Estatísticas da Wikcionário anglo-saxon

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist

Metrics have been collected from a full archive dump, which contains all revisions of every article, meta data and raw content.
See also metrics definitions


 
Monthly counts & Quarterly rankings: março 2015
 
DataWikcionaristasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
mar 2015    0%   +430%0%-0%-0%0%0% 0%
fev 2015    0%   -90%0%0%0%0%0% 0%
jan 2015    0%   +23%0%0%0%+1%0% 0%
dez 2014    0%    0%-0%0%+1%0% 0%
out 2014    0%   -24%-0%-0%-0%0%0% 0%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
mar 201512   2,2 k 17,42321061,6 Mb82 k7,3 k40 k202271
fev 201512   2,2 k 17,4232201,6 Mb82 k7,3 k40 k202271
jan 201512 2 2,1 k 17,42322031,6 Mb82 k7,3 k40 k202271
dez 201412 1 2,1 k 17,32331651,5 Mb82 k7,3 k39 k202271
nov 201412 1 2,1 k 17,3233151,5 Mb82 k7,3 k39 k202271
out 201412 1 2,1 k 17,32341951,5 Mb82 k7,2 k39 k202271
set 201412   2,1 k 17,22352561,5 Mb83 k7,3 k39 k202271
ago 201412   2,1 k 17,12354221,5 Mb83 k7,3 k38 k202271
jul 201412 1 2,1 k 16,9235751,5 Mb83 k7,3 k37 k202271
jun 201412 1 2,1 k 16,8236941,5 Mb83 k7,3 k37 k202271
mai 201412 1 2,1 k 16,8236801,5 Mb83 k7,3 k37 k202261
abr 201412 1 2,1 k 16,82361051,5 Mb83 k7,3 k37 k202260
mar 201412 1 2,1 k 16,72371071,5 Mb83 k7,5 k37 k202261
fev 201412 112,1 k 16,72434091,5 Mb84 k7,5 k37 k202261
jan 201412 112,1 k 16,62461951,5 Mb84 k7,4 k37 k202264
dez 201312 1 2,1 k 16,52465541,5 Mb84 k7,4 k37 k202264
nov 201312 112,1 k 16,32463251,5 Mb84 k7,4 k36 k202260
out 201312 112,1 k 16,12471821,5 Mb85 k7,3 k36 k202259
set 201312 1 2,1 k 16247711,5 Mb85 k7,4 k36 k202259
ago 2013121212,1 k 162477391,5 Mb85 k7,4 k36 k202259
jul 2013111112,1 k 15,72475351,5 Mb84 k7,3 k35 k202259
jun 201310   2,1 k 15,52491241,5 Mb85 k7,4 k35 k202258
mai 201310   2,1 k 15,42491731,5 Mb85 k7,4 k35 k202258
abr 201310   2,1 k 15,3249761,5 Mb85 k7,4 k35 k202257
mar 201310   2,1 k 15,3249711,5 Mb85 k7,4 k34 k202258
fev 201310   2,1 k 15,32491091,5 Mb85 k7,4 k34 k202258
jan 201310   2,1 k 15,22492231,5 Mb85 k7,4 k34 k202258
dez 201210   2,1 k 15,12491621,5 Mb85 k7,4 k34 k202258
nov 201210   2,1 k 15249951,5 Mb85 k7,4 k34 k202258
out 201210 1 2,1 k 152491931,5 Mb85 k7,4 k34 k202258
set 201210   2,1 k 14,92491871,5 Mb85 k7,4 k34 k202258
ago 201210 1 2,1 k 14,82492131,5 Mb85 k7,4 k33 k202258
jul 20121011 2,1 k 14,72483831,5 Mb84 k7,3 k33 k202258
jun 20129   2,1 k 14,52472061,5 Mb84 k7,3 k33 k202258
mai 20129   2,1 k 14,42472891,5 Mb84 k7,3 k33 k202258
abr 20129   2,1 k 14,32472951,5 Mb84 k7,3 k33 k202258
mar 20129   2,1 k 14,12471621,5 Mb84 k7,3 k33 k202258
fev 2012911 2,1 k 14,12471641,5 Mb84 k7,3 k32 k19 258
jan 20128   2,1 k 142471321,5 Mb84 k7,3 k32 k6 258
dez 20118   2,1 k 13,92475331,5 Mb84 k7,3 k32 k6 258
nov 20118   2,1 k 13,72474911,5 Mb84 k7,3 k31 k6 258
out 20118 1 2,1 k 13,42475401,4 Mb84 k7,3 k31 k6 258
set 20118   2,1 k 13,2247571,4 Mb84 k7,3 k30 k6 258
ago 20118   2,1 k 13,2247851,4 Mb84 k7,3 k30 k6 258
