dhurakij Pundit University’s Postgraduate Business Students/DBA Roundtable , 17 2 The Use of English with Other Members of the Thai Academic Community among Dhurakij Pundit University’s Postgraduate Business Students/MBA Roundtable , 18 2 The Use of English with Other Members of the Thai Academic Community among Dhurakij Pundit University’s Postgraduate Business Students/Appendix B: The Questionnaire , 19 2 The Use of English with Other Members of the Thai Academic Community among Dhurakij Pundit University’s Postgraduate Business Students/Appendix A: Content Validity Analysis , 20 2 The Use of English with Other Members of the Thai Academic Community among Dhurakij Pundit University’s Postgraduate Business Students , 21 2 Health informatics , 22 2 Advanced projects in chemistry , 23 2 Usergroup:Parents , 24 2 Voice over Internet Protocol , 25 2 Arndell Special School

nov 2009: 1 16 UTPA STEM/CBI Courses , 2 15 Facilitating Online/course mini conference , 3 6 French/Mentoring/Participants , 4 5 Children Schools and Families Bill , 5 5 Technical writing , 6 4 The Use of English with Other Members of the Thai Academic Community among Dhurakij Pundit University’s Postgraduate Business Students , 7 4 Managing Human Resource Flows , 8 3 UTPA STEM/CBI Courses/Calculus2 , 9 3 Saudi Arabia , 10 3 Jordan , 11 3 Angles , 12 2 The Use of English with Other Members of the Thai Academic Community among Dhurakij Pundit University’s Postgraduate Business Students/Findings and Discussion/DISCUSSIONS , 13 2 The Use of English with Other Members of the Thai Academic Community among Dhurakij Pundit University’s Postgraduate Business Students/DBA Roundtable/DBA Roundtable: Part 2 , 14 2 The Use of English with Other Members of the Thai Academic Community among Dhurakij Pundit University’s Postgraduate Business Students/MBA Roundtable/MBA Roundtable: Part 2 , 15 2 The Use of English with Other Members of the Thai Academic Community among Dhurakij Pundit University’s Postgraduate Business Students/Findings and Discussion , 16 2 Right to Reply , 17 2 Epiinjury - a collaborative learning project on occupational injury epidemiology , 18 2 Operating System , 19 2 Barefoot running , 20 2 UTPA STEM/CBI Courses/CalculusII/Representing Functions as Power Series , 21 2 UTPA STEM/CBI Courses/Manufacturing Processes Lab/t-statistic , 22 2 How to use Maxwell Model to Reconstruct Radar Image , 23 2 UTPA STEM/CBI Courses/CalculusII , 24 2 Geometry and Measurement , 25 2 UTPA STEM/CBI Courses/Statics

dez 2009: 1 5 Children Schools and Families Bill , 2 5 Managing Human Resource Flows , 3 4 Facilitating Online/course mini conference , 4 4 French/Mentoring/Participants , 5 4 Technical writing audience , 6 3 Learning theories in practice , 7 3 The Use of English with Other Members of the Thai Academic Community among Dhurakij Pundit University’s Postgraduate Business Students , 8 3 Amendments to Section 19B of Schedule 1 , 9 2 Learning theories in practice/Process writing in L2 Classrooms , 10 2 Wiki Campus Radio/Active audio stream/01-25 , 11 2 Amendments to Section 19H of Schedule 1 , 12 2 Amendments to Section 19G of Schedule 1 , 13 2 Amendments to Section 19F of Schedule 1 , 14 2 Amendments to Section 19E of Schedule 1 , 15 2 Amendments to Section 19D of Schedule 1 , 16 2 The Use of English with Other Members of the Thai Academic Community among Dhurakij Pundit University’s Postgraduate Business Students/DBA Roundtable/DBA Roundtable: Part 2 , 17 2 The Use of English with Other Members of the Thai Academic Community among Dhurakij Pundit University’s Postgraduate Business Students/DBA Roundtable , 18 2 The Use of English with Other Members of the Thai Academic Community among Dhurakij Pundit University’s Postgraduate Business Students/MBA Roundtable , 19 2 The Use of English with Other Members of the Thai Academic Community among Dhurakij Pundit University’s Postgraduate Business Students/Appendix C: Focus Group Discussions , 20 2 The Use of English with Other Members of the Thai Academic Community among Dhurakij Pundit University’s Postgraduate Business Students/Appendix A: Content Validity Analysis , 21 2 Amendments to Section 19C of Schedule 1 , 22 2 Amendments to Section 19A of Schedule 1 , 23 2 Normal vs not normal , 24 2 Epiinjury - a collaborative learning project on occupational injury epidemiology

jan 2010: 1 11 Managing Human Resource Flows , 2 11 Technical writing UI Design , 3 5 Children Schools and Families Bill , 4 5 Web Design/What is HTML , 5 4 Egm6341.s10.Team2/HW1 , 6 4 Icns141/Homework , 7 3 UCL anatomy , 8 3 Wiki Pedagogy , 9 3 Noble gases , 10 3 Wish-list for Amendments , 11 3 Comparison between Roman and Han Empires , 12 3 Basic filmmaking (pre-production) , 13 3 How to be a Wikimedia sysop , 14 3 Technical writing courses , 15 3 Technical writing overview , 16 2 UCNISS , 17 2 SAR mission 2008 02 , 18 2 Bones of the shoulder region 3 , 19 2 Bones of the shoulder region 4 , 20 2 Bones of the shoulder region 2 , 21 2 Bones of the shoulder region , 22 2 Military Medicine , 23 2 Whats is aperesis , 24 2 Mobile wallet , 25 2 Amendments proposed by Mr Nick Gibb, Tim Loughton and Bill Wiggin as of 19 January 2010

fev 2010: 1 14 Web 2.0 , 2 9 Romanticism and Revolution , 3 7 18th century European scholarly societies and academies , 4 6 History Essay Format & Thesis Statement , 5 4 Reviewing My Semester with the FUN WITH ENGLISH 7A & 8A Textbooks , 6 4 UTPA STEM/CBI Courses , 7 3 UTPA STEM/CBI Courses/Calculus Based Physics/Angular Momentum and its Conservation , 8 3 Value chains and new media , 9 3 SAR mission 2008 02 , 10 3 Russian Roulette (Drinking Game) , 11 3 Variables and Types in Turing , 12 3 Introduction to Turing Programming Language , 13 3 Other Free Learning Resources , 14 2 UCNISS , 15 2 UTPA STEM/CBI Courses/Thermal Systems Design and Optimization/Economics , 16 2 Luke Laird , 17 2 Marine Biology Lesson Plan , 18 2 Finite Difference Time Domain , 19 2 How to learn - asking questions finding answers , 20 2 LessonPlanTemplate2 , 21 2 Exploring Second Life for Foreign Language , 22 2 Hawaiian creole English , 23 2 Language revitalization , 24 2 Egm6341.s10.Team2/HW3 , 25 2 The Near Death Experience as Possible Evidence for any Afterlife

mar 2010: 1 9 Open academia in practice/Participants , 2 8 Wikiversity open letter project/WMF Board March 2010 , 3 6 French/Mentoring/Participants , 4 5 Going naked - Openism and freedom in academia , 5 5 HTML , 6 4 Wikizens with a Second Life account , 7 4 Using social media for teaching and research , 8 4 Wikimedia Ethics , 9 3 University of Canberra/Things that don't work , 10 3 Inflammatory bowel disease , 11 3 MergeSort , 12 3 Open academia in practice , 13 3 The Hand , 14 3 Elements of a good TBL , 15 3 Sport sponsorship and media , 16 3 ExtraDix , 17 3 RadixSort , 18 3 ID rapid prototyping plan , 19 3 What is the sixth sense? , 20 3 Egm6341.s10.Team2/HW4 , 21 3 Exploring Second Life for Foreign Language , 22 3 Google Wave for education , 23 3 Russian Roulette (Drinking Game) , 24 3 India , 25 3 Sorting data

