Estatísticas da Wikcionário anglo-saxon

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist

Metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.
See also metrics definitions


 
Monthly counts & Quarterly rankings: dezembro 2015
 
DataWikcionaristasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
dez 2015    0%   +30%      0%
nov 2015    0%   -48%      0%
out 2015    0%   +25%      0%
set 2015    0%   -57%      0%
ago 2015    0%   +174%      0%
jul 2015    0%   -71%      0%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
dez 201513   2,2 k 18 86      271
nov 201513   2,2 k 17,9 66      271
out 20151311 2,2 k 17,9 127      271
set 201512   2,2 k 17,9 102      271
ago 201512   2,2 k 17,8 238      271
jul 201512   2,2 k 17,7 87      271
jun 201512   2,2 k 17,7 300      271
mai 201512   2,2 k 17,5 132      271
abr 201512 1 2,2 k 17,5 118      271
mar 201512   2,2 k 17,42321061,6 Mb82 k7,3 k40 k202271
fev 201512   2,2 k 17,4232201,6 Mb82 k7,3 k40 k202271
jan 201512 2 2,2 k 17,42322031,6 Mb82 k7,3 k40 k202271
dez 201412 1 2,1 k 17,32331651,5 Mb82 k7,3 k39 k202271
nov 201412 1 2,1 k 17,2233151,5 Mb82 k7,3 k39 k202271
out 201412 1 2,1 k 17,22341951,5 Mb82 k7,2 k39 k202271
set 201412   2,1 k 17,22352561,5 Mb83 k7,3 k39 k202271
ago 201412   2,1 k 172354221,5 Mb83 k7,3 k38 k202271
jul 201412 1 2,1 k 16,9235751,5 Mb83 k7,3 k37 k202271
jun 201412 1 2,1 k 16,8236941,5 Mb83 k7,3 k37 k202271
mai 201412 1 2,1 k 16,8236801,5 Mb83 k7,3 k37 k202261
abr 201412 1 2,1 k 16,82361051,5 Mb83 k7,3 k37 k202260
mar 201412 1 2,1 k 16,72371071,5 Mb83 k7,5 k37 k202260
fev 201412 112,1 k 16,72434091,5 Mb84 k7,5 k37 k202260
jan 201412 112,1 k 16,62461951,5 Mb84 k7,4 k37 k202260
dez 201312 1 2,1 k 16,52465541,5 Mb84 k7,4 k37 k202260
nov 201312 112,1 k 16,22463251,5 Mb84 k7,4 k36 k202256
out 201312 112,1 k 16,12471821,5 Mb85 k7,3 k36 k202255
set 201312 1 2,1 k 16247711,5 Mb85 k7,4 k36 k202255
ago 2013121212,1 k 162477391,5 Mb85 k7,4 k36 k202255
jul 2013111112,1 k 15,72475351,5 Mb84 k7,3 k35 k202254
jun 201310   2,1 k 15,42491241,5 Mb85 k7,4 k35 k202253
mai 201310   2,1 k 15,32491731,5 Mb85 k7,4 k35 k202253
abr 201310   2,1 k 15,3249761,5 Mb85 k7,4 k35 k202253
mar 201310   2,1 k 15,2249711,5 Mb85 k7,4 k34 k202253
fev 201310   2,1 k 15,22491091,5 Mb85 k7,4 k34 k202253
jan 201310   2,1 k 15,22492231,5 Mb85 k7,4 k34 k202253
dez 201210   2,1 k 152491621,5 Mb85 k7,4 k34 k202253
nov 201210   2,1 k 15249951,5 Mb85 k7,4 k34 k202253
out 201210 1 2,1 k 14,92491931,5 Mb85 k7,4 k34 k202253
set 201210   2,1 k 14,82491871,5 Mb85 k7,4 k34 k202253
ago 201210 1 2,1 k 14,72492131,5 Mb85 k7,4 k33 k202253
jul 20121011 2,1 k 14,62483831,5 Mb84 k7,3 k33 k202253
jun 20129   2,1 k 14,52472061,5 Mb84 k7,3 k33 k202253
mai 20129   2,1 k 14,42472891,5 Mb84 k7,3 k33 k202253
abr 20129   2,1 k 14,22472951,5 Mb84 k7,3 k33 k202253
mar 20129   2,1 k 14,12471621,5 Mb84 k7,3 k33 k202253
fev 2012911 2,1 k 142471641,5 Mb84 k7,3 k32 k19 253
jan 20128   2,1 k 13,92471321,5 Mb84 k7,3 k32 k6 253
dez 20118   2,1 k 13,92475331,5 Mb84 k7,3 k32 k6 253