jul 20118   2,1 k 13,12471111,4 Mb84 k7,3 k30 k6 258
jun 20118   2,1 k 13,12472231,4 Mb84 k7,3 k30 k6 258
mai 20118   2,1 k 132472441,4 Mb84 k7,3 k29 k6 258
abr 20118   2,1 k 12,92473431,4 Mb84 k7,3 k29 k6 258
mar 20118   2,1 k 12,72473061,4 Mb84 k7,3 k29 k6 258
fev 20118   2,1 k 12,62472221,4 Mb84 k7,3 k28 k6 258
jan 20118   2,1 k 12,52472481,4 Mb84 k7,3 k28 k61258
dez 20108   2,1 k 12,32472521,4 Mb84 k7,3 k28 k61258
nov 20108 1 2,1 k 12,22473291,4 Mb84 k7,3 k28 k61258
out 20108 112,1 k 12,12473841,4 Mb84 k7,3 k27 k61258
set 20108 112,1 k 11,92474431,4 Mb84 k7,3 k27 k61257
ago 20108 112,1 k 11,72473541,4 Mb84 k7,3 k26 k61257
jul 20108 112,1 k 11,52474821,4 Mb84 k7,3 k26 k61257
jun 20108 112,1 k 11,32473951,4 Mb84 k7,3 k26 k61257
mai 20108 112,1 k 11,12473411,4 Mb84 k7,3 k25 k61257
abr 20108 112,1 k 10,92471961,4 Mb84 k7,3 k25 k61257
mar 20108 112,1 k 10,82472431,4 Mb84 k7,3 k25 k61257
fev 20108 112,1 k 10,72473121,4 Mb84 k7,3 k25 k61257
jan 20108 112,1 k 10,62472901,4 Mb84 k7,3 k24 k61257
dez 20098 112,1 k 10,42473201,4 Mb84 k7,3 k24 k61257
nov 20098 112,1 k 10,32473791,4 Mb84 k7,3 k24 k61257
out 20098 112,1 k 10,12473551,3 Mb84 k7,3 k23 k61256
set 20098 112,1 k 9,92473101,3 Mb84 k7,3 k23 k61256
ago 20098 112,1 k 9,82475341,3 Mb84 k7,3 k23 k61256
jul 20098 112,1 k 9,52472131,3 Mb84 k7,3 k22 k61256
jun 20098 212,1 k 9,42472371,3 Mb84 k7,3 k22 k61252
mai 20098 112,1 k 9,32473841,3 Mb84 k7,3 k22 k61249
abr 20098 112,1 k 9,22472931,3 Mb84 k7,3 k21 k61249
mar 20098 322,1 k192478711,3 Mb84 k7,3 k21 k61249
fev 200982212,1 k 8,72404571,3 Mb81 k6,9 k20 k71241
jan 20096 1 2,1 k18,52331541,2 Mb79 k6,8 k19 k71230
dez 2008611 2,1 k 8,52311181,2 Mb78 k6,6 k19 k61230
nov 20085   2,0 k 8,5231891,2 Mb78 k6,6 k19 k61230
out 20085   2,0 k 8,5231271,2 Mb78 k6,6 k19 k71230
set 20085   2,0 k 8,4231841,2 Mb78 k6,6 k19 k61230
ago 20085   2,0 k 8,42321421,2 Mb78 k6,6 k19 k61230
jul 20085   2,0 k 8,32322281,2 Mb78 k6,6 k18 k61230
jun 20085 112,0 k38,22324121,2 Mb78 k6,6 k18 k61230
mai 20085   1,9 k 8,42403111,2 Mb76 k6,5 k16 k71230
abr 20085 1 1,9 k 8,3240911,2 Mb76 k6,5 k15 k71230
mar 2008512 1,9 k 8,22392381,2 Mb76 k6,4 k15 k71229
fev 2008412 1,9 k 8,12393271,2 Mb76 k6,4 k15 k71228
jan 20083   1,9 k 7,92394191,1 Mb76 k6,4 k15 k71227
dez 20073   1,9 k 7,7239751,1 Mb76 k6,4 k14 k71227
nov 20073   1,9 k 7,7239301,1 Mb76 k6,4 k14 k71227
out 20073   1,9 k 7,72391511,1 Mb76 k6,4 k14 k71227
set 20073 1 1,9 k 7,6239641,1 Mb76 k6,4 k14 k71227
ago 20073 1 1,9 k 7,6239561,1 Mb76 k6,4 k13 k71227
jul 20073   1,9 k 7,5239921,1 Mb76 k6,4 k13 k71218
jun 20073 1 1,9 k27,52411611,1 Mb76 k6,4 k13 k755217
mai 20073 111,9 k67,62438861,1 Mb75 k6,6 k13 k755215
abr 20073   1,7 k 82553241,0 Mb70 k6,2 k10 k 102213
mar 20073   1,7 k 7,82552011,0 Mb70 k6,2 k10 k 102213
fev 20073   1,7 k 7,72552401,0 Mb70 k6,2 k9,8 k 102213
jan 20073   1,7 k 7,52554931,0 Mb70 k6,2 k9,6 k 102213
dez 20063   1,7 k 7,22562501,0 Mb70 k6,2 k9,2 k 102213