abr 2010: 1 16 Wikiversity open letter project/WMF Board March 2010 , 2 5 Rebooting Wikiversity , 3 5 Conway's Game of Life , 4 3 Response testing/WMF Projects , 5 3 United Arab Emirates , 6 3 Normal distribution , 7 3 Bloom Clock/Master List , 8 3 BCP/Forsythia x intermedia/Logs , 9 3 BCP/Taraxacum officinale/Logs , 10 3 Bloom Clock/Unknown Plants , 11 2 Nonstandard physics/Dirac large numbers hypothesis , 12 2 Cold fusion/Experts/Abd ul-Rahman Lomax , 13 2 Teaching EFL Listening via FUN WITH ENGLISH Books/7B/Lesson 9 , 14 2 Plant identification/Acer saccharum , 15 2 UTPA STEM/CBI Courses/Microprocessor System Design , 16 2 UTPA STEM/CBI Courses/Business Algebra/Linear Programming , 17 2 UTPA STEM/CBI Courses/General Microbiology/Genetic Engineering Using Bacteria , 18 2 Microprocessor System Design , 19 2 UTPA STEM/CBI Courses/Calculus Based Physics/Faraday's Law , 20 2 Career Exploration Using Second Life , 21 2 Response testing/WMF Projects/Newbie treatment at Criteria for speedy deletion , 22 2 How force field analysis is used? , 23 2 University of Canberra/Things that could work/Vision for open education and research using popular internet , 24 2 University of Canberra/OpenUC , 25 2 University of Canberra/Things that could work

mai 2010: 1 16 Great Repeal Bill , 2 14 Great Repeal Bill/Debate , 3 4 C++ , 4 3 Greek and Roman military traditions , 5 3 UC-IP , 6 3 Intellectual Property - proposed policy and procedures for Australian research and education , 7 3 BCP/Trifolium repens/Logs , 8 2 The Goal: , 9 2 Mapudungun language , 10 2 Chemical Equilibrium , 11 2 Fundamental Electrochemistry , 12 2 Overtraining , 13 2 Otago Polytechnic's policy on intellectual property , 14 2 Limit (mathematics) , 15 2 IAST , 16 2 Model of human intelligence/Related work , 17 2 Looking at World War II - Text and Media , 18 2 Model of human intelligence/Methodology , 19 2 Model of human intelligence/Objective , 20 2 Vision for open education and research using popular internet , 21 2 Model of human intelligence , 22 2 University of Canberra/OpenUC , 23 2 Photographic Composition , 24 2 French/Mentoring/Participants , 25 2 Crocodile

jun 2010: 1 6 KinderCalculus , 2 5 UC-IP , 3 4 KinderCalculus/blead , 4 4 KinderCalculus/Nouns & Verbs , 5 4 Improving Technical Topics At Wikiversity , 6 4 NAU-POS254-Fascism , 7 4 NAU-POS254-Socialism , 8 4 Introduction to Computer Science , 9 3 KinderCalculus/syntax , 10 3 Department of Regional Anatomy of the Human Body , 11 3 Eukaryotic gene example , 12 3 Martin Lohse/Music style , 13 3 Martin Lohse , 14 3 Wikineighborhoods , 15 3 Motivation and emotion , 16 3 Multilingual Pages , 17 3 Great Repeal Bill , 18 3 NAU-POS254-Radical challenges to Enlightenment Ideologies , 19 3 Tourism , 20 3 History of the Ottoman Empire , 21 3 How to be a Wikimedia sysop , 22 3 C++ , 23 2 Parliamentary Reform Bill , 24 2 Cite:Allen & Bennett 2008 , 25 2 Ten Stupid Things Beginners Do to Mess Up Their Contradance Experience/Waiting to Be Asked

jul 2010: 1 14 University of Canberra/RCC2010/Registration , 2 10 18th century European scholarly societies and academies , 3 6 Human Legacy Course , 4 4 KinderCalculus/Nouns & Verbs , 5 4 Great Repeal Bill , 6 3 Parliamentary Reform Bill , 7 3 How to build a pykrete bong , 8 3 University of Canberra/RCC2010/Schedule , 9 3 KinderCalculus/Dress , 10 3 KinderCalculus/syntax , 11 3 KinderCalculus/blead , 12 3 Motivation and emotion , 13 3 University of Canberra , 14 3 Information theory , 15 3 Learning mathematics , 16 2 World War I , 17 2 Limitations of Scientific Research , 18 2 Teaching EFL Listening via FUN WITH ENGLISH Books/7B/Lesson 14 , 19 2 Auditory Cortical Evolution , 20 2 Using the internet for learning and research , 21 2 Indiana University future faculty teaching fellows , 22 2 Survey about Wikipedia , 23 2 University of Canberra/RCC moved/Invitation , 24 2 University of Canberra/RCC Canberra: Planning , 25 2 University of Canberra/RCC Canberra: Location

ago 2010: 1 42 Motivation and emotion/Participants/2010 , 2 19 Motivation and emotion/Textbook , 3 10 University of Canberra/RCC2010/Registration , 4 9 Motivation and emotion , 5 6 English basics 101 , 6 5 Motivation and emotion/Book/2011/Specific emotions , 7 4 Dramaturgy , 8 4 Dinosaur , 9 4 Exercise and metabolic disease , 10 4 English basics , 11 4 History of the Ottoman Empire , 12 4 C++ , 13 3 Motivation and emotion/Textbook/Motivation/Addiction , 14 3 Motivation and emotion/Textbook/Motivation/Procrastination , 15 3 University of Canberra/RCC2010/Conversations behind wikis , 16 3 University of Canberra/RCC2010/Wikis for applied learning , 17 3 University of Canberra/RCC2010/Wikiversity , 18 3 Survey about Wikipedia , 19 3 University of Canberra/RCC2010/Schedule , 20 3 Motivation and emotion/References , 21 3 StrategyHeuristics , 22 3 Web design , 23 2 Motivation and emotion/Textbook/Motivation/Hunger , 24 2 Cold fusion/Lab , 25 2 The Collins of Chard. Chapter I.

set 2010: 1 16 Motivation and emotion/Participants/2010 , 2 11 University of Canberra/Wikis for research , 3 8 Motivation and emotion/Textbook , 4 5 Motivation and emotion/Textbook/Motivation/Procrastination , 5 5 UTPA STEM/CBI Courses , 6 4 Human Legacy Course , 7 4 Web 2.0 , 8 3 16th century: Growth of the Empire, Part 2, Suleiman I (\"the Magnificent\") , 9 3 The sport workplace , 10 3 UC Women's Group Mentoring Program , 11 2 Quiz on 16th century: Growth of the Empire, Part 2, Suleiman I (\"the Magnificent\") , 12 2 UTPA STEM/CBI Courses/Microbiology/Chemiosmosis in Eukaryotes , 13 2 UTPA STEM/CBI Courses/Calculus Based Physics II/DC Circuits , 14 2 UTPA STEM/CBI Courses/Biology I , 15 2 UTPA STEM/CBI Courses/Materials/Thin Films , 16 2 UTPA STEM/CBI Courses/Computer Science/Arrays , 17 2 UTPA STEM/CBI Courses/General Physics I/Projectile Motion , 18 2 UTPA STEM/CBI Courses/Anatomy and Physiology/Endocrine Imbalance , 19 2 UTPA STEM/CBI Courses/Assembly Programming , 20 2 UTPA STEM/CBI Courses/Cell Biology/Cancer Biology , 21 2 The Teacher's Day in Thailand , 22 2 Motivation and emotion/Textbook/Motivation/Procrastination/Answers to procrastination crossword , 23 2 Songkran Festival , 24 2 Madagascar , 25 2 United republic of Tanzania