nov 20118   2,1 k 13,62474911,5 Mb84 k7,3 k31 k6 253
out 20118 1 2,1 k 13,42475401,4 Mb84 k7,3 k31 k6 253
set 20118   2,1 k 13,1247571,4 Mb84 k7,3 k30 k6 253
ago 20118   2,1 k 13,1247851,4 Mb84 k7,3 k30 k6 253
jul 20118   2,1 k 13,12471111,4 Mb84 k7,3 k30 k6 253
jun 20118   2,1 k 132472231,4 Mb84 k7,3 k30 k6 253
mai 20118   2,1 k 12,92472441,4 Mb84 k7,3 k29 k6 253
abr 20118   2,1 k 12,82473431,4 Mb84 k7,3 k29 k6 253
mar 20118   2,1 k 12,62473061,4 Mb84 k7,3 k29 k6 253
fev 20118   2,1 k 12,52472221,4 Mb84 k7,3 k28 k6 253
jan 20118   2,1 k 12,42472481,4 Mb84 k7,3 k28 k61253
dez 20108   2,1 k 12,32472521,4 Mb84 k7,3 k28 k61253
nov 20108 1 2,1 k 12,22473291,4 Mb84 k7,3 k28 k61253
out 20108 112,1 k 122473841,4 Mb84 k7,3 k27 k61253
set 20108 112,1 k 11,82474431,4 Mb84 k7,3 k27 k61252
ago 20108 112,1 k 11,62473541,4 Mb84 k7,3 k26 k61252
jul 20108 112,1 k 11,52474821,4 Mb84 k7,3 k26 k61252
jun 20108 112,1 k 11,22473951,4 Mb84 k7,3 k26 k61252
mai 20108 112,1 k 11,12473411,4 Mb84 k7,3 k25 k61252
abr 20108 112,1 k 10,92471961,4 Mb84 k7,3 k25 k61252
mar 20108 112,1 k 10,82472431,4 Mb84 k7,3 k25 k61252
fev 20108 112,1 k 10,72473121,4 Mb84 k7,3 k25 k61252
jan 20108 112,1 k 10,52472901,4 Mb84 k7,3 k24 k61252
dez 20098 112,1 k 10,42473201,4 Mb84 k7,3 k24 k61252
nov 20098 112,1 k 10,22473791,4 Mb84 k7,3 k24 k61252
out 20098 112,1 k 10,12473551,3 Mb84 k7,3 k23 k61251
set 20098 112,1 k 9,92473101,3 Mb84 k7,3 k23 k61251
ago 20098 112,1 k 9,82475341,3 Mb84 k7,3 k23 k61251
jul 20098 112,1 k 9,52472131,3 Mb84 k7,3 k22 k61251
jun 20098 212,1 k 9,42472371,3 Mb84 k7,3 k22 k61247
mai 20098 112,1 k 9,32473841,3 Mb84 k7,3 k22 k61244
abr 20098 112,1 k 9,12472931,3 Mb84 k7,3 k21 k61244
mar 20098 322,1 k192478711,3 Mb84 k7,3 k21 k61244
fev 200982212,1 k 8,72404571,3 Mb81 k6,9 k20 k71238
jan 20096 1 2,1 k18,52331541,2 Mb79 k6,8 k19 k71227
dez 2008611 2,1 k 8,52311181,2 Mb78 k6,6 k19 k61227
nov 20085   2,1 k 8,5231891,2 Mb78 k6,6 k19 k61227
out 20085   2,1 k 8,4231271,2 Mb78 k6,6 k19 k71227
set 20085   2,1 k 8,4231841,2 Mb78 k6,6 k19 k61227
ago 20085   2,1 k 8,42321421,2 Mb78 k6,6 k19 k61227
jul 20085   2,0 k 8,32322281,2 Mb78 k6,6 k18 k61227
jun 20085 112,0 k38,22324121,2 Mb78 k6,6 k18 k61227
mai 20085   2,0 k 8,42403111,2 Mb76 k6,5 k16 k71227
abr 20085 1 2,0 k 8,2240911,2 Mb76 k6,5 k15 k71227
mar 2008512 1,9 k 8,22392381,2 Mb76 k6,4 k15 k71226
fev 2008412 1,9 k 8,12393271,2 Mb76 k6,4 k15 k71225
jan 20083   1,9 k 7,92394191,1 Mb76 k6,4 k15 k71225
dez 20073   1,9 k 7,7239751,1 Mb76 k6,4 k14 k71225
nov 20073   1,9 k 7,7239301,1 Mb76 k6,4 k14 k71225
out 20073   1,9 k 7,72391511,1 Mb76 k6,4 k14 k71225
set 20073 1 1,9 k 7,6239641,1 Mb76 k6,4 k14 k71225
ago 20073 1 1,9 k 7,6239561,1 Mb76 k6,4 k13 k71225
jul 20073   1,9 k 7,5239921,1 Mb76 k6,4 k13 k71216
jun 20073 1 1,9 k27,52411611,1 Mb76 k6,4 k13 k755216
mai 20073 111,9 k67,62438861,1 Mb75 k6,6 k13 k755214
abr 20073   1,7 k 7,92553241,0 Mb70 k6,2 k10 k 102212
mar 20073   1,7 k 7,82552011,0 Mb70 k6,2 k10 k 102212
fev 20073   1,7 k 7,62552401,0 Mb70 k6,2 k9,8 k 102212
jan 20073   1,7 k 7,52554931,0 Mb70 k6,2 k9,6 k 102212