nov 20063   1,7 k 7,12562901021 kb70 k6,2 k8,9 k 102213
out 20063 111,7 k26,92557831016 kb70 k6,2 k8,6 k 102213
set 20063 1 1,6 k 6,8263505977 kb68 k6,0 k7,8 k 102212
ago 20063 1 1,6 k 6,5264506969 kb67 k6,0 k7,3 k 102203
jul 20063   1,6 k 6,2259470951 kb66 k6,0 k7,0 k 101192
jun 20063 111,6 k 5,9259837944 kb66 k6,0 k6,6 k 101192
mai 20063 1 1,6 k 5,4256364929 kb65 k5,9 k6,3 k 101161
abr 20063 111,6 k15,2253466916 kb64 k5,9 k5,9 k 101161
mar 20063 111,6 k252511,0 k886 kb62 k5,7 k5,4 k 101152
fev 200631321,5 k 4,52272,2 k801 kb56 k5,5 k4,3 k 101116
jan 20062   1,5 k 3,1226166785 kb55 k5,5 k3,6 k 10175
dez 20052 111,5 k13226399782 kb55 k5,5 k3,4 k 10175
nov 20052   1,5 k 2,7215244751 kb52 k5,4 k3,3 k 10118
out 20052 1 1,5 k12,6215232749 kb52 k5,4 k3,2 k 10118
set 20052 1 1,4 k12,4215220736 kb51 k5,4 k2,8 k 10115
ago 20052 111,4 k32,3203500702 kb48 k4,7 k2,6 k 10115
jul 20052 111,3 k42,1211719664 kb46 k4,4 k2,1 k 10115
jun 20052 111,2 k251,82281,2 k613 kb43 k4,0 k419 10114
mai 20052 11445122,1370720343 kb23 k2,0 k415 10111
abr 20052   67 311804132 kb10 k899216 1018
mar 20052 1 6513121546131 kb10 k883214 1018
fev 20052 1 4313,5101811371 kb5,8 k497252 1108
jan 2005211 14 2,712513731 kb2,5 k220252 110 
dez 20041   1 1445 1,8 kb79 106 9 
nov 200411  1 144511,8 kb79 106 9 
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
The following table ranks this project in relation to projects in other languages with 1000+ articles
jan 2015953749439762247809694918887116129
out 2014953774479760145759694908787115129
jul 2014943274489461146959694908786115129
abr 2014943373479455246739593898684113129
jan 2014934180489359244869492878583113129
out 2013924374459361244689491868483113129
jul 2013943878509263245679389858282114129
abr 2013963679519165244899289858082112129
jan 2013954580549167241878987838081112129
out 2012943373488959241858784827881110129
jul 2012934683528669241748583827581110129
abr 2012943876528666241768379817382110129
jan 2012983576508360240898177787197114129
out 2011973981488169238717875776895113129
jul 2011954379497765439807873756892113129
abr 2011933278447660439727873726890112129
jan 2011933578507561339707773716790109129
out 20109136108777461440697772716690109129
jul 20109045109867166541717571706487108129
abr 20108845104766858541757270676086108129
jan 20108730102736758538667069655884108129
out 20098538100756757538666967655882107129
jul 20098539101756759636726664625683106129
abr 2009815098736453536736663625683106129
jan 2009835875426355740636562635475107129
out 2008883672426361640806461615374107128
jul 2008863068446157838626160615376105128
abr 2008854272486162634696157605273101128
jan 20081044375515859629605552594968101128
out 20071013772495661626605150544464102128
jul 2007100437343515882566494950436099128
abr 200794407545486052257474548429125128
jan 200790478143426462047464442418124128
out 200687396242394481841414038397319128
jul 200684406838375271942373634356216128
abr 2006783852333246121737353428305316128
jan 2006834558342841171441323426254415121
