Estatísticas da Wikcionário anglo-saxon

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist

Metrics have been collected from a full archive dump, which contains all revisions of every article, meta data and raw content.
See also metrics definitions


 
Monthly counts & Quarterly rankings: fevereiro 2014
 
DataWikcionaristasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
fev 2014    +1%   +110%0%0%+1%0%0% -1%
jan 2014    0%   -65%-0%-0%0%0%0% 0%
dez 2013    0%   +70%+1%0%-0%+2%0% +2%
nov 2013    0%   +79%0%-0%+1%+1%0% 0%
out 2013    -0%   +156%-0%-0%-0%0%0% 0%
set 2013    0%   -90%0%0%0%-0%0% 0%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
fev 201412 112,1 k 16,72444101,5 Mb85 k7,5 k37 k202263
jan 201412 112,1 k 16,62461951,5 Mb84 k7,5 k37 k202266
dez 201312 1 2,1 k 16,52475541,5 Mb85 k7,4 k37 k202266
nov 201312 112,1 k 16,32473251,5 Mb85 k7,4 k36 k202262
out 201312 112,1 k 16,12471821,5 Mb85 k7,4 k36 k202261
set 201312 1 2,1 k 16247711,5 Mb85 k7,4 k36 k202261
ago 2013121212,1 k 162487401,5 Mb85 k7,4 k36 k202261
jul 2013111112,1 k 15,72475351,5 Mb84 k7,4 k35 k202261
jun 201310   2,1 k 15,52491241,5 Mb85 k7,4 k35 k202260
mai 201310   2,1 k 15,42491731,5 Mb85 k7,4 k35 k202260
abr 201310   2,1 k 15,3249761,5 Mb85 k7,4 k35 k202259
mar 201310   2,1 k 15,3249711,5 Mb85 k7,4 k34 k202260
fev 201310   2,1 k 15,32491091,5 Mb85 k7,4 k34 k202260
jan 201310   2,1 k 15,22492241,5 Mb85 k7,4 k34 k202260
dez 201210   2,1 k 15,12491621,5 Mb85 k7,4 k34 k202260
nov 201210   2,1 k 15249951,5 Mb85 k7,4 k34 k202260
out 201210 1 2,1 k 152491941,5 Mb85 k7,4 k34 k202260
set 201210   2,1 k 14,92491871,5 Mb85 k7,4 k34 k202260
ago 201210 1 2,1 k 14,82492131,5 Mb85 k7,4 k33 k202260
jul 20121011 2,1 k 14,72483831,5 Mb84 k7,4 k33 k202260
jun 20129   2,1 k 14,52482061,5 Mb84 k7,4 k33 k202260
mai 20129   2,1 k 14,42482901,5 Mb84 k7,4 k33 k202260
abr 20129   2,1 k 14,32482951,5 Mb84 k7,4 k33 k202260
mar 20129   2,1 k 14,22481641,5 Mb84 k7,4 k33 k202260
fev 2012911 2,1 k 14,12481641,5 Mb84 k7,4 k32 k19 260
jan 20128   2,1 k 142481321,5 Mb84 k7,4 k32 k6 260
dez 20118   2,1 k 13,92485331,5 Mb84 k7,4 k32 k6 260
nov 20118   2,1 k 13,72484921,5 Mb84 k7,4 k31 k6 260
out 20118 1 2,1 k 13,52475411,5 Mb84 k7,4 k31 k6 260
set 20118   2,1 k 13,2247571,4 Mb84 k7,3 k30 k6 260
ago 20118   2,1 k 13,2247851,4 Mb84 k7,3 k30 k6 260
jul 20118   2,1 k 13,12471111,4 Mb84 k7,3 k30 k6 260
jun 20118   2,1 k 13,12472231,4 Mb84 k7,3 k30 k6 260
mai 20118   2,1 k 132472441,4 Mb84 k7,3 k29 k6 260
abr 20118   2,1 k 12,92473431,4 Mb84 k7,3 k29 k6 260
mar 20118   2,1 k 12,72473061,4 Mb84 k7,3 k29 k6 260
fev 20118   2,1 k 12,62472221,4 Mb84 k7,3 k28 k6 260
jan 20118   2,1 k 12,52472481,4 Mb84 k7,3 k28 k61260
dez 20108   2,1 k 12,32472521,4 Mb84 k7,3 k28 k61260
nov 20108 1 2,1 k 12,22483301,4 Mb84 k7,3 k28 k61260
out 20108 112,1 k 12,12483851,4 Mb84 k7,3 k27 k61260
set 20108 112,1 k 11,92484431,4 Mb84 k7,3 k27 k61259
ago 20108 112,1 k 11,72483541,4 Mb84 k7,3 k27 k61259
jul 20108 112,1 k 11,52484841,4 Mb84 k7,3 k26 k61259
jun 20108 112,1 k 11,32483961,4 Mb84 k7,3 k26 k61259
mai 20108 112,1 k 11,12483411,4 Mb84 k7,3 k25 k61259
abr 20108 112,1 k 10,92481961,4 Mb84 k7,3 k25 k61259
mar 20108 112,1 k 10,92482431,4 Mb84 k7,3 k25 k61259
fev 20108 112,1 k 10,72483121,4 Mb84 k7,3 k25 k61259
jan 20108 112,1 k 10,62482941,4 Mb84 k7,3 k24 k61259
dez 20098 112,1 k 10,52483211,4 Mb84 k7,3 k24 k61259
nov 20098 112,1 k 10,32483791,4 Mb84 k7,3 k24 k61259
out 20098 112,1 k 10,12483551,3 Mb84 k7,3 k23 k61258
set 20098 112,1 k 102473111,3 Mb84 k7,3 k23 k61258
ago 20098 112,1 k 9,82475341,3 Mb84 k7,3 k23 k61258