dez 20063   1,7 k 7,22562501,0 Mb70 k6,2 k9,2 k 102212
nov 20063   1,7 k 7,12562901021 kb70 k6,2 k8,9 k 102212
out 20063 111,7 k26,92557831016 kb70 k6,2 k8,6 k 102212
set 20063 1 1,6 k 6,7263505977 kb68 k6,0 k7,8 k 102211
ago 20063 1 1,6 k 6,5264506969 kb67 k6,0 k7,3 k 102202
jul 20063   1,6 k 6,1259470951 kb66 k6,0 k7,0 k 101191
jun 20063 111,6 k 5,9259837944 kb66 k6,0 k6,6 k 101191
mai 20063 1 1,6 k 5,4256364929 kb65 k5,9 k6,3 k 101162
abr 20063 111,6 k15,2253466916 kb64 k5,9 k5,9 k 101162
mar 20063 111,6 k252511,0 k886 kb62 k5,7 k5,4 k 101153
fev 200631321,5 k 4,52272,2 k801 kb56 k5,5 k4,3 k 101117
jan 20062   1,5 k 3,1226166785 kb55 k5,5 k3,6 k 10178
dez 20052 111,5 k13226399782 kb55 k5,5 k3,4 k 10178
nov 20052   1,5 k 2,7215244751 kb52 k5,4 k3,3 k 10121
out 20052 1 1,5 k12,6215232749 kb52 k5,4 k3,2 k 10121
set 20052 1 1,4 k12,4215220736 kb51 k5,4 k2,8 k 10118
ago 20052 111,4 k32,3203500702 kb48 k4,7 k2,6 k 10118
jul 20052 111,3 k42,1211719664 kb46 k4,4 k2,1 k 10118
jun 20052 111,2 k251,72281,2 k613 kb43 k4,0 k419 10117
mai 20052 11450122370720343 kb23 k2,0 k415 10114
abr 20052   71 2,811804132 kb10 k899216 10111
mar 20052 1 6912,9121546131 kb10 k883214 10111
fev 20052 1 4113,7101811371 kb5,8 k497252 11010
jan 2005211 12 3,212513731 kb2,5 k220252 1102
dez 20041      445 1,8 kb79 106 91
nov 200411     44511,8 kb79 106 91
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
The following table ranks this project in relation to projects in other languages with 1000+ articles
out 2015993579 102 1 102      136
jul 2015100   101 1 112      136
abr 201599 77 99 1 96      136
jan 2015983249439958148809795938887121136
out 2014984072469961146759795928787119136
jul 2014973373489858147959795928786119136
abr 2014973372479757147739694918684118136
jan 2014964178489658145869593898583118136
out 2013954273459562145689592888483118136
jul 2013983876509563146679490878282119136
abr 2013983780519464145899390878082117136
jan 2013984582549467142879088858081117136
out 2012973674499163242868886847881115136
jul 2012964281538869242748685847580115136
abr 2012983978528865242768481837381115136
jan 201210035795086642429082798071101120136
out 2011993980488567240717876786899119136
jul 2011984381488069241797874766896119136
abr 2011963381457860241727874736894118136
jan 2011963579507761240707774726794113136
out 20109335105767660241697773726694113136
jul 20109246105837466242717672716491112136
abr 20109046101757157342757371686090112136
jan 2010893298736960339667070665886112136
out 2009864095726955339656968665884111136
jul 2009864098746959439746765635684110136
abr 2009835096726653338726764635684109136
jan 2009855975426657342636663645476110136
out 2008913674436663242826562625374110135
jul 2008893272456359440646261625376108135
abr 2008864274496364335716258615273106135
jan 20081054377515959530605552594968105135
out 20071014074505863526615150544463106135
jul 20071014371445559525664949504359103134
abr 200796387547526142258474548429226134
jan 200793478344426642147464442418225134
out 200688396141404471941414038397419134
jul 200683406738395362042373634356216134