out 2005763247262534171130272522234012109
jul 200569344024222317112124232224299104
abr 20056425412139292020493533333423993
jan 20055520331944241515293937372317981
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100ediçõesbytes
 WikcionaristasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikcionaristas (usuários registrados)
A = Wikcionaristas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikcionaristas que editaram pelo menos dez vezes desde que chegaram
C = Wikcionaristas que contribuíram cinco vezes ou mais este mês
D = Wikcionaristas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  5  10  100  1  3  5  10  5  10  1  3  5  10  25  100  5  10  100 
mar 201511    22 2   112     11 
fev 20151     11 31    51    11 
jan 2015322    2114421  421   11 
dez 2014211    2213     3111  11 
nov 20141111      31    42111 1  
out 201411111  1112     61       
set 201411    1113     51       
ago 201411    221      51    1  
jul 201421111  22       1        
jun 201421111  11       111      
mai 201411111  1        2        
abr 201411111  1  1     81       
mar 201431111  21 2     3        
fev 20141111111 22 1     4111     
jan 2014111111  21 1     83211    
dez 201311111  111411   41111    
nov 2013211111  1115321  1132211   
out 2013311111  11 21    432      
set 201311111     421   4322     
ago 2013222221  1112     5222  1  
jul 20131111111 21121    113111 1  
jun 20131     1112     1        
mai 20132     3211     3        
abr 20132     11       2     1  
mar 20131     11 1     211   1  
fev 20131     43 1     41       
jan 20131     411            1  
jan 2015322    2114421  421   11 
out 201411111  1112     61       
jul 201421111  22       1        
abr 201411111  1  1     81       
jan 2014111111  21 1     83211    
out 2013311111  11 21    432      
jul 20131111111 21121    113111 1  
abr 20132     11       2     1  
jan 20131     411            1  
out 20123111   3213     42    11 
jul 20121111   3322     51       
abr 20121     54211    311      
jan 2012      32       1     21 
out 2011111    3211     4     1  
jul 20111     22 1     21    1  
abr 2011      431      411   11 
jan 20111     431      3     1  
out 20103111111 11       5        
jul 20101111111                   
abr 2010111111           42    1  
jan 20101111111    1     1111     
out 20091111111 11 1     3        
jul 2009221111  1        5     21 
abr 20091111111 1        421      
jan 2009211    22 1     621   11 
out 20081     11 1     522      
jul 20081     2211     4        
abr 200811111  11       3111     
jan 20081     2222     2        
out 2007      111      4        
jul 20072     11                
abr 2007      111               
jan 2007      111      21       
out 2006111111  111      1        
jul 2006      1111     3        
abr 2006111111  111      1111     
jan 200621    1111     5111     
out 2005111    111               
jul 20051111111 1111     11111 1  
abr 200511             1111     
jan 200521111           111111   