jul 20098 112,1 k 9,62472141,3 Mb84 k7,3 k22 k61258
jun 20098 212,1 k 9,52472371,3 Mb84 k7,3 k22 k61254
mai 20098 112,1 k 9,32473841,3 Mb84 k7,3 k22 k61251
abr 20098 112,1 k 9,22472931,3 Mb84 k7,3 k21 k61251
mar 20098 322,1 k192478731,3 Mb84 k7,3 k21 k61251
fev 200982212,1 k 8,72404571,3 Mb81 k6,9 k20 k71243
jan 20096 1 2,1 k18,52341541,3 Mb79 k6,8 k19 k71232
dez 2008611 2,1 k 8,52311181,2 Mb78 k6,7 k19 k61232
nov 20085   2,0 k 8,5232891,2 Mb78 k6,7 k19 k61232
out 20085   2,0 k 8,5232271,2 Mb78 k6,7 k19 k71232
set 20085   2,0 k 8,4232841,2 Mb78 k6,7 k19 k61232
ago 20085   2,0 k 8,42321421,2 Mb78 k6,7 k19 k61232
jul 20085   2,0 k 8,32322281,2 Mb78 k6,7 k18 k61232
jun 20085 112,0 k38,22324121,2 Mb78 k6,7 k18 k61232
mai 20085   2,0 k 8,42413131,2 Mb77 k6,5 k16 k71232
abr 20085 1 2,0 k 8,3241911,2 Mb77 k6,5 k15 k71232
mar 2008512 1,9 k 8,22402391,2 Mb76 k6,5 k15 k71231
fev 2008412 1,9 k 8,12403281,2 Mb76 k6,4 k15 k71230
jan 20083   1,9 k 82394191,2 Mb76 k6,4 k15 k71229
dez 20073   1,9 k 7,7239751,1 Mb76 k6,4 k14 k71229
nov 20073   1,9 k 7,7239301,1 Mb76 k6,4 k14 k71229
out 20073   1,9 k 7,72391521,1 Mb76 k6,4 k14 k71229
set 20073 1 1,9 k 7,6239641,1 Mb76 k6,4 k14 k71229
ago 20073 1 1,9 k 7,6239561,1 Mb76 k6,4 k13 k71229
jul 20073   1,9 k 7,6240921,1 Mb76 k6,4 k13 k71220
jun 20073 1 1,9 k27,52421611,1 Mb76 k6,5 k13 k755219
mai 20073 111,9 k67,62448861,1 Mb75 k6,6 k13 k755217
abr 20073   1,7 k 82563241,0 Mb70 k6,2 k10 k 102215
mar 20073   1,7 k 7,82562031,0 Mb70 k6,2 k10 k 102215
fev 20073   1,7 k 7,72562401,0 Mb70 k6,2 k9,9 k 102215
jan 20073   1,7 k 7,52564941,0 Mb70 k6,2 k9,6 k 102215
dez 20063   1,7 k 7,22562511,0 Mb70 k6,2 k9,2 k 102215
nov 20063   1,7 k 7,12562941023 kb70 k6,2 k8,9 k 102215
out 20063 111,7 k26,92567841018 kb70 k6,2 k8,6 k 102215
set 20063 1 1,6 k 6,8263505978 kb68 k6,0 k7,8 k 102214
ago 20063 1 1,6 k 6,5264508971 kb68 k6,0 k7,4 k 102205
jul 20063   1,6 k 6,2260472952 kb67 k6,0 k7,0 k 101194
jun 20063 111,6 k 5,9260838946 kb67 k6,0 k6,6 k 101194
mai 20063 1 1,6 k 5,4256365930 kb65 k5,9 k6,3 k 101163
abr 20063 111,6 k15,2254467917 kb65 k5,9 k5,9 k 101163
mar 20063 111,6 k252511,0 k888 kb62 k5,7 k5,4 k 101154
fev 200631321,5 k 4,52282,2 k802 kb56 k5,5 k4,3 k 101118
jan 20062   1,5 k 3,1226166786 kb55 k5,5 k3,6 k 10175
dez 20052 111,5 k13227399783 kb55 k5,5 k3,4 k 10175
nov 20052   1,5 k 2,7216245752 kb52 k5,4 k3,3 k 10118
out 20052 1 1,5 k12,6216232750 kb52 k5,4 k3,2 k 10118
set 20052 1 1,4 k12,4215221738 kb52 k5,4 k2,9 k 10115
ago 20052 111,4 k32,3204500704 kb49 k4,7 k2,6 k 10115
jul 20052 111,3 k42,1211720666 kb46 k4,4 k2,1 k 10115
jun 20052 111,2 k251,82281,2 k615 kb43 k4,0 k419 10114
mai 20052 11445122,1370720343 kb23 k2,0 k415 10111
abr 20052   67 311804132 kb10 k899216 1018
mar 20052 1 6513121546131 kb10 k883214 1018
fev 20052 1 4313,5101811371 kb5,8 k497252 1108
jan 2005211 14 2,712513731 kb2,5 k220252 110 
dez 20041   1 1445 1,8 kb79 106 9 
nov 200411  1 144511,8 kb79 106 9 
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
The following table ranks this project in relation to projects in other languages with 1000+ articles
jan 2014954377489558245869593898590107118
out 2013954271449460244689592888490107118
jul 2013973773509464245679490878289108118
abr 2013993578519365244909290878089106118
jan 2013984482549367241879088858088106118
out 2012973575489159241858886847888103118
jul 2012964280548866241748685847587103118
abr 2012974078528866241768481827387103118
jan 20129635764985602408982798071100108118
out 2011964181488370238717876786899108118
jul 2011944380487966439797874766896107118
abr 2011923478457862440727874736894106118