abr 2006783751333446101837363428305416134
jan 2006834559343241161541333426254416126
out 2005753346262734171330282522234112114
jul 200570304024222418122125232224309109
abr 20056624402142312020523633333624997
jan 20055720341952281616304139392518985
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100ediçõesbytes
 WikcionaristasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikcionaristas (usuários registrados)
A = Wikcionaristas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikcionaristas que editaram pelo menos dez vezes desde que chegaram
C = Wikcionaristas que contribuíram cinco vezes ou mais este mês
D = Wikcionaristas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  5  10  100  1  3  5  10  5  10  1  3  5  10  25  100  5  10  100 
dez 20151     22 1     321   11 
nov 2015      22 1     2     21 
out 20152111   32       4221  21 
set 2015      32 521   1     11 
ago 20151     3311     2     11 
jul 2015      32 1     1     11 
jun 20151     211            11 
mai 2015      211            11 
abr 2015111    32 2   222111  21 
mar 201511    22 2   112     11 
fev 20151     11 31    51    11 
jan 2015322    2114421  421   11 
dez 2014211    2212     2111  11 
nov 20141111      21    42111 1  
out 201411111  1111     61       
set 201411    1113     5        
ago 201411    221      51    1  
jul 201421111  22       1        
jun 201421111  11       111      
mai 201411111  1        2        
abr 201411111  1  1     81       
mar 201431111  21 2     3        
fev 20141111111 22 1     4111     
jan 2014111111  21 1     72111    
out 20152111   32       4221  21 
jul 2015      32 1     1     11 
abr 2015111    32 2   222111  21 
jan 2015322    2114421  421   11 
out 201411111  1111     61       
jul 201421111  22       1        
abr 201411111  1  1     81       
jan 2014111111  21 1     72111    
out 2013311111  11 21    431      
jul 20131111111 21121    112111 1  
abr 20132     11       2     1  
jan 20131     411            1  
out 20123111   3213     42    11 
jul 20121111   3322     5        
abr 20121     54211    311      
jan 2012      32       1     21 
out 2011111    3211     4     1  
jul 20111     22 1     21    1  
abr 2011      431      411   11 
jan 20111     431      3     1  
out 20103111111 11       5        
jul 20101111111                   
abr 2010111111           42    1  
jan 20101111111    1     1111     
out 20091111111 11 1     3        
jul 2009221111  1        5     21 
abr 20091111111 1        421      
jan 2009211    22 1     421   11 
out 20081     11 1     522      
jul 20081     2211     4        
abr 200811111  11       3111     
jan 20081     2222     2        
out 2007      111      3        
jul 20072     11                
abr 2007      111               
jan 2007      111      21       
out 2006111111  111      1        
jul 2006      1111     3        
abr 2006111111  111      1111     
jan 200621    1111     5111     
out 2005111    111               
jul 20051111111 1111     11111 1  
abr 200511             1111     
jan 200521111           111111   