 

Distribuição de edições de artigos por wikcionaristas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikcionaristasEdições total
159100.0%16,346100.0%
32135.6%16,29399.7%
101220.3%16,23899.3%
32915.3%16,19799.1%
10058.5%15,94297.5%
31646.8%15,70396.1%
100046.8%15,70396.1%
316223.4%12,19774.6%

 

1 wikcionaristas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions
agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
EspreonUC3 01,89634111mar 10, 201375019-41-

 

20 wikcionaristas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
InterwicketUC17,344jan 29, 20092251nov 08, 20101603
JamesUC24,853jan 09, 20053732mar 08, 20092213
BlackkdarkUC4239fev 09, 20092240out 26, 2012885
Orel BeilinsonUC587jul 30, 2012973ago 07, 2012965
LipeFontouraUC667fev 17, 20082598fev 18, 20082597
SpacebirdyUC756ago 01, 20072798nov 07, 20111239
StardsenUC845mai 29, 2013670mar 04, 2014391
Thamizhpparithi MaariUC916fev 05, 20121149mar 08, 20121117
WōdenhelmUC1015fev 27, 20072953dez 20, 20101561
Gott wisstUC1110jun 01, 20092128jun 10, 20092119
SajasazeUC128fev 12, 20063333mai 13, 20063243
RoggyUC138jul 15, 20092084jul 15, 20092084
LwhUC147out 19, 20111258abr 12, 20121082
MalaysiaboyUC157jan 08, 201581fev 03, 201555
Hayden120UC166set 19, 20101653out 16, 20101626
PiolinfaxUC175mar 26, 20063291fev 20, 20092229
MalafayaUC185set 12, 20082390mai 02, 2013697
PiRSquared17UC195out 18, 2012893nov 25, 2013490
JorunnUC204nov 27, 20072680jan 29, 20082617
SaforrestUC213jan 11, 20053730jul 17, 20082447

 

usuários anônimos, ordenados por número de contribuições
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
66.177.127.727
189.32.16.8821
85.211.65.20416

No total 221 edições foram feitas por usuários anônimos, de um total de 37549 edições ( 0e %)
  