jan 2011923577507761339707774726793104118
out 2010913598757661440697773726693104118
jul 2010904499837365540717672716491103118
abr 2010884696757056541747371686090103118
jan 2010863096726959537667070665888103118
out 2009853991726956537656968665886102118
jul 2009854093746960637746765635685101118
abr 200982499472665253772676463568599118
jan 2009845975426554741636563635479100118
out 2008903673426560641806462615376100117
jul 200886317245635883964616161537698117
abr 200885427249636263470615861527495117
jan 200897417450595962859545258497294117
out 200794407450576262561505053447295117
jul 200792406843525582465484948436491116
abr 200789387045495952157464547428425116
jan 200788467944426461947454441417924116
out 200684386141394481841404038397219116
jul 200680386537375071941363634356516116
abr 2006753751333245121737353428305616116
jan 2006804458342841171441323426255016110
out 2005743247262534171130272522234612102
jul 20056831402422231711212423222437997
abr 20056525412139302020503533333433987
jan 20055720341945241515294038382425978
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100ediçõesbytes
 WikcionaristasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikcionaristas (usuários registrados)
A = Wikcionaristas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikcionaristas que editaram pelo menos dez vezes desde que chegaram
C = Wikcionaristas que contribuíram cinco vezes ou mais este mês
D = Wikcionaristas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  5  10  100  1  3  5  10  1  3  5  10  25  100  5  10  100 
fev 20141111111 22 1    7311     
jan 2014111111  21 1    103221    
dez 201311111  111411  72111    
nov 2013211111  1115321 1332211   
out 2013311111  11 21   532      
set 201311111     421  53221    
ago 2013222221  1112    5222  1  
jul 20131111111 21121   113111 1  
jun 20131     1112    2        
mai 20132     3211    3        
abr 20132     11      2     1  
mar 20131     11 1    211   1  
fev 20131     43 1    611      
jan 20131     411     2     1  
dez 20122     3212    421      
nov 20121     32      2        
out 20123111   3213    42    11 
set 2012      3211    411      
ago 201211111  32 41   621   11 
jul 20121111   3322    51       
jun 20121     321     311   11 
mai 20121     4411    72       
abr 20121     54211   4111     
mar 20122     33 3    41       
fev 20122111   2212    8211     
jan 2012      32      21    21 
jan 2014111111  21 1    103221    
out 2013311111  11 21   532      
jul 20131111111 21121   113111 1  
abr 20132     11      2     1  
jan 20131     411     2     1  
out 20123111   3213    42    11 
jul 20121111   3322    51       
abr 20121     54211   4111     
jan 2012      32      21    21 
out 2011111    3211    41    1  
jul 20111     22 1    311   1  
abr 2011      431     4111  11 
jan 20111     431     3     1  
out 20103111111 11      5        
jul 20101111111                  
abr 2010111111          531   1  
jan 20101111111    1    1111     
out 20091111111 11 1    3        
jul 2009221111  1       5     21 
abr 20091111111 1       421      
jan 2009211    22 1    621   11 
out 20081     11 1    522      
jul 20081     2211    5        
abr 200811111  11      3111     
jan 20081     2222    2        
out 2007      111     4        
jul 20072     11               
abr 2007      111              
jan 2007      111     21       
out 2006111111  111     1        
jul 2006      1111    3        
abr 2006111111  111     1111     
jan 200621    1111    5111     
out 2005111    111              
jul 20051111111 1111    11111 1  
abr 200511            1111     
jan 200521111          111111   