 

Distribuição de edições de artigos por wikcionaristas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikcionaristasEdições total
162100.0%16,368100.0%
32235.5%16,31399.7%
101321.0%16,25899.3%
32914.5%16,19999.0%
10058.1%15,94497.4%
31646.5%15,70595.9%
100046.5%15,70595.9%
316223.2%12,19774.5%

 

1 wikcionaristas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions
agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
SiealexUC61...11--dez 22, 20158----

 

20 wikcionaristas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
InterwicketUC17,344jan 29, 20092526nov 08, 20101878
JamesUC24,853jan 11, 20054005mar 08, 20092488
EspreonUC31,898mar 10, 20131025out 14, 201577
BlackkdarkUC4239fev 09, 20092515out 26, 20121160
Orel BeilinsonUC587jul 30, 20121248ago 07, 20121240
LipeFontouraUC667fev 17, 20082873fev 18, 20082872
SpacebirdyUC756ago 01, 20073073nov 07, 20111514
StardsenUC845mai 29, 2013945mar 04, 2014666
LwhUC918out 19, 20111533out 23, 201568
Thamizhpparithi MaariUC1016fev 05, 20121424mar 08, 20121392
WōdenhelmUC1115fev 27, 20073228dez 20, 20101836
Gott wisstUC1210jun 01, 20092403jun 10, 20092394
Sajasaze~angwiktionaryUC138fev 12, 20063608mai 13, 20063518
RoggyUC148jul 15, 20092359jul 15, 20092359
MalaysiaboyUC157jan 08, 2015356fev 03, 2015330
JAn DudíkUC167abr 07, 2015267abr 07, 2015267
Hayden120UC176set 19, 20101928out 16, 20101901
PiolinfaxUC185mar 26, 20063566fev 20, 20092504
MalafayaUC195set 12, 20082665mai 02, 2013972
PiRSquared17UC205out 18, 20121168nov 25, 2013765

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 225 edições foram feitas por usuários anônimos, de um total de 38805 edições ( 0e %)
  