out 2010: 1 26 Instructive examples , 2 7 Laboratory on Mathematics and Mathematics Education/Fermi Questions/Scaffolds , 3 4 Wikistution/Article II (The Executive) , 4 4 Wikistution/Amendment XXI (Prohibition Repealed) , 5 4 Wikistution , 6 4 Gynecological examination , 7 4 Bloom Clock , 8 3 Section 1.3 , 9 3 Section 2.1 , 10 3 Section 3.2 , 11 3 Wikistution/Article V (Amendments) , 12 3 Wikistution/Amendment XXVIII , 13 3 Wikistution/Amendment XIX (Woman Suffrage) , 14 3 Wikistution/Amendment II (Right to Bear Arms) , 15 3 Proving the Pythagorean Theorem By Picture , 16 3 Laboratory on Mathematics and Mathematics Education , 17 3 Fluid Mechanics for MAP/Introduction , 18 3 Composing free and open online educational resources 2011 , 19 3 Motivation and emotion/Textbook/Motivation/Risk-taking , 20 3 Motivation and emotion/Textbook/Motivation/Motivational toxicity , 21 3 Motivation and emotion/Textbook/Motivation/Student motivation theories , 22 3 BCP/Spigelia marilandica , 23 3 Facilitating Online , 24 3 Cold fusion , 25 2 Latonic/Présens

nov 2010: 1 11 Why academics do and do not participate on wikis , 2 8 Instructive examples , 3 6 Bloom Clock , 4 4 Motivation and emotion/Textbook/Motivation/Anxiety , 5 4 Motivation and emotion/Textbook/Emotion/Sleep , 6 3 Wikilitigation , 7 3 Stability of RK methods , 8 3 Motivation and emotion/Textbook/Emotion/Theories/Cognitive , 9 3 Motivation and emotion/Textbook/Motivation/Intrinsic and extrinsic motivation , 10 3 Motivation and emotion/Textbook/Emotion/Stress, arousal and coping , 11 3 Motivation and emotion/Textbook/Emotion/Facial expression , 12 3 Cold fusion/Theory , 13 3 Motivation and emotion/Textbook/Emotion/Anxiety , 14 3 Motivation and emotion/Textbook/Emotion/Psychopathy , 15 3 Motivation and emotion/Textbook/Emotion/Sport , 16 3 Motivation and emotion/Textbook/Motivation/Sexual motivation , 17 3 Motivation and emotion/Textbook/Motivation/Student motivation theories , 18 3 Human Legacy Course , 19 3 Moodle , 20 3 Tourism industry , 21 2 Wikilitigation/WP noticeboards , 22 2 Open academia: Principles and practices , 23 2 Introductory Algebra/Lesson Sequence , 24 2 Clinical Exercise Biomechanics , 25 2 Creating a video lecture

dez 2010: 1 11 Conservation Entrepreneurship/Annotated Bibliography , 2 10 Why academics do and do not participate on wikis , 3 5 Conservation Entrepreneurship/Student Essays , 4 4 Instructive examples , 5 4 Fiji , 6 3 Learning civility , 7 3 Motivation and emotion/Textbook/Motivation/Gender differences in sexual motivation , 8 3 Cold fusion/Experts/Abd ul-Rahman Lomax , 9 3 Stellar evolution , 10 3 Cold fusion , 11 3 Media literacy , 12 2 Astrobiology , 13 2 Communication and Identities in Institutional Arenas - Part I , 14 2 HLA , 15 2 Motivation and emotion/Textbook/Motivation/Education , 16 2 Cold fusion/Storms (2010)/Radioactive decay of contaminant , 17 2 Student online safety guidelines , 18 2 Wikilitigation/WP:NOT , 19 2 Cold fusion/Storms (2010) , 20 2 Cold fusion/Theory , 21 2 Sport research/Research design , 22 2 Fluid Mechanics for MAP/Fluid Dynamics , 23 2 Height of the Ottoman Empire , 24 2 Cold fusion/Skeptical arguments/Shanahan , 25 2 Uruguay

jan 2011: 1 51 Psycholinguistics/Participants , 2 47 Psycholinguistics , 3 11 SPIR608 Political Simulations and Gaming/2011 , 4 6 Composing free and open online educational resources/Participants/Next start , 5 5 Complex socio-ecological systems/Complex Adaptive Systems , 6 5 Complex socio-ecological systems/System dynamics , 7 5 Communication and Identities in Institutional Arenas - Part I/Tuesday 25 January , 8 5 University of Canberra/RCC2011 , 9 4 Doctor of Philosophy , 10 4 Psycholinguistics/What is a Word? , 11 4 SPIR608 Political Simulations and Gaming , 12 4 GRD Capstone , 13 4 Communication and Identities in Institutional Arenas - Part I , 14 3 Learning theories in practice/Constructivism/Math , 15 3 University of Canberra/RCC2011/Participants , 16 3 University of Canberra/RCC/Navigation , 17 3 Communication and Identities in Institutional Arenas - Part I/Monday-Tuesday 16-17 May , 18 3 Cosmic View , 19 3 Fluid Mechanics for MAP/Analytical solutions of internal and external flows , 20 3 HiFi , 21 3 Psycholinguistics/Speech Production , 22 3 Psycholinguistics/Language and Thought , 23 3 Psycholinguistics/History and Major Theories , 24 3 Complex socio-ecological systems/Systems modeling , 25 3 Complex socio-ecological systems/Genetic algorithms

fev 2011: 1 13 Web 2.0 , 2 9 SPIR608 Political Simulations and Gaming/2011 , 3 6 University of Canberra/RCC2011/RecentChangesCamp Expanded/Melbourne , 4 6 Gettysburg Address , 5 5 UCNISS/Sport Wiki Academy/Using Wikimedia Foundation projects , 6 5 Computer Architecture Lab/SS2011 , 7 5 University of Canberra/RCC2011 , 8 4 Engineering Experience 4: Design a Small Solar Vehicle/Nl/Team PM4 , 9 4 University of Canberra/RCC2011/RecentChangesCamp Expanded , 10 4 Heliganstadt Testament; Symphony No. 9, op. 125, IV , 11 4 Psycholinguistics , 12 4 Workshop for Australian education policy/The Bruce Declaration , 13 4 Game design , 14 4 Cold fusion , 15 3 Institutions and communities , 16 3 The History of the Paralympic Movement in Australia/Tender , 17 3 Dignity/when your dignity was threatened or abridged , 18 3 Conceptual frameworks, models, theories, definitions , 19 3 Cosmic View: Glossary of Terms , 20 3 University of Canberra/RCC2011/Participants , 21 3 University of Canberra/RCC/Navigation , 22 3 SPIR608 Political Simulations and Gaming/2011/Week 6 , 23 3 Moral Obligation to Be Intelligent, The , 24 3 Preschool Language and Skills , 25 3 Psycholinguistics/Parsing

mar 2011: 1 5 Collaborative Scenario , 2 5 Open Educational Resources for School Teachers from Developing Nations/Participants , 3 5 Engineering Experience 4: Design a Small Solar Vehicle/Nl/Team HelioDrive (Team PM4) , 4 5 Engineering Experience 4: Design a Small Solar Vehicle/Nl/Team PM5 , 5 4 Web 2.0 Tools for Teaching , 6 4 The History of the Paralympic Movement in Australia/Tender , 7 4 Engineering Experience 4: Design a Small Solar Vehicle/Nl/Team AM5 , 8 4 Psycholinguistics , 9 3 Engineering Experience 4: Design a Small Solar Vehicle/Nl/Team PM7/Design rapport , 10 3 Preparing an Online Collaborative Environment Plan , 11 3 Creative Teaching Techniques for Teaching I&E , 12 3 Open Web Sources , 13 3 Institutions and communities , 14 3 Observational astronomy/Meteor observing , 15 3 Web Resources and Social Media Tools for Teaching Innovation and Entrepreneurship , 16 3 Engineering Experience 4: Design a Small Solar Vehicle/Nl , 17 3 Wikimedia Ethics/Moulton, JWSchmidt's investigation , 18 3 History of the Ottoman Empire , 19 3 Wikimedia Ethics/Case Studies2 , 20 3 Educational Media Awareness Campaign , 21 3 Qualitative research , 22 3 Electric Circuit Analysis , 23 3 Observational astronomy , 24 2 Wikimedia Ethics/TOC , 25 2 Preventing email spam/Spam identification tactics