 

Distribuição de edições de artigos por wikcionaristas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikcionaristasEdições total
154100.0%15,904100.0%
32037.0%15,85599.7%
101222.2%15,80799.4%
32916.7%15,76699.1%
10059.3%15,51297.5%
31647.4%15,27396.0%
100047.4%15,27396.0%
316223.7%12,21076.8%

 

1 wikcionaristas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions
agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
EspreonUC3 01,45038833030mar 10, 20133541110335

 

20 wikcionaristas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
InterwicketUC17,355jan 29, 20091855nov 08, 20101207
JamesUC24,855jan 09, 20053336mar 08, 20091817
BlackkdarkUC4239fev 09, 20091844out 26, 2012489
Orel BeilinsonUC587jul 30, 2012577ago 07, 2012569
LipeFontouraUC667fev 17, 20082202fev 18, 20082201
SpacebirdyUC756ago 01, 20072402nov 07, 2011843
StardsenUC844mai 29, 2013274ago 23, 2013188
Thamizhpparithi MaariUC916fev 05, 2012753mar 08, 2012721
WōdenhelmUC1015fev 27, 20072557dez 20, 20101165
Gott wisstUC1110jun 01, 20091732jun 10, 20091723
SajasazeUC128fev 12, 20062937mai 13, 20062847
RoggyUC138jul 15, 20091688jul 15, 20091688
LwhUC147out 19, 2011862abr 12, 2012686
Hayden120UC156set 19, 20101257out 16, 20101230
PiolinfaxUC165mar 26, 20062895fev 20, 20091833
MalafayaUC175set 12, 20081994mai 02, 2013301
PiRSquared17UC185out 18, 2012497nov 25, 201394
JorunnUC194nov 27, 20072284jan 29, 20082221
SaforrestUC203jan 11, 20053334jul 17, 20082051
ElvireUC213set 24, 2011887jun 30, 2012607