21 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
RobotGMwiktUC18,684jul 12, 20053823jun 06, 20082763--
HydrizBotUC23,461abr 23, 20121346dez 31, 2015---
Luckas-botUC32,275mar 06, 20092490jan 26, 2014703--
JAnDbotUC41,895abr 18, 20121351dez 30, 2015---
KamikazeBotUC51,356out 18, 20111534fev 27, 20131036--
VolkovBotUC61,233ago 20, 20073054abr 18, 2013986--
SpaceBirdyBotUC7784jun 22, 20082747dez 30, 20092191--
WikitanvirBotUC8537abr 15, 20111720jan 19, 20121441--
AvocatoBotUC9379out 27, 20111525out 31, 20121155--
ArthurBotUC10356nov 14, 20101872nov 03, 20111518--
MonoBotUC11349dez 25, 20072927jun 14, 20082755--
YS-BotUC12336set 11, 20121205out 17, 201574--
MjbmrbotUC13188jan 21, 20111804mar 28, 20111738--
CaBotUC14158nov 27, 20101859nov 27, 20101859--
RoggBotUC1562jul 14, 20092360abr 18, 20111717--
CarsracBotUC1659jul 15, 20092359mai 29, 2013945--
WarddrBOTUC1747jul 25, 20121253ago 17, 2013865--
MelancholieBotUC1814mar 11, 20092485out 03, 20092279--
Makecat-botUC198nov 18, 20121137jan 22, 20131072--
ChuispastonBotUC207mai 25, 20111680jun 09, 20111665--
GhalyBotUC211jan 18, 20131076jan 18, 20131076--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110JpgPng
dez 20152,4 k4262523161573221460      11
nov 20152,4 k4212523161573221460      11
out 20152,4 k4212523161573221460      11
set 20152,4 k4192523161433221460      11
ago 20152,4 k4192523161433221460      11
jul 20152,4 k4192523161423221460      11
jun 20152,4 k4182523161423221460      11
mai 20152,4 k4182523161423221460      11
abr 20152,4 k4182523161423221460      11
mar 20152,4 k4172523161423220460     311
fev 20152,4 k4172523161423220460     211
jan 20152,4 k4122523161423220460     1311
dez 20142,4 k4092523161423220460     611
nov 20142,4 k4092523161423218960     1211
out 20142,4 k4062523161393218960     7311
set 20142,4 k4052523161383218960     311
ago 20142,4 k4002523161383218960     411
jul 20142,4 k3952523161383218960     2611
jun 20142,4 k3952523161383218960     7811
mai 20142,4 k3952523161383218860     7011
abr 20142,4 k3942523161383218860     9511
mar 20142,4 k3902523151383218860     7411
fev 20142,4 k3872523151383218860     36711
jan 20142,4 k3832523151383218460     15411
dez 20132,4 k3782523151353218460     5111
nov 20132,4 k3782523141343218460     18511
out 20132,4 k3742023101342918460     14811
set 20132,4 k3712023101342918260     6611
ago 20132,4 k3552023091342918260     22911
jul 20132,4 k3512023091341417360     29511
jun 20132,4 k3432023081341417360     111
mai 20132,4 k3422023081341417360     411
abr 20132,4 k3402023081341417360     311
mar 20132,4 k3362023081341417360     111
fev 20132,4 k3292023081341417360     111
jan 20132,4 k3222023081341417360     111
dez 20122,4 k3212023081341417360     111
nov 20122,4 k3162023081341417360     111
out 20122,4 k3162023081341417360     1911
set 20122,4 k3112023081341417360      11
ago 20122,4 k3072023081341417360     7411
jul 20122,4 k3022023081341417360     1311
jun 20122,4 k2982023081341417360     111
mai 20122,4 k2862023081341417360     111
abr 20122,4 k2802023081341417360     111
mar 20122,4 k2752023071341417360     311
fev 20122,4 k2742023071341417360     1611
jan 20122,4 k2652023071331417360      11
dez 20112,4 k2632023071331417360      11
nov 20112,4 k2592023071331417360     511
out 20112,4 k2442023071321417360     511
set 20112,4 k2402023071321417360     111
ago 20112,4 k2352023071321417360      11
jul 20112,4 k2312023071321417360     211
jun 20112,4 k2232023071321417360      11
mai 20112,4 k2202023071321417360      11
abr 20112,4 k2152023071321417360      11
mar 20112,4 k2062023071321417360      11
fev 20112,4 k2042023071321417360     511
jan 20112,4 k2002023071321417360     111
dez 20102,4 k1972023071321417360     311
nov 20102,4 k1952023071311217360     5511
out 20102,4 k1892023061311217360     37311
set 20102,4 k1842023061311217360     44211
ago 20102,4 k1792023061311217360     35411
jul 20102,4 k1622023061311217360     48111
jun 20102,4 k1622023061311217360     39311
mai 20102,4 k1522023061311217360     33711
abr 20102,4 k1502023061311217160     19511
mar 20102,4 k1452023061311217160     24011
fev 20102,4 k1422023061311217160     30811
jan 20102,4 k1392023061311217160     28711
dez 20092,4 k1282023061311217160     31011
nov 20092,4 k1262023061311217160     35711
out 20092,4 k1232023061311217160     33911
set 20092,4 k1202023061311217160     30111
ago 20092,4 k1162023061311217160     52911
jul 20092,4 k1162023061311217160     20311
jun 20092,4 k1122023061311217160     23511
mai 20092,4 k1092023061301217160     38111
abr 20092,4 k1072023061301217160     28211
mar 20092,4 k982023061301217160     83011
fev 20092,3 k911923061141217160     38711
jan 20092,3 k861923061141217160     811
dez 20082,3 k851923061121217160     911
nov 20082,3 k841923061121217060     111
out 20082,3 k701923061121217060     111
set 20082,3 k601923061121217060     211
ago 20082,3 k601923061121217060     111
jul 20082,3 k591923061121217060     111
jun 20082,3 k551923061121217060     13111
mai 20082,2 k501923061121217060     111
abr 20082,2 k491923061121217060     5111
mar 20082,2 k481923051121216760     8111
fev 20082,2 k451823051121216660     10911
jan 20082,2 k411823051071216260     111
dez 20072,2 k391823051071216260     411
nov 20072,2 k351823051071216260     111
out 20072,2 k341823051051216260      11
set 20072,2 k321823051051216260     611
ago 20072,2 k291722981021216260     3111
jul 20072,2 k241722981011216260     311
jun 20072,2 k24172298951216260     8111
mai 20072,1 k24172288951216260     39011
abr 20071,9 k24172283881215850      11
mar 20071,9 k24172283881215850     311
fev 20071,9 k24172283881215850     411
jan 20071,9 k23172283871215750      11
dez 20061,9 k21172282871215750      11
nov 20061,9 k20172282871215750      11
out 20061,9 k20162282871215750     19211
set 20061,8 k20162282871215650     3811
ago 20061,8 k19162282871215550     9711
jul 20061,8 k19162282871215550      11
jun 20061,8 k15162282871215550     25511
mai 20061,8 k14142281861214550     611
abr 20061,8 k14142280861214450     13911
mar 20061,7 k14142280831213450     27911
fev 20061,6 k14141279681212227     1797 1
jan 20061,6 k13141278681211927     6 1
dez 20051,6 k11121278681211926     345 1
nov 20051,5 k611 2746249626     1  
out 20051,5 k611 2726249626     12  
set 20051,5 k611 2726249626     38  
ago 20051,4 k610 2715439626     158  
jul 20051,3 k510 2705229526     257  
jun 20051,2 k48 2654828025     1160  
mai 200546436 238312458     719  
abr 20058232 23828 86     4  
mar 20058022 23828 82     46  
fev 20055111 2379 71     111  
jan 200514 1 2375 11     36  
dez 20041   236            
nov 20041                