abr 2011: 1 5 Openness and collaboration , 2 5 Open Educational Resources for School Teachers from Developing Nations/Participants , 3 4 Engineering Experience 4: Design a Small Solar Vehicle/Nl/Team PM5 , 4 3 Open Educational Resources for School Teachers from Developing Nations , 5 3 SPIR608 Political Simulations and Gaming/2011/BRIC , 6 3 Psycholinguistics , 7 3 Nonstandard physics/Gravitomagnetism , 8 3 Tourism , 9 2 Continuous versus Discrete Manufacturing in ERP , 10 2 Icns141/Term 3, 2010/2011 , 11 2 Rogers 19 point theory , 12 2 Bhagavad Gita/The Satanic Verses of Bhagavad-gita , 13 2 Openness and collaboration/Edit using your real name , 14 2 SPIR608 Political Simulations and Gaming/2011/Evaluation , 15 2 LMS Interactivity Lesson 1 , 16 2 ID LMS Interactivity , 17 2 English Composition II , 18 2 English Composition I , 19 2 Sample Collaborative Environment Plan , 20 2 Introduction to Bayesian Statistics , 21 2 SPIR608 Political Simulations and Gaming/2011/Energy Game , 22 2 Internet entrepreneur , 23 2 Choosing Methods for a Presentation , 24 2 Active Directory in schools , 25 2 Designing a Problem Space for a Collaborative Work Environment

mai 2011: 1 4 The History of the Paralympic Movement in Australia/All pages , 2 4 The History of the Paralympic Movement in Australia , 3 4 Open academic practice and Excellence in Research for Australia , 4 4 Human Legacy Course , 5 3 Research in education: Open and networked practices , 6 3 Patricia Zavella , 7 3 Continuous versus Discrete Manufacturing in ERP , 8 3 Latin American and Latina/o Cultural Studies , 9 3 UsEGM6321.F10.TEAM1.WILKS/Mtg3 , 10 3 UsEGM6321.F10.TEAM1.WILKS/Mtg1 , 11 2 Katie Harwood , 12 2 UCNISS/Women and children's sport research centre proposal , 13 2 EGM6341.s11.TEAM1.WILKS/Mtg1 , 14 2 Baigents Case , 15 2 Fiji Hindi Vocabulary/Awadhi derivations , 16 2 Fiji Hindi Vocabulary/Bhojpuri derivations , 17 2 Classical Mechanics Formulae , 18 2 Open academia survey , 19 2 Fiji Hindi Vocabulary , 20 2 Bhagavad Gita/The Satanic Verses of Bhagavad-gita , 21 2 Second Life/Sustainability considerations relating to the use of Second Life for education , 22 2 University Edible Landscaping , 23 2 UsEGM6321.F10.TEAM1.WILKS/Mtg15 , 24 2 Adapted Physical Education , 25 2 Kuwait

jun 2011: 1 4 Open academic practice and Excellence in Research for Australia , 2 4 Human Legacy Course , 3 3 Chemicals , 4 3 United States History , 5 3 Open academia survey , 6 3 Applied linear operators and spectral methods , 7 3 Lesson:Camera Lenses , 8 2 NTEU discussion on TEQSA framework for standards in teaching and learning , 9 2 1975/Pask , 10 2 Paleontology , 11 2 Factor of urbanization , 12 2 Patterns , 13 2 Java Tutorial/Trail: Javolution , 14 2 Anomaly , 15 2 School of Latin , 16 2 UTPA STEM/CBI Courses/Graphics/Pictorial Sketching , 17 2 United States History/Feedback , 18 2 Tongue Twisters , 19 2 Organometallic chemistry/Cone Angles , 20 2 Luísa Ourique Lau/Canabinóides , 21 2 UCNISS/Women and children's sport research centre proposal , 22 2 Harbor wave , 23 2 The History of the Paralympic Movement in Australia/List of contributors , 24 2 Climate control/An artificial \" tornado\" to supplant the real thing , 25 2 The History of the Paralympic Movement in Australia

jul 2011: 1 4 EGM6341.s11.team1.Gong/Mtg8 , 2 4 Educational wikis , 3 3 Greater Access Choice and Flexibility: Learning at University of Canberra , 4 3 Occupational health , 5 3 Necator Americanus , 6 3 The History of the Paralympic Movement in Australia/Library , 7 3 United States History , 8 3 The History of the Paralympic Movement in Australia , 9 3 Human Legacy Course , 10 3 Spanish 1/Chapter 1 (The Basics) , 11 3 Albert Einstein quote , 12 3 Spanish/Spanish One , 13 2 Effective EU Simulations , 14 2 Euroscience response to EU Consultation on scientific information in the digital age , 15 2 Averages , 16 2 String instruments , 17 2 First aid techniques , 18 2 Behavioral Finance , 19 2 Archive of Simulations and Games/Annotated Bibliography , 20 2 Virtues , 21 2 Course KOIIA-I (Communication and Identities in Institutional Arenas Part I) Spring 2011/Thursday 14 April , 22 2 Course KOIIA-I (Communication and Identities in Institutional Arenas Part I) Spring 2011/Monday 14 February , 23 2 Exercises on the bisection method/Solution , 24 2 American fiddle , 25 2 Ascariasis

ago 2011: 1 68 Motivation and emotion/Participants , 2 28 Motivation and emotion/Book/2011 , 3 6 Wiki 101 , 4 4 Motivation and emotion/Book/2011/Competitiveness and happiness , 5 4 Human Legacy Course , 6 4 Moodle , 7 3 Salticid studies/First records of Hakka (Araneae: Salticidae) in North America , 8 3 Cardboard boats/Howard Community College , 9 3 Naturality , 10 3 Types of computers , 11 3 The History of the Paralympic Movement in Australia/List of contributors , 12 3 Boubaker Polynomials , 13 3 Motivation and emotion/Tutorials/Introduction/Definitions , 14 2 Motivation and emotion/Book/2011/Creativity , 15 2 Molecular Biology/External resources , 16 2 Motivation and emotion/Book/2011/Learned optimism , 17 2 Cardboard boats/Howard Community College/Spring2008/Pride of Fleet , 18 2 CIVICS , 19 2 General Engineering Projects/Team Done Form , 20 2 Servetus , 21 2 Motivation and emotion/Participants/How to sign , 22 2 What is a computer? , 23 2 Hardware , 24 2 Relaxation techniques , 25 2 Pygmalion effect

set 2011: 1 14 Poppit/Howard Community College/Fall2011 , 2 14 Motivation and emotion/Participants , 3 11 Motivation and emotion/Book/2011 , 4 6 Teaching and Learning Online , 5 5 Solar/Howard Community College/Fall2011 , 6 5 Poppit/Howard Community College/Fall2011/501 superior , 7 5 Poppit/Howard Community College/Fall2011/501 jupiters , 8 5 Poppit/Howard Community College/Fall2011/501 jdjengineers , 9 5 Poppit/Howard Community College/Fall2011/501 EME , 10 5 The History of the Paralympic Movement in Australia/Meetings/Perth 18 Sept 2011 , 11 5 Motivation and emotion/Book/2011/Aggression , 12 4 Escher/Howard Community College/fall2011/502 ABM , 13 4 Airplane Float/Howard community college/fall2011/502 Floaters , 14 4 Model boat/Howard Community College/fall2011/502 bottle , 15 4 HAM/Howard Community College/Fall 2011 , 16 4 Rube Goldberg/Howard Community College/Fall2011/550 FKJ , 17 4 BallBot/Howard Community College/Fall2011/501 BBotz , 18 4 HoverCraft/Howard Community College/Fall2011 , 19 4 Helicopter/Howard Community College/Fall2011/501 Flyers , 20 4 Airplane Float , 21 4 Poppit/Howard Community College/Fall2011/502 1+1=11 , 22 4 Poppit/Howard Community College/Fall2011/502 ZNC , 23 4 Poppit/Howard Community College/Fall2011/550 cjf , 24 4 Poppit/Howard Community College/Fall2011/501 robots , 25 4 Poppit/Howard Community College/Fall2011/501 dragons