 

usuários anônimos, ordenados por número de contribuições
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
66.177.127.727
189.32.16.8821
85.211.65.20416

No total 220 edições foram feitas por usuários anônimos, de um total de 35760 edições ( 0e %)
  


21 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
RobotGMwiktUC18,704jul 12, 20053152jun 06, 20082092--
HydrizBotUC22,401abr 23, 2012675ago 23, 2013188--
Luckas-botUC32,275mar 06, 20091819jan 26, 201432--
KamikazeBotUC41,358out 18, 2011863fev 27, 2013365--
VolkovBotUC51,238ago 20, 20072383abr 18, 2013315--
SpaceBirdyBotUC6784jun 22, 20082076dez 30, 20091520--
JAnDbotUC7624abr 18, 2012680fev 28, 2014---
WikitanvirBotUC8537abr 15, 20111049jan 19, 2012770--
AvocatoBotUC9382out 27, 2011854out 31, 2012484--
ArthurBotUC10357nov 14, 20101201nov 03, 2011847--
MonoBotUC11349dez 25, 20072256jun 14, 20082084--
MjbmrbotUC12188jan 21, 20111133mar 28, 20111067--
CaBotUC13158nov 27, 20101188nov 27, 20101188--
RoggBotUC1463jul 14, 20091689abr 18, 20111046--
YS-BotUC1561set 11, 2012534fev 25, 20142--
CarsracBotUC1659jul 15, 20091688mai 29, 2013274--
WarddrBOTUC1747jul 25, 2012582ago 17, 2013194--
MelancholieBotUC1814mar 11, 20091814out 03, 20091608--
Makecat-botUC198nov 18, 2012466jan 22, 2013401--
ChuispastonBotUC207mai 25, 20111009jun 09, 2011994--
GhalyBotUC211jan 18, 2013405jan 18, 2013405--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110JpgPng
fev 20142,4 k5382523151383219061     36711
jan 20142,4 k5312523151383218661     15411
dez 20132,4 k5202523151353218661     5111
nov 20132,4 k5172523141343218661     18511
out 20132,4 k5082023101342918661     14811
set 20132,4 k5012023101342918461     6611
ago 20132,4 k4732023091342918461     22911
jul 20132,4 k4692023091341417561     29511
jun 20132,4 k4602023081341417561     111
mai 20132,4 k4572023081341417561     411
abr 20132,4 k4552023081341417561     311
mar 20132,4 k4512023081341417561     111
fev 20132,4 k4422023081341417561     111
jan 20132,4 k4322023081341417561     111
dez 20122,4 k4282023081341417561     211
nov 20122,4 k4222023081341417561     111
out 20122,4 k4212023081341417561     1911
set 20122,4 k4162023081341417561      11
ago 20122,4 k4112023081341417561     7411
jul 20122,4 k4002023081341417561     1311
jun 20122,4 k3942023081341417561     111
mai 20122,4 k3802023081341417561     111
abr 20122,4 k3722023081341417561     111
mar 20122,4 k3642023071341417561     311
fev 20122,4 k3602023071341417561     1611
jan 20122,4 k3412023071331417561      11
dez 20112,4 k3362023071331417561      11
nov 20112,4 k3302023071331417561     511
out 20112,4 k3152023071321417561     511
set 20112,4 k3082023071321417561     111
ago 20112,4 k3012023071321417561      11
jul 20112,4 k2942023071321417561     211
jun 20112,4 k2812023071321417561      11
mai 20112,4 k2772023071321417561      11
abr 20112,4 k2672023071321417561      11
mar 20112,4 k2542023071321417561      11
fev 20112,4 k2522023071321417561     511
jan 20112,4 k2432023071321417561     111
dez 20102,4 k2382023071321417561     311
nov 20102,4 k2352023071311217561     5511
out 20102,4 k2272023061311217561     37411
set 20102,4 k2222023061311217561     44211
ago 20102,4 k2172023061311217561     35411
jul 20102,4 k1992023061311217561     48211
jun 20102,4 k1992023061311217561     39411
mai 20102,4 k1772023061311217561     33711
abr 20102,4 k1742023061311217361     19511
mar 20102,4 k1652023061311217361     24011
fev 20102,4 k1622023061311217361     30811
jan 20102,4 k1592023061311217361     29011
dez 20092,4 k1462023061311217361     31111
nov 20092,4 k1442023061311217361     35711
out 20092,4 k1412023061311217361     33911
set 20092,4 k1372023061311217361     30211
ago 20092,4 k1312023061311217361     52911
jul 20092,4 k1312023061311217361     20411
jun 20092,4 k1272023061311217361     23511
mai 20092,4 k1242023061301217361     38111
abr 20092,4 k1222023061301217361     28211
mar 20092,4 k1112023061301217361     83211
fev 20092,3 k1001923061141217361     38711
jan 20092,3 k951923061141217361     811
dez 20082,3 k941923061121217361     911
nov 20082,3 k931923061121217261     111
out 20082,3 k741923061121217261     111
set 20082,3 k641923061121217261     211
ago 20082,3 k641923061121217261     111
jul 20082,3 k631923061121217261     111
jun 20082,3 k581923061121217261     13111
mai 20082,2 k531923061121217261     111
abr 20082,2 k521923061121217261     5111
mar 20082,2 k511923051121216961     8111
fev 20082,2 k471823051121216861     10911
jan 20082,2 k431823051071216461     111
dez 20072,2 k411823051071216461     411
nov 20072,2 k371823051071216461     111
out 20072,2 k361823051051216461      11
set 20072,2 k341823051051216461     611
ago 20072,2 k311722981021216461     3111
jul 20072,2 k241722981011216461     311
jun 20072,2 k24172298951216461     8111
mai 20072,1 k24172288951216461     39011
abr 20071,9 k24172283881216051      11
mar 20071,9 k24172283881216051     311
fev 20071,9 k24172283881216051     411
jan 20071,9 k23172283871215951      11
dez 20061,9 k21172282871215951      11
nov 20061,9 k20172282871215951      11
out 20061,9 k20162282871215951     19211
set 20061,8 k20162282871215851     3811
ago 20061,8 k19162282871215751     9711
jul 20061,8 k19162282871215751      11
jun 20061,8 k15162282871215751     25511
mai 20061,8 k14142281861214751     611
abr 20061,8 k14142280861214651     13911
mar 20061,7 k14142280831213651     27911
fev 20061,6 k14141279681212428     1800 1
jan 20061,6 k13141278681212128     6 1
dez 20051,6 k11121278681212127     345 1
nov 20051,5 k611 2746249827     1  
out 20051,5 k611 2726249827     12  
set 20051,5 k611 2726249827     38  
ago 20051,4 k610 2715439827     158  
jul 20051,3 k510 2705229727     257  
jun 20051,2 k48 2654828126     1162  
mai 200546436 238312459     719  
abr 20058232 23828 86     4  
mar 20058022 23828 82     46  
fev 20055111 2379 71     111  
jan 200514 1 2375 11     36  
dez 20041   236            
nov 20041                