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

nov 2004: 1 1 main Page

jan 2005: 1 2 Sunnandæg , 2 1 endelīf

fev 2005: 1 1 oþstandan (Gebīgednes)

mar 2005: 1 1 whose

abr 2005: 1 1 lēohtgēar

mai 2005: 1 1 hniton

jun 2005: 1 1 twig

jul 2005: 1 1 twig

ago 2005: 1 1 angsum

set 2005: 1 1 ān

out 2005: 1 1 bæcere

nov 2005: 1 1 dagur

dez 2005: 1 1 fāh (declīnung)

jan 2006: 1 1 farmer

fev 2006: 1 2 mercredi , 2 2 geágen , 3 2 gerǽden , 4 2 gewróten , 5 2 geswógen , 6 2 gerówen , 7 2 gehwósen , 8 2 gehwópen , 9 2 gewópen , 10 2 gesáwen , 11 2 gewáwen , 12 2 geswápen , 13 2 gescáden , 14 2 gehléapen , 15 2 gehwésen , 16 2 gelǽten , 17 2 gelácen , 18 2 gehéawen , 19 2 geháten , 20 2 gegrówen , 21 2 geglówen , 22 2 geflówen , 23 2 mót , 24 2 déag , 25 2 wát

mar 2006: 1 2 æppel , 2 2 goose , 3 1 twig

abr 2006: 1 1 bēacenfȳr

mai 2006: 1 1 willan

jun 2006: 1 1 manst

ago 2006: 1 1 bócon

set 2006: 1 1 gebróht

out 2006: 1 1 berunnon

fev 2007: 1 1 lufian

mar 2007: 1 1 lufian

mai 2007: 1 1 Hēafodtramet

jun 2007: 1 1 triskaidekaphobia

jul 2007: 1 1 Port:Mōnþas

ago 2007: 1 1 gnád

set 2007: 1 1 handicap

nov 2007: 1 1 ābacen

dez 2007: 1 1 asf.