out 2011: 1 8 Motivation and emotion/Participants , 2 7 Motivation and emotion/Book/2011 , 3 6 Motivation and emotion/Book/2011/Gambling , 4 5 Motivation and emotion/Book/2011/Emotional intelligence , 5 5 University of Canberra/RCC2012 , 6 4 University of Canberra/RCC2012/Participants , 7 4 Motivation and emotion/Book/2011/Dealing with conflict , 8 4 1000 Songs/Give ear, O heavens and I will speak Deut 32:1-43 , 9 4 Airplane Float/Howard community college/fall2011/502 Floaters , 10 4 StrandBeest/Howard Community College/fall2011/550 Kapachi , 11 4 BallBot/Howard Community College/Fall2011/501 BBotz , 12 4 Motivation and emotion/Book/2011/Shame , 13 4 Motivation and emotion/Book/2011/Relationships and happiness , 14 4 Other Free Learning Resources , 15 3 Motivation and emotion/Book/Sport participation , 16 3 TAO , 17 3 Tape purge/Howard Community College/Fall2011 , 18 3 Motivation and emotion/Book/2011/Peer influence in adolescence , 19 3 Rubberband gun/Howard Community College/fall2011/550 JHK , 20 3 Helicopter/Howard Community College/Fall2011/501 Eagles , 21 3 Engines/Howard Community College/Fall2011/501 BigBlock , 22 3 Corn Starch/Howard Community College/Fall 2011/501 Speakers , 23 3 1000 Songs/The Lord abides upon my head like a crown (ode 01) , 24 3 1000 Songs/Oxyrhynchus hymn fragment , 25 3 Digital culture

nov 2011: 1 11 Motivation and emotion/Book/2011 , 2 8 Fascinosum Kulturlandschaft , 3 8 University of Canberra/RCC2012/Participants , 4 8 Web design , 5 6 Motivation and emotion/Book/2011/Dealing with conflict , 6 5 Motivation and emotion/Book/Time management , 7 4 Bridges/Howard Community College/fall2011/501 DAS 3 , 8 4 Motivation and emotion/Book/2011/Leaving home , 9 4 Motivation and emotion/Book/2011/Sensation seeking , 10 4 Motivation and emotion/Book/2011/Competitiveness , 11 4 Motivation and emotion/Book/2011/Diet, weight loss, and emotion , 12 4 Helicopter/Howard Community College/Fall2011/501 Eagles , 13 4 Motivation and emotion/Book/2011/Emotional control vs. emotional expressiveness , 14 4 Motivation and emotion/Book/2011/Criminality , 15 4 Motivation and emotion/Book/2011/Learned optimism , 16 4 Shock , 17 3 Sleep , 18 3 RNA world vs metabolism first , 19 3 Motivation and emotion/Book/Spiritual and religious motivation , 20 3 Bernoulli/Howard Community College/Fall2011/502 Desi'z , 21 3 Robot arm/Howard Community College/Fall2011/502 TFCWNS , 22 3 Model boat/Howard Community College/fall2011/502 AHZ , 23 3 Apps/Howard Community College/Fall 2011/501 Creators , 24 3 Motivation and emotion/Book/2011/Self-efficacy and achievement , 25 3 Motivation and emotion/Book/Trauma recovery and growth

dez 2011: 1 7 TAO/Community members , 2 6 University of Canberra/RCC2012/Participants , 3 4 Helicopter/Howard Community College/Fall2011/550 Helicopter , 4 4 What is a computer? , 5 3 Rubberband gun/Howard Community College/fall2011/501 Rubberman2 , 6 3 Rubberband gun/Howard Community College/fall2011/550 JK , 7 3 Bridges/Howard Community College/fall2011/501 DAS 3 , 8 3 Escher/Howard Community College/fall2011/502 BMproject3 , 9 3 Robot arm/Howard Community College/Fall2011/502 TFCWNS , 10 3 Model boat/Howard Community College/fall2011/502 AHZ , 11 3 HoverCraft/Howard Community College/Fall2011/501 Glorious3 , 12 3 TAO/How to participate in the TAO Community of Practice? , 13 3 History of the Ottoman Empire , 14 2 Irish Pronunciation , 15 2 Sound and psychology , 16 2 Thimerosal and Autism? , 17 2 Arduino/RC Toy Hack , 18 2 TAO/Working with Volunteer Instructors: Best Practices , 19 2 Grub composting , 20 2 How to meditate , 21 2 The Journal of Sport and Exercise Studies/Business, Politics and Sport 2011 , 22 2 University of Canberra/RCC2012/Potential participants , 23 2 TAO/How to create a learning and/or research module?/Getting started , 24 2 Wikipedia/The history of Wikipedia , 25 2 UserMbaig7172/enes100/engine

jan 2012: 1 21 Big bang , 2 15 Panspermia , 3 13 Water fluoridation controversy , 4 11 University of Canberra/RCC2012/Participants , 5 7 Egm4313.s12.team7/Report1 , 6 6 Egm4313.s12.team5.R1 , 7 5 Egm4313.s12.team6 , 8 5 University of Canberra/RCC2012/Thursday dinner , 9 5 Katie Harwood , 10 4 University of Canberra/RCC2012 , 11 3 Big bang/A Critique of NASA scientist: Evidence of alien life on meteorite , 12 3 Egm4313.s12.team11.R1 , 13 3 UCusingwikis , 14 3 Big bang/A critique of Compton effect interpretation of solar red shift , 15 3 Panspermia/A critique of The dark side of the universe: from Zwicky to accelerated expansion , 16 3 Earth , 17 2 Caregiving and dementia , 18 2 Egm4313.s12.team6.reports/R1 , 19 2 Egm4313.s12.team7 , 20 2 Panspermia/A Critique ofWhy Do Some People Reject Panspermia? , 21 2 Panspermia/A critique of Panspermia—true or false , 22 2 Panspermia/A Critique of Protection of bacterial spores in space, a contribution to the discussion on panspermia , 23 2 Panspermia/a critique of Stardust Findings -Implications for Panspermia , 24 2 Panspermia/a critique of Panspermia—true or false? , 25 2 Panspermia/A Critique of Biological evidence against the panspermia theory

fev 2012: 1 18 Are humans causing global warming , 2 13 Invariant Tasks: Skill Builder Practice , 3 9 Concept Classification: Skill Builder Practice , 4 9 Understanding: Example , 5 8 Teaching Procedures, page 8 , 6 7 Egm4313.s12.team7/Report2 , 7 7 Egm4313.s12.team6.reports/R1 , 8 6 Egm4313.s12.teamboss/R3 , 9 6 Are humans causing global warming/a critique of Global warming and the export of dissolved organic carbon from boreal peatlands , 10 6 Egm4313.s12.team12.R2 , 11 6 Egm4313.s12.team5.R2 , 12 6 Cardboard boats/Themed , 13 6 Panspermia/A Critique of Protection of bacterial spores in space, a contribution to the discussion on panspermia , 14 5 Helicopter/Howard Community College/Spring2012/p502JASS , 15 5 3D Scan/Howard Community College/Spring2012/P1550jme , 16 5 Are humans causing global warming/A critique of Fingerprints of global warming on wild animals and plants , 17 5 Are humans causing global warming/A critique of Contributions of past and present human generations to committed warming caused by carbon dioxide , 18 5 Egm4313.s12.team5.R3 , 19 5 Egm4313.s12.team14.report2 , 20 5 A critique of The microbiologist looks at panspermia , 21 4 Egm4313.s12.team11.R3 , 22 4 Car Hack/Howard Community College/Spring2012/p1501kmd , 23 4 Wind Turbine/Howard Community College/Spring2012/p1502sid , 24 4 HoverCraft/Howard Community College/Spring2012/p1550JJIW , 25 4 Power projects/Howard Community College/Spring2012/p1550KMN