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

nov 2004: 1 1 main Page

jan 2005: 1 2 Sunnandæg , 2 1 endelīf

fev 2005: 1 1 oþstandan (Gebīgednes)

mar 2005: 1 1 whose

abr 2005: 1 1 lēohtgēar

mai 2005: 1 1 hniton

jun 2005: 1 1 twig

jul 2005: 1 1 twig

ago 2005: 1 1 angsum

set 2005: 1 1 ān

out 2005: 1 1 bæcere

nov 2005: 1 1 dagur

dez 2005: 1 1 fāh (declīnung)

jan 2006: 1 1 farmer

fev 2006: 1 2 mercredi , 2 2 geágen , 3 2 gerǽden , 4 2 gewróten , 5 2 geswógen , 6 2 gerówen , 7 2 gehwósen , 8 2 gehwópen , 9 2 gewópen , 10 2 gesáwen , 11 2 gewáwen , 12 2 geswápen , 13 2 gescáden , 14 2 gehléapen , 15 2 gehwésen , 16 2 gelǽten , 17 2 gelácen , 18 2 gehéawen , 19 2 geháten , 20 2 gegrówen , 21 2 geglówen , 22 2 geflówen , 23 2 mót , 24 2 déag , 25 2 wát

mar 2006: 1 2 æppel , 2 2 goose , 3 1 twig

abr 2006: 1 1 bēacenfȳr

mai 2006: 1 1 willan

jun 2006: 1 1 manst

ago 2006: 1 1 bócon

set 2006: 1 1 gebróht

out 2006: 1 1 berunnon

fev 2007: 1 1 lufian

mar 2007: 1 1 lufian

mai 2007: 1 1 Hēafodtramet

jun 2007: 1 1 triskaidekaphobia

jul 2007: 1 1 Port:Mōnþas

ago 2007: 1 1 gnád

set 2007: 1 1 handicap

nov 2007: 1 1 ābacen

dez 2007: 1 1 asf.