jan 2008: 1 1 ābacen

fev 2008: 1 2 uproar , 2 2 boat , 3 1 stān

mar 2008: 1 2 ābacen , 2 1 ábacen

abr 2008: 1 1 ád

mai 2008: 1 1 Hēafodtramet

jun 2008: 1 1 goddess

jul 2008: 1 1 ymbstandan

ago 2008: 1 1 lukewarm

set 2008: 1 1 Weorc:Gemǣnscipes Port

out 2008: 1 1 Hēafodtramet

nov 2008: 1 1 Hēafodtramet

dez 2008: 1 1 difficult

jan 2009: 1 1 tīene

fev 2009: 1 2 Hēafodtramet , 2 2 folc , 3 2 dēaþ , 4 2 cyning , 5 2 difficult , 6 2 child , 7 2 ship , 8 2 English

mar 2009: 1 2 hira , 2 2 hine , 3 2 hīe , 4 2 hit , 5 2 him , 6 2 hire , 7 2 hēo , 8 2 his , 9 2 , 10 2 , 11 1 Hēafodtramet

abr 2009: 1 1 reveal

mai 2009: 1 1 twig

jun 2009: 1 2 ele

jul 2009: 1 2 Fisch , 2 2 Dienstag , 3 1 montag

ago 2009: 1 3 Hēafodtramet , 2 2 Affrica

set 2009: 1 1 his

out 2009: 1 1 ele

nov 2009: 1 1 twig

dez 2009: 1 1 hira

jan 2010: 1 1 unc

fev 2010: 1 1 twig

mar 2010: 1 1 ele

abr 2010: 1 1 ele

mai 2010: 1 1 hit

jun 2010: 1 1 hira

jul 2010: 1 1 proficient

ago 2010: 1 1 wit

set 2010: 1 2 sprǣc , 2 1 hit

out 2010: 1 1 twig

nov 2010: 1 1 humanity

dez 2010: 1 1 Hēafodtramet

jan 2011: 1 1 burning

fev 2011: 1 2 burning , 2 1 bonjour

jul 2011: 1 1 dæg

set 2011: 1 1 måndag

out 2011: 1 1

nov 2011: 1 2 heathen , 2 2 gecalen

fev 2012: 1 1 bucket

mar 2012: 1 1 Weorc:Gemǣnscipes Port

abr 2012: 1 1

mai 2012: 1 1 insanity

jun 2012: 1 1 perdition

jul 2012: 1 1 hēo

ago 2012: 1 1 cild

out 2012: 1 1 bearn

nov 2012: 1 1

dez 2012: 1 1 cyning

jan 2013: 1 1 asf.

fev 2013: 1 1 naht

mar 2013: 1 1 Hrēþmōnaþ

abr 2013: 1 1 dēaþ

mai 2013: 1 1 Eald Seaxisc

jun 2013: 1 1 heard

jul 2013: 1 1 Hēafodtramet

ago 2013: 1 2 Niðerlendisc , 2 2 hēafod , 3 2 Þēodisc , 4 2 land , 5 2 maandag , 6 1 Wasserpflanze

set 2013: 1 1 silofr

out 2013: 1 1 Niðerlendisc

nov 2013: 1 2 dēaþ , 2 2 thiu , 3 1 Baðanceaster

dez 2013: 1 1 Héafodtramet

jan 2014: 1 1 beorn

fev 2014: 1 1 they

mar 2014: 1 2 language , 2 2 English , 3 1 Old English

abr 2014: 1 1 Monday

mai 2014: 1 1 punish

jun 2014: 1 1 áihta

jul 2014: 1 2 engelsk , 2 1 folc

ago 2014: 1 1 favor

set 2014: 1 1 reveal

out 2014: 1 1 sēon

nov 2014: 1 1 Hēafodtramet

dez 2014: 1 2 Hēafodtramet

jan 2015: 1 2 Januari

fev 2015: 1 1 Februari

mar 2015: 1 1 size

abr 2015: 1 1 cesta

jun 2015: 1 1 English

ago 2015: 1 1 Hrēþmōnaþ

out 2015: 1 2 çielo , 2 1 cheval

dez 2015: 1 1 Hēafodtramet

Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Quinta-feira, 21 de janeiro 2016 20:38

Dump file angwiktionary-20160111-stub-meta-history.xml.gz (edits only), size 2.4 Mb as gz -> 19 Mb
Dump processed till Dec 31, 2015, on server stat1002, ready at Tue-12/01/2016-11:02 after 25 sec.

Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.