mar 2012: 1 18 Nuclear power greener , 2 16 Was there a mitochondrial Eve? , 3 7 Egm4313.s12.teamboss/R5 , 4 7 Egm4313.s12.teamboss/R4 , 5 6 Egm4313.s12.team5.R5 , 6 6 Nuclear power greener/a critique of Nuclear power: renaissance or relapse? Global climate change and long-term Three Mile Island activists’ narratives. , 7 6 Nuclear power greener/A Critique of The role of nuclear energy in 21st century for sustainable development in Korea , 8 6 Egm4313.s12.team5.R4 , 9 5 Was there a mitochondrial Eve?/A Critique of Simulating the mitochondrial dna inheritance , 10 5 Was there a mitochondrial Eve?/a critique of Human demographic history: refining the recent African origin model , 11 5 Nuclear power greener/A critique of Leukaemia in young children living in the vicinity of German nuclear power plants , 12 5 3D Scan/Howard Community College/Spring2012/P1550jme , 13 4 Egm4313.s12.team11.R5 , 14 4 Was there a mitochondrial Eve?/A critique of Recent African origin of modern humans revealed by complete sequences of hominoid mitochondrial DNAs. , 15 4 Was there a mitochondrial Eve?/A critique of The Myth of Eve , 16 4 Was there a mitochondrial Eve?/A Critique of A complete Neadertal Mitochondrial genome sequence determined by high-throughput sequencing: A Review , 17 4 Was there a mitochondrial Eve?/A critique of Absence of Regional Affinities of Neandertal DNA With Living Humans Does Not Reject Multiregional Evolution , 18 4 Was there a mitochondrial Eve?/A critique of Genomics refutes an exclusively African origin of humans , 19 4 Egm4313.s12.team11.R4 , 20 4 Nuclear power greener/A Critique of Recent Advances in Nuclear Power: A Review , 21 4 Nuclear power greener/A Critique of CANDU reactors and greenhouse gas emissions , 22 4 Nuclear power greener/A critique of Risks of nuclear power , 23 4 Media literacy , 24 3 Was there a mitochondrial Eve?/A critique of Evidence for mitochondrial DNA recombination in a human population of island Melanesia , 25 3 Was there a mitochondrial Eve?/A critique of Whole-mtDNA Genome Sequence Analysis of Ancient African Lineages

abr 2012: 1 15 What killed the dinosaurs , 2 9 What killed the dinosaurs/A critique of More evidence that the Chicxulub impact predates the K/T mass extinction. Meteoritics & Planetary Science , 3 7 What killed the dinosaurs/Experimental evidence that an asteroid impact led to the extinction of many species , 4 7 Egm4313.s12.teamboss/R7 , 5 7 Egm4313.s12.teamboss/R6 , 6 6 Egm4313.s12.team5.R6 , 7 6 What killed the dinosaurs/A critique of From The Cover: Chicxulub impact predates the K-T boundary mass extinction , 8 5 Egm4313.s12.team11.R7 , 9 5 Egm4313.s12.team5.R7 , 10 5 What killed the dinosaurs/A Critique of The Extinction of the Dinosaurs in North America , 11 4 Egm4313.s12.team11.R6 , 12 4 What killed the dinosaurs/A critique of Volcanoes and extinctions: Round Two , 13 4 CIVICS , 14 3 Numeral systems , 15 3 What killed the dinosaurs/A critique of The Cretaceous-Tertiary mass extinction is due to the post-impact ozone conditions from the asteroid collision in the Yucatan Peninsula in northestern Mexico (The Chicxulub crater) , 16 3 What killed the dinosaurs/A Critique of Extraterrestrial Cause for the Cretaceous-Tertiary Extinction , 17 3 What killed the dinosaurs/A Critique of Lava Flows, Mass Extinctions, and Mantle Plumes , 18 3 Was there a mitochondrial Eve?/A critique of Whole-mtDNA Genome Sequence Analysis of Ancient African Lineages , 19 3 Helicopter/Howard Community College/Spring2012/p2502JASS , 20 3 Robot end effector/Howard Community College/Spring2012/p1501mjj2 , 21 3 Bridges/Howard Community College/spring2012/p2501msn , 22 3 Bridges/Howard Community College/spring2012/p2501jds , 23 3 Illuminate Clothing/Howard Community College/spring2012/I1550INC , 24 3 Was there a mitochondrial Eve? , 25 2 Cognitive Theory of MML Continued

mai 2012: 1 7 The History of the Paralympic Movement in Australia/Meetings/Brisbane 26 May 2012 , 2 4 Airplane Float/Howard community college/Spring2012/p3501msn , 3 4 University of Canberra/Critical Care Nursing , 4 3 A Hero of Our Time , 5 3 Dominant group/Business , 6 3 Bridges/Howard Community College/spring2012/p3501jds , 7 3 University of Canberra/Critical Care Nursing/Resources , 8 3 Wikipedia , 9 2 Guide for New Librarians , 10 2 Mental health and the internet , 11 2 Recommending places , 12 2 Craft of Poetry , 13 2 Psychedelic Poetry , 14 2 Courage , 15 2 Astronomical observatories , 16 2 Wikidata , 17 2 Countersinking , 18 2 Rube Goldberg/Howard Community College/Spring2012/p1501-SZ , 19 2 Anna Karenina , 20 2 Buddha’s Little Finger , 21 2 PD Neuroprotection/GM1 , 22 2 Envy , 23 2 Afterlife , 24 2 Master and Margarita , 25 2 Budda’s Little Finger

jun 2012: 1 3 Mathematical biophysics , 2 3 Guide for New Librarians , 3 3 Facilitating meaningful activity for people with dementia within residential facilities , 4 3 San Marino , 5 3 Philosophy message board/Archive , 6 3 Biophysics , 7 2 Nitrogen Compounds 1 , 8 2 Encorporating STEM in Va. Education , 9 2 Three States of Korea and Gaya Confederacy , 10 2 KinderCalculus/forever numbers , 11 2 Common phrasal verbs in English , 12 2 Enactments said to be unnecessary and such like , 13 2 Understanding Digital Communications , 14 2 Understanding Information Theory , 15 2 Nonabelian Quantum Algebraic Topology , 16 2 Paths of Glory (Game) , 17 2 Aerodynamics course , 18 2 Mathematical Biology , 19 2 Biomathematics , 20 2 States Founding Myths around the World , 21 2 History of the Goguryeo Empire , 22 2 Teaching About Africa Using New Media Resources In the Classroom , 23 2 Errors in the spoken English of EFL learners , 24 2 MathJax Test , 25 2 Yoneda lemma

jul 2012: 1 6 Academic writing , 2 4 Wikiworld , 3 2 Learning Habits , 4 2 Walsh permutation; bit permutation , 5 2 Walsh permutation; bit permutation; calc , 6 2 Filling Scuba Cylinders , 7 2 The Environment , 8 2 Introduction to Composite Materials , 9 2 Atypical parkinsonism , 10 2 Stellar science , 11 2 Three States of Korea and Gaya Confederacy , 12 2 Gojoseon Emperors Timeline , 13 2 History of the Goguryeo Empire , 14 2 Goguryeo Project , 15 2 History of Korea , 16 2 Deficiencies as PD cause/Glutathione , 17 2 Gojoseon Empire , 18 2 Geometry/Chapter 1/ Lesson 1 (Identify Points, Lines, and Planes) , 19 2 Infection as PD cause/Melanoma , 20 2 Auto manicure , 21 2 Spirituality , 22 2 Doctor of Philosophy , 23 2 Cambodia , 24 2 History of the Ottoman Empire , 25 2 Sources of Credit Reports/Credit Report Components

