Estatísticas da Wikiversity finlandês

Zoom           
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist
 
Monthly counts & Quarterly rankings
 
DataContributorsArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
out 2009+5%   +1%   -11%+4%+2%0%+3%-3%+16% 
set 20090%   0%   +63%+1%+1%+1%-2%+1%+2% 
ago 2009+10%   0%   -46%0%0%0%+14%-1%-1% 
jul 2009    +1%   -19%+4%+3%+2%+13%+9%+11% 
jun 2009    +3%   +688%+2%+1%+1%+35%+6%-16% 
mai 2009    0%   -90%0%0%+1%0%0%0% 
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
out 20092312 259 8,434721291,1 Mb117 k42940981,1 k5
set 200922 3 257 8,034241451,1 Mb114 k429391019165
ago 20092223 256 7,43420891,0 Mb114 k426401008975
jul 20092025 256 7,134161661,0 Mb114 k425351019034
jun 20091825 254 6,533372051,0 Mb110 k41531938102
mai 20091611 247 5,83395261010 kb109 k41023889691
abr 200915121246 5,834042671008 kb109 k40423889661
mar 200914   246 4,73402431007 kb109 k4051488960 
fev 200914 4 244 4,53385159995 kb107 k4051488936 
jan 20091435 232 4,13460166965 kb104 k3541186891 
dez 20081125 22613,53135199865 kb90 k335781834 
nov 2008935119013,13328433776 kb80 k249769709 
out 2008611 15111,0347717640 kb64 k193755507 
set 20085   134 1,0349410564 kb57 k153750392 
ago 20085   124 1,03272 492 kb50 k133741363 
jul 20085   124 1,032722492 kb50 k133741363 
jun 2008512 12221,0331856491 kb50 k131741360 
mai 20084   66 1,04188 339 kb34 k10277196 
abr 2008423 6611,0418833339 kb34 k10277196 
mar 20082 1 3311,0452816187 kb20 k4975180 
fev 2008211 17 1,04630993 kb10 k1872115 
jan 2008111 8 1,01715819 kb1,6 k14  26 
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
 ContributorsArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

Contributors (usuários registrados)
A = Contributors que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de contributors que editaram pelo menos dez vezes desde que chegaram
C = Contributors que contribuíram cinco vezes ou mais este mês
D = Contributors que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Namespaces: Articles = 0   Talk = 1,3,5,7,9,..   Other = 2,4,6,8,..

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 5  10  25  100  5  5  5  5  10  25  5 
out 200922     1   
set 200931     31  
ago 200932     41  
jul 2009553  1 321 
jun 2009533  1     
mai 20091      33  
abr 20092221   64  
mar 2009           
fev 2009432        
jan 200955         
dez 2008532        
nov 20085441       
out 20081          
set 2008           
ago 2008           
jul 2008           
jun 2008221        
mai 2008           
abr 200832         
mar 20081          
fev 20081          
jan 20081      1   

 

Distribuição de edições de artigos por contributors
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=ContributorsEdições total
196100.0%1577100.0%
34243.8%149294.6%
102222.9%138587.8%
321212.5%119175.5%
10066.2%88856.3%

 

17 contributors recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesPrimeira edição
ArtigosOutros
 posiçãoúltimos
30 dias
totaltotalúltimos
30 dias
datadias
atrás
agoraΔ
Satun1 01206  nov 07, 2008357
Arongas4+21211114 abr 06, 2008572
Tarmo7+1260213abr 11, 2009202
Str4nd16 012440 jun 19, 2009133
Lilli20+69111277set 27, 200933
Crt24+22910 abr 13, 2009200
Mjlassila30+574544set 25, 200935
Teromakotero35+4141 jul 16, 2009106
Chwaege36+41481jul 29, 200993
Marika7042...44  out 08, 200922
Sus47+1213  set 28, 200932
Lseilone48...33  out 02, 200928
XmaceX52+121211out 26, 2008369
Kotala65+2112  set 25, 200935
Splyysh66+2212  set 26, 200934
Eevahl67...22  out 07, 200923
Tititamminen96...11  out 06, 200924

 