jan 2008: 1 1 ābacen

fev 2008: 1 2 uproar , 2 2 boat , 3 1 stān

mar 2008: 1 2 ābacen , 2 1 ábacen

abr 2008: 1 1 ád

mai 2008: 1 1 Hēafodtramet

jun 2008: 1 1 goddess

jul 2008: 1 1 ymbstandan

ago 2008: 1 1 lukewarm

set 2008: 1 1 Weorc:Gemǣnscipes Port

out 2008: 1 1 Hēafodtramet

nov 2008: 1 1 Hēafodtramet

dez 2008: 1 1 difficult

jan 2009: 1 1 tīene

fev 2009: 1 2 Hēafodtramet , 2 2 folc , 3 2 dēaþ , 4 2 cyning , 5 2 difficult , 6 2 child , 7 2 ship , 8 2 English

mar 2009: 1 2 hira , 2 2 hine , 3 2 hīe , 4 2 hit , 5 2 him , 6 2 hire , 7 2 hēo , 8 2 his , 9 2 , 10 2 , 11 1 Hēafodtramet

abr 2009: 1 1 reveal

mai 2009: 1 1 twig

jun 2009: 1 2 ele

jul 2009: 1 2 Fisch , 2 2 Dienstag , 3 1 montag

ago 2009: 1 3 Hēafodtramet , 2 2 Affrica

set 2009: 1 1 his

out 2009: 1 1 ele

nov 2009: 1 1 twig

dez 2009: 1 1 hira

jan 2010: 1 1 unc

fev 2010: 1 1 twig

mar 2010: 1 1 ele

abr 2010: 1 1 ele

mai 2010: 1 1 hit

jun 2010: 1 1 hira

jul 2010: 1 1 proficient

ago 2010: 1 1 wit

set 2010: 1 2 sprǣc , 2 1 hit

out 2010: 1 1 twig

nov 2010: 1 1 humanity

dez 2010: 1 1 Hēafodtramet

jan 2011: 1 1 burning

fev 2011: 1 2 burning , 2 1 bonjour

jul 2011: 1 1 dæg

set 2011: 1 1 måndag

out 2011: 1 1

nov 2011: 1 2 heathen , 2 2 gecalen

fev 2012: 1 1 bucket

mar 2012: 1 1 Weorc:Gemǣnscipes Port

abr 2012: 1 1

mai 2012: 1 1 insanity

jun 2012: 1 1 perdition

jul 2012: 1 1 hēo

ago 2012: 1 1 cild

out 2012: 1 1 bearn

nov 2012: 1 1

dez 2012: 1 2 cyning

jan 2013: 1 1 asf.

fev 2013: 1 1 naht

mar 2013: 1 1 Hrēþmōnaþ

abr 2013: 1 1 dēaþ

mai 2013: 1 1 Eald Seaxisc

jun 2013: 1 1 heard

jul 2013: 1 1 Hēafodtramet

ago 2013: 1 2 Niðerlendisc , 2 2 hēafod , 3 2 Þēodisc , 4 2 land , 5 2 maandag , 6 1 Wasserpflanze

set 2013: 1 1 silofr

out 2013: 1 1 Niðerlendisc

nov 2013: 1 2 dēaþ , 2 2 thiu , 3 1 Baðanceaster

dez 2013: 1 1 Héafodtramet

jan 2014: 1 1 beorn

fev 2014: 1 1 they

Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Domingo, 30 de março 2014 19:30

Dump file angwiktionary-20140308-pages-meta-history.xml.7z (full dump), size 2.4 Mb as 7z -> 50 Mb
Dump processed till Feb 28, 2014, on server stat1002, ready at Fri-14/03/2014-14:18 after 32 sec.

Versão do script:2.6
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.