ago 2012: 1 13 Cultural Encounters , 2 6 Caregiving and dementia/Participants , 3 4 Bon appetit , 4 3 \"Nice to meet you!\" , 5 3 Leisure time , 6 3 Introduction to Python for FEniCS , 7 3 Human Legacy Course , 8 3 Wikiworld , 9 3 Violin 101 , 10 2 Symptomatic Relief for PD/Dyskinesia , 11 2 Dating and Romantic Relationships , 12 2 Caregiving and dementia/Wiki training/Emails , 13 2 Computer architecture/Introduction , 14 2 Leaders , 15 2 Balti Foods , 16 2 Mba rankings , 17 2 Holidays and celebrations , 18 2 You are what you wear , 19 2 National stereotypes , 20 2 Dating and romance , 21 2 Onphd , 22 2 Computer Science/Help , 23 2 TAO/Wikimedia Seniors Outreach , 24 2 Inversion (discrete mathematics) , 25 2 Web programming, an example

set 2012: 1 21 Collaborative computing , 2 20 Was there a mitochondrial Eve? , 3 18 What killed the dinosaurs , 4 16 Water fluoridation controversy , 5 8 Emerging Web Technologies , 6 7 Caregiving and dementia/Participants , 7 7 Was there a mitochondrial Eve?/A critique of Whole-mtDNA Genome Sequence Analysis of Ancient African Lineages , 8 6 TAO/Handbook/Examples of users and communities , 9 6 Water fluoridation controversy/A Critique of Arsenic and Fluoride Exposure in Drinking Water: Children's IQ and Growth in Shanyin County, Shanxi Province, China , 10 6 TAO/Handbook , 11 6 Was there a mitochondrial Eve?/A critique of Recent African origin of modern humans revealed by complete sequences of hominoid mitochondrial DNAs. , 12 5 Igloo/Howard Community College/Fall2012/p1-502-lmra , 13 5 Door access/Howard Community College/Fall2012/p1-502-hwht , 14 5 Water fluoridation controversy/A critique of Hip Fracture Incidence before and after the Fluoridation of the Public Water Supply, Rochester, Minnesota , 15 5 Water fluoridation controversy/A Critique of Water Fluoridation , 16 5 What killed the dinosaurs/Experimental evidence that an asteroid impact led to the extinction of many species , 17 5 What killed the dinosaurs/A Critique of The Extinction of the Dinosaurs in North America , 18 5 Was there a mitochondrial Eve?/A Critique of A complete Neadertal Mitochondrial genome sequence determined by high-throughput sequencing: A Review , 19 4 Was there a mitochondrial Eve?/A critique of The Origins of Modern Humans: Multiregional or Out of Africa? , 20 4 HoverCraft/Howard Community College/Fall2012/p1501east , 21 4 HoverCraft/Howard Community College/Fall2012 , 22 4 SnakeHat/Howard Community College/fall2012/p1-502-aks , 23 4 BarCode/Howard Community College/fall2012/p1-503-nwzz , 24 4 StrandBeest/Howard Community College/fall2012/p1-550-owa , 25 4 Water fluoridation controversy/A Critique of Physiology and toxicity of fluoride

out 2012: 1 14 What killed the dinosaurs , 2 14 Are humans causing global warming , 3 14 Nuclear power greener , 4 6 Emerging Web Technologies , 5 6 A critique of Is a Signature of Socio-economic Impact written on the Climate? , 6 5 Rep5hid , 7 5 Robot car/Howard Community College/Fall2012/p1-503-mcf , 8 5 Nuclear power greener/A critique of Leukaemia in young children living in the vicinity of German nuclear power plants , 9 5 Are humans causing global warming/A critique of Contributions of past and present human generations to committed warming caused by carbon dioxide , 10 5 Are humans causing global warming/A Critique of Global warming and long term climatic changes: a progress report. , 11 5 Water fluoridation controversy , 12 5 Was there a mitochondrial Eve? , 13 4 Are humans causing global warming/A Critique of Global-scale temperature patterns and climate forcing over the past six centuries , 14 4 Are humans causing global warming/A Critique of Global warming and human activity: A model for studying the potential instability of the carbon dioxide/temperature feedback mechanism,Ecological Modeling. , 15 4 Igloo/Howard Community College/Fall2012/p1-502-lmra , 16 4 ComboLockPick/Howard Community College/Fall2012/p1-502-cmsb , 17 4 SnakeHat/Howard Community College/fall2012/p1-502-aks , 18 4 Corn Starch/Howard Community College/fall2012/p1-550-soc , 19 4 What killed the dinosaurs/Experimental evidence that an asteroid impact led to the extinction of many species , 20 4 What killed the dinosaurs/A Critique of Extraterrestrial Cause for the Cretaceous-Tertiary Extinction , 21 4 Nuclear power greener/A Critique of A Comparison between Fossil and Nuclear Power Plants Pollutions and Their Environmental Effects. , 22 4 Nuclear power greener/A critique of Nuclear power and the environment: comparative assessment of environmental and health impacts of electricity-generating systems. , 23 4 Are humans causing global warming/a critique of Global warming and the export of dissolved organic carbon from boreal peatlands , 24 3 Static electricity/Howard Community College/Fall2012/p2-502-mw , 25 3 Arduino Motor Control/Howard Community College/Fall2012/P2-501-CDMN

nov 2012: 1 13 Panspermia , 2 6 Web Technologies Master List , 3 6 Nuclear power greener , 4 6 LHC black hole risk , 5 5 LangCamp 2012 , 6 4 International Digital Rights , 7 4 Helicopter/Howard Community College/Fall2012/p3-550-mww , 8 4 HoverCraft/Howard Community College/Fall2012/p3501 NEKK , 9 4 Robot car/Howard Community College/Fall2012/p3-501 CMLA , 10 4 Static electricity/Howard Community College/Fall2012/p3-502-hkm , 11 4 Igloo/Howard Community College/Fall2012/p1-502-lash , 12 4 SnakeHat/Howard Community College/fall2012/p-3-502-hwrm , 13 4 StrandBeest/Howard Community College/fall2012/p3-550-ocm , 14 4 Arduino Motor Control/Howard Community College/Fall2012/P2-501-CDMN , 15 4 Rube Goldberg/Howard Community College/Fall2012/p2-504-fcrd , 16 3 Web technologies master list , 17 3 Corn Starch/Howard Community College/Fall 2012/SOC 2 , 18 3 ComboLockPick/Howard Community College/Fall2012/p3-502-lynn , 19 3 Robot car/Howard Community College/Fall2012/p3-503 TZN , 20 3 Multimeter Arduino/Howard Community College/Fall2012/p2-550-oq , 21 3 Health education and development/Critical essay , 22 3 Health education and development , 23 3 HoverCraft/Howard Community College/Fall2012/p2-501 RAJK , 24 3 Static electricity/Howard Community College/Fall2012/p2-502-mw , 25 3 Door access/Howard Community College/Fall2012/p2-502-cash