20 contributors recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesPrimeira ediçãoúltima edição
 posiçãototaldatadias
atrás
datadias
atrás
Crochet.david2186jan 27, 2008642ago 18, 200973
RobH3184abr 07, 2009206abr 07, 2009206
Crochet.david.bot5101abr 07, 2009206set 14, 200946
Iskpop6100nov 28, 2008336fev 17, 2009255
Lamberg859dez 19, 2008315fev 02, 2009270
Hillgentleman951out 22, 2008373abr 06, 2009207
Rammac1048set 24, 2008401jun 18, 2009134
Jpurma1144jul 02, 2009120set 28, 200932
Sue.harrison1241nov 10, 2008354dez 10, 2008324
Astevanoska1329dez 09, 2008325mar 28, 2009216
Juhana1428mar 17, 2008592jul 04, 2009118
Erkan_Yilmaz1524jun 15, 2008502jun 16, 2008501
Sentree_Saatana1720ago 07, 200984ago 07, 200984
Gdimeski1819dez 10, 2008324jan 30, 2009273
Pe31917jan 29, 2008640jun 25, 2008492
Raimondo2111fev 02, 2008636abr 23, 2009190
Peeii2210abr 06, 2008572abr 07, 2008571
Vnovegil239nov 28, 2008336mar 19, 2009225
Villevenalainen259jun 23, 2009129jun 29, 2009123
Jylipiha269set 17, 200943set 17, 200943

 

usuários anônimos, ordenados por número de contribuições
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
161.76.9.367
88.148.195.1350
91.155.233.18150
91.155.239.9234
130.232.49.7332
90.212.59.17119
90.203.251.22619
193.136.33.22117
80.223.22.6216
153.1.181.19416

No total 599 edições foram feitas por usuários anônimos, de um total de 2178 edições ( 27e %)
 


Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110JpgPng
out 20092808843341132      95%21
set 20092747843341132      96%21
ago 20092717142136129      96%11
jul 20092706332135126      96%11
jun 20092655331129120      96% 1
mai 20092494031127 20      99% 1
abr 20092473731127 12      100% 1
mar 2009245 1 127 12      100%  
fev 2009243 1 127 12      100%  
jan 2009231 1 125 11      100%  
dez 2008225   125 11      100%  
nov 2008196   125 10      100%  
out 2008150   125 10      100%  
set 2008134   125 10      100%  
ago 2008124   125 8      100%  
jul 2008124   125 8      100%  
jun 2008122   124 8      100%  
mai 200866   124 8      100%  
abr 200866   122 8      100%  
mar 200833   122 8      100%  
fev 200817   122 8      100%  
jan 20088   122 4      100%  

 

20 most edited articles (> 25 edits)
 

EdiçõesUnique usersArtigosArchived
TotalReg.Reg.Unreg.
11449%1128New Methods of Assessment/Small group< 1 Mb  
9595%73Vapaiden ja avointen oppiresurssien tuottaminen2.1 Mb  
9284%4010Vapaiden ja avointen oppiresurssien tuottaminen/Osallistujat< 1 Mb  
7919%413Uudet lukutaidot< 1 Mb  
7076%65Harppaus avoimeen oppimiseen< 1 Mb  
6398%31Construction Management cases< 1 Mb  
6242%46Goce Dimeski< 1 Mb  
6075%63New Methods of Assessment/Tutors< 1 Mb  
5459%43New Methods of Assessment/Study Guide< 1 Mb  
4947%45New Methods of Assessment/Group work on chosen technology1< 1 Mb  
4461%2010Harppaus avoimeen oppimiseen/Ilmoittautuminen< 1 Mb  
3879%54Ankica Stevanoska Jancheska< 1 Mb  
3768%33New Methods of Assessment/Group work on chosen technology3< 1 Mb  
3511%24Boban Jakimovski< 1 Mb  
3187%103Wikiopisto:Kahvihuone< 1 Mb  
300% 1Julkinen sosiologia< 1 Mb  
2945%31New Methods of Assessment/Overview of the course structure< 1 Mb  
2945%35New Methods of Assessment/Group work on chosen technology2< 1 Mb  
2868%43Introduction to e-Assessment and the e-Learning Tools2< 1 Mb  
2580%61Introduction to e-Assessment and the e-Learning Tools1< 1 Mb  

 

ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

jan 2008: 1 1 Tietotyön johtaminen/muistiinpanot 17.1

fev 2008: 1 1 Tietotyön johtaminen/kahvihuone

mar 2008: 1 1 Tietotekniikka 3/loppuraportti 3

abr 2008: 1 1 Hae Mediawikin asennuspaketti

jun 2008: 1 1 Verkkokurssin suunnittelu/Digitaalinen sisällöntuotanto/Organisaatioiden sisällöntuotannon vertailua

jul 2008: 1 1 Kuvitussuunnitelma

set 2008: 1 1 Luku 14

out 2008: 1 1 Kamerapuhelimen käyttö opetustilanteessa

nov 2008: 1 6 New Methods of Assessment/Tutors , 2 4 New Methods of Assessment/Study Guide , 3 4 New Methods of Assessment/Small group , 4 4 New Methods of Assessment/Group work on chosen technology1 , 5 2 Wikis , 6 1 Writing of Wiki Article3

dez 2008: 1 9 New Methods of Assessment/Small group , 2 3 Vicente Novegil , 3 3 Introduction to e-Assessment and the e-Learning Tools1 , 4 2 Ulkar Bayramova , 5 2 Zoran Filov , 6 2 Goce Dimeski , 7 2 Boban Jakimovski

jan 2009: 1 4 New Methods of Assessment/Pairs , 2 2 Ulkar Bayramova , 3 2 Ankica Stevanoska Jancheska , 4 1 Construction Management cases

fev 2009: 1 2 Ulkar Bayramova, AR Implementation , 2 2 Goce Dimeski, AR Implementation , 3 2 Boban Jakimovski, AR Implementation , 4 2 Ankica Stevanoska Jancheska, AR Implementation

mar 2009: 1 1 Ankica Stevanoska Jancheska, AR Implementation

abr 2009: 1 8 Etusivu , 2 3 Kansainvälinen tähtitieteen vuosi , 3 2 Vuosijuhla 2009 , 4 2 Wikiopiston opintotarjonta , 5 2 Perinteinen luokkahuoneopetus sosiaaliseen mediaan , 6 2 Kurssi-ideoita , 7 1 Ulkar Bayramova, AR Implementation

mai 2009: 1 3 Perinteinen luokkahuoneopetus sosiaaliseen mediaan , 2 1 IBrain-lukupiiri

jun 2009: 1 7 Harppaus avoimeen oppimiseen/Ilmoittautuminen , 2 4 IBrain-lukupiiri , 3 3 IBrain-lukupiiri/Linkkejä , 4 2 IBrain-lukupiiri/Kirja-arvio , 5 2 IBrain-lukupiiri/Luku 9

jul 2009: 1 5 Vapaiden ja avointen oppiresurssien tuottaminen/Osallistujat , 2 5 Harppaus avoimeen oppimiseen/Ilmoittautuminen , 3 3 Harppaus avoimeen oppimiseen , 4 3 Wikiopiston opintotarjonta , 5 2 Vapaiden ja avointen oppiresurssien tuottaminen , 6 2 Kurssi-ideoita

ago 2009: 1 16 Vapaiden ja avointen oppiresurssien tuottaminen/Osallistujat , 2 5 Vapaiden ja avointen oppiresurssien tuottaminen , 3 5 Harppaus avoimeen oppimiseen , 4 4 Harppaus avoimeen oppimiseen/Ilmoittautuminen , 5 3 AVOkurssi

set 2009: 1 20 Vapaiden ja avointen oppiresurssien tuottaminen/Osallistujat , 2 5 Harppaus avoimeen oppimiseen/Ilmoittautuminen , 3 3 Vapaiden ja avointen oppiresurssien tuottaminen , 4 1 Luentomuistiinpanot

out 2009: 1 11 Vapaiden ja avointen oppiresurssien tuottaminen/Osallistujat , 2 3 Wikiopiston opintotarjonta , 3 2 Mediakasvatus ja uudet lukutaidot , 4 1 R-harjoituksia yhteiskuntatieteilijöille

Note: Before the official launch of Wikiversity as a project, in August 2006,
some course materials were already produced on Wikibooks.
Wikistats pages that show monthly trends include that early history.

Estatísticas geradas em Terça-feira, 24 de novembro 2009 a partir de cópias do banco de dados SQL de Sábado, 31 de outubro 2009
Versão do script:2.5
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
For documentation see meta
Scripts: scripts.zip

All data and images on this page are in the public domain.