dez 2012: 1 7 LangCamp 2012/Minangkabau language , 2 7 LHC black hole risk , 3 5 LangCamp 2012 , 4 4 LHC black hole risk/a critique of Correction to the Higher Dimensional Black Hole Entropy , 5 4 Web Technologies Master List , 6 4 Hydraulic ram/Howard Community College/Fall2012/p3501ATandT , 7 4 Static electricity/Howard Community College/Fall2012/p3-502-hkm , 8 3 Living Self-sufficiency in London , 9 3 Indigenous and Intercultural Health , 10 3 SAE Car/Howard Community College/Fall2012 , 11 3 LHC black hole risk/A critique of ''Critical Revision of LHC risks and communication''. , 12 3 LHC black hole risk/A Critque of: Review of the Safety of LHC Collisions , 13 3 LangCamp 2012/Balinese language , 14 3 HoverCraft/Howard Community College/Fall2012/p3501 NEKK , 15 3 Robot car/Howard Community College/Fall2012/p3-501 CMLA , 16 3 Attendance/Howard Community College/fall2012/p3-503-ff , 17 3 StrandBeest/Howard Community College/fall2012/p3-550-ocm , 18 3 TAO/Silver Knowledge , 19 2 Rodger's Method , 20 2 A-Level Mechanics - Vectors , 21 2 Online social entrepreneurship , 22 2 Corporations Kill Innovation , 23 2 Damm algorithm , 24 2 Gravitational model of strong interaction , 25 2 Indigenous and Intercultural Health/Community-Based Project

jan 2013: 1 9 MoM-s13-team5-R1 , 2 8 Selected topics in finite mathematics/Linear programming , 3 8 Selected topics in finite mathematics/Eulerian cycles , 4 7 Selected topics in finite mathematics , 5 5 Selected topics in finite mathematics/Minimum spanning trees , 6 5 Selected topics in finite mathematics/Hamiltonian cycles , 7 5 Selected topics in finite mathematics/What is a graph , 8 4 Egm3520.s13.team1.r1 , 9 4 Selected topics in finite mathematics/Transportation problems , 10 4 Selected topics in finite mathematics/Bin Packing , 11 4 SPIR608 Political Simulations and Gaming/2013 , 12 4 Rodger's Method , 13 3 Ethical medical research/Alternatives to animal testing , 14 3 Caregiving and dementia/Topics/Diagnosing dementia , 15 3 Kedar Joshi Quotes , 16 2 Selected topics in finite mathematics/Graph coloring , 17 2 SPIR608 Political Simulation and Gaming/2013/Week 3 , 18 2 Introduction to Parkinson's Science/Q Page 90 , 19 2 Algebra/Vectors in two dimensions , 20 2 SPIR608 Political Simulations and Gaming/2013/Week 1 , 21 2 Fida's Structure , 22 2 Perfect Syllogism , 23 2 Infection as PD cause/Influenza , 24 2 Riemann hypothesis , 25 2 Regions

fev 2013: 1 11 Selected topics in finite mathematics , 2 10 Open Education Week 2013/La Trobe University Open Conference , 3 9 EGM3520.s13.team5.r3 , 4 9 Selected topics in finite mathematics/Sets, logic, and arguments , 5 8 Selected topics in finite mathematics/Monotonic , 6 7 Report 2 Voc Quoc , 7 7 Egm3520.s13.team1.r2 , 8 6 Eml4507 Team7 Report3 , 9 6 Selected topics in finite mathematics/Pareto condition , 10 6 Selected topics in finite mathematics/Independent of irrelevant alternatives , 11 6 Selected topics in finite mathematics/Majority criterion , 12 6 Eml4507 Team7 Report2 , 13 5 Egm3520.s13.team1.r3 , 14 5 Team Negative Damping (3): Report 3 , 15 5 Engineering Experience 4: Design a Small Solar Vehicle/Nl/2013: Team PM5 , 16 5 Selected topics in finite mathematics/Voting/Plurality , 17 4 Engineering Experience 4: Design a Small Solar Vehicle/Nl/2013: Team PM6 , 18 4 Selected topics in finite mathematics/Voting/Borda count , 19 4 Selected topics in finite mathematics/Voting/Condorcet method , 20 4 Egm3520.s13.team4.r2 , 21 3 Ageing and intellectual disability , 22 3 Engineering Experience 4: Design a Small Solar Vehicle/Nl/2013: Team AM9 , 23 3 Engineering Experience 4: Design a Small Solar Vehicle/Nl/2013: Team AM6 , 24 3 Selected topics in finite mathematics/Dropout criterion , 25 3 Open Access in Latin America

mar 2013: 1 9 Web 2.0 , 2 8 Open Education Week 2013/La Trobe University Open Conference , 3 7 Egm3520.s13.team5.r5 , 4 7 Egm3520.s13.team5.r4 , 5 5 Report 4 Team 7 , 6 5 Selected topics in finite mathematics/Voting coalitions , 7 5 Computer Architecture Lab/SS2013 , 8 4 Selected topics in finite mathematics/Managing your money , 9 4 Egm3520.s13.team1.r5 , 10 4 Eml4507 Team 7 Report 5 , 11 4 Selected topics in finite mathematics/Weighted voting , 12 4 Open Education Week 2013/La Trobe University Open Conference/Critical ideas , 13 3 Mom-s13-team4-R5 , 14 3 Team Negative Damping (3): Report 5 , 15 3 Catalogue 22 , 16 3 Team Negative Damping (3): Report 4 , 17 3 Open Education Week 2013/La Trobe University Open Conference/Introductions and agenda , 18 3 C.N.S.C. Field Station , 19 3 Open Education Week 2013/La Trobe University Open Conference/Practical steps, getting started , 20 3 Open Education Week 2013/La Trobe University Open Conference/Producing OERs , 21 3 Open Education Week 2013/La Trobe University Open Conference/Who's doing what , 22 3 Ageing and intellectual disability , 23 3 Engineering Experience 4: Design a Small Solar Vehicle/Nl/2013: Team AM13 , 24 3 Engineering Experience 4: Design a Small Solar Vehicle/Nl/2013: Team AM3 , 25 3 Selected topics in finite mathematics/Independent of irrelevant alternatives

abr 2013: 1 6 Selected topics in finite mathematics/Taxes , 2 6 Wikimedia in higher education/2013/University of Sydney , 3 5 EGM3520.s13.team5.r6 , 4 5 Selected topics in finite mathematics/Managing your money , 5 5 Computer Architecture Lab/SS2013 , 6 4 Team 7 Report 7 , 7 4 Team Negative Damping (3): Report 6 , 8 4 Eml4507 Team 7 Report 6 , 9 4 Egm3520.s13.team1.r6 , 10 3 University of Wollongong , 11 2 Bible, English, King James, According to the two-source hypothesis , 12 2 Mary Mote - Federal Writers' Project - Life Histories , 13 2 PD Gene Therapy/RNA interference , 14 2 Eml4507.s13.team3.andersondavyr7 , 15 2 Civilmonetarymodel , 16 2 Edith Wallick - Federal Writers' Project - Life Histories , 17 2 Riphah international university , 18 2 \"A Southern Gentleman\" (Seaboard, NC) - Federal Writers' Project - Life Histories , 19 2 Callie Hines - Federal Writers' Project - Life Histories , 20 2 Jim Parker - Federal Writers' Project - Life Histories , 21 2 Estelle Stancill - Federal Writers' Project - Life Histories , 22 2 Earl M. Lasker - Federal Writers' Project - Life Histories , 23 2 John McClenny- Federal Writers' Project- Life Histories , 24 2 Jennie Chambers - Federal Writers' Project - Life Histories , 25 2 Gertie Deal - Federal Writers' Project - Life Histories

Note: Before the official launch of Wikiversity as a project, in August 2006,
some course materials were already produced on Wikibooks.
Wikistats pages that show monthly trends include that early history.

Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Quinta-feira, 6 de junho 2013 04:55

Dump file enwikiversity-20130509-pages-meta-history.xml.7z (full dump), size 147 Mb as 7z -> 13 Gb
Dump processed till Apr 30, 2013, on server stat1, ready at Fri-17/05/2013-17:06 after 27 min, 16 sec.

Versão do script:2.6
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.