21 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
RobotGMwiktUC18,684jul 12, 20053548jun 06, 20082488--
HydrizBotUC22,705abr 23, 20121071jan 24, 201565--
Luckas-botUC32,275mar 06, 20092215jan 26, 2014428--
JAnDbotUC41,514abr 18, 20121076mar 29, 20151--
KamikazeBotUC51,356out 18, 20111259fev 27, 2013761--
VolkovBotUC61,233ago 20, 20072779abr 18, 2013711--
SpaceBirdyBotUC7784jun 22, 20082472dez 30, 20091916--
WikitanvirBotUC8537abr 15, 20111445jan 19, 20121166--
AvocatoBotUC9379out 27, 20111250out 31, 2012880--
ArthurBotUC10356nov 14, 20101597nov 03, 20111243--
MonoBotUC11349dez 25, 20072652jun 14, 20082480--
YS-BotUC12244set 11, 2012930mar 31, 2015---
MjbmrbotUC13188jan 21, 20111529mar 28, 20111463--
CaBotUC14158nov 27, 20101584nov 27, 20101584--
RoggBotUC1562jul 14, 20092085abr 18, 20111442--
CarsracBotUC1659jul 15, 20092084mai 29, 2013670--
WarddrBOTUC1747jul 25, 2012978ago 17, 2013590--
MelancholieBotUC1814mar 11, 20092210out 03, 20092004--
Makecat-botUC198nov 18, 2012862jan 22, 2013797--
ChuispastonBotUC207mai 25, 20111405jun 09, 20111390--
GhalyBotUC211jan 18, 2013801jan 18, 2013801--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110JpgPng
mar 20152,4 k4602523161423220460     311
fev 20152,4 k4602523161423220460     211
jan 20152,4 k4552523161423220460     1311
dez 20142,4 k4522523161423220460     611
nov 20142,4 k4512523161423218960     1211
out 20142,4 k4482523161393218960     7311
set 20142,4 k4472523161383218960     311
ago 20142,4 k4422523161383218960     411
jul 20142,4 k4372523161383218960     2611
jun 20142,4 k4372523161383218960     7811
mai 20142,4 k4372523161383218860     7011
abr 20142,4 k4362523161383218860     9511
mar 20142,4 k4322523151383218860     7411
fev 20142,4 k4292523151383218860     36711
jan 20142,4 k4252523151383218460     15411
dez 20132,4 k4172523151353218460     5111
nov 20132,4 k4162523141343218460     18511
out 20132,4 k4122023101342918460     14811
set 20132,4 k4082023101342918260     6611
ago 20132,4 k3892023091342918260     22911
jul 20132,4 k3852023091341417360     29511
jun 20132,4 k3762023081341417360     111
mai 20132,4 k3752023081341417360     411
abr 20132,4 k3732023081341417360     311
mar 20132,4 k3692023081341417360     111
fev 20132,4 k3612023081341417360     111
jan 20132,4 k3542023081341417360     111
dez 20122,4 k3532023081341417360     111
nov 20122,4 k3482023081341417360     111
out 20122,4 k3472023081341417360     1911
set 20122,4 k3422023081341417360      11
ago 20122,4 k3382023081341417360     7411
jul 20122,4 k3322023081341417360     1311
jun 20122,4 k3262023081341417360     111
mai 20122,4 k3142023081341417360     111
abr 20122,4 k3072023081341417360     111
mar 20122,4 k3012023071341417360     311
fev 20122,4 k2982023071341417360     1611
jan 20122,4 k2872023071331417360      11
dez 20112,4 k2852023071331417360      11
nov 20112,4 k2802023071331417360     511
out 20112,4 k2652023071321417360     511
set 20112,4 k2612023071321417360     111
ago 20112,4 k2552023071321417360      11
jul 20112,4 k2492023071321417360     211
jun 20112,4 k2412023071321417360      11
mai 20112,4 k2382023071321417360      11
abr 20112,4 k2322023071321417360      11
mar 20112,4 k2202023071321417360      11
fev 20112,4 k2182023071321417360     511
jan 20112,4 k2102023071321417360     111
dez 20102,4 k2062023071321417360     311
nov 20102,4 k2032023071311217360     5511
out 20102,4 k1972023061311217360     37311
set 20102,4 k1922023061311217360     44211
ago 20102,4 k1872023061311217360     35411
jul 20102,4 k1702023061311217360     48111
jun 20102,4 k1702023061311217360     39311
mai 20102,4 k1582023061311217360     33711
abr 20102,4 k1562023061311217160     19511
mar 20102,4 k1512023061311217160     24011
fev 20102,4 k1482023061311217160     30811
jan 20102,4 k1452023061311217160     28711
dez 20092,4 k1342023061311217160     31011
nov 20092,4 k1322023061311217160     35711
out 20092,4 k1292023061311217160     33911
set 20092,4 k1262023061311217160     30111
ago 20092,4 k1222023061311217160     52911
jul 20092,4 k1222023061311217160     20311
jun 20092,4 k1182023061311217160     23511
mai 20092,4 k1152023061301217160     38111
abr 20092,4 k1132023061301217160     28211
mar 20092,4 k1032023061301217160     83011
fev 20092,3 k941923061141217160     38711
jan 20092,3 k891923061141217160     811
dez 20082,3 k881923061121217160     911
nov 20082,3 k871923061121217060     111
out 20082,3 k711923061121217060     111
set 20082,3 k611923061121217060     211
ago 20082,3 k611923061121217060     111
jul 20082,3 k601923061121217060     111
jun 20082,3 k561923061121217060     13111
mai 20082,2 k511923061121217060     111
abr 20082,2 k501923061121217060     5111
mar 20082,2 k491923051121216760     8111
fev 20082,2 k461823051121216660     10911
jan 20082,2 k421823051071216260     111
dez 20072,2 k401823051071216260     411
nov 20072,2 k361823051071216260     111
out 20072,2 k351823051051216260      11
set 20072,2 k331823051051216260     611
ago 20072,2 k301722981021216260     3111
jul 20072,2 k241722981011216260     311
jun 20072,2 k24172298951216260     8111
mai 20072,1 k24172288951216260     39011
abr 20071,9 k24172283881215850      11
mar 20071,9 k24172283881215850     311
fev 20071,9 k24172283881215850     411
jan 20071,9 k23172283871215750      11
dez 20061,9 k21172282871215750      11
nov 20061,9 k20172282871215750      11
out 20061,9 k20162282871215750     19211
set 20061,8 k20162282871215650     3811
ago 20061,8 k19162282871215550     9711
jul 20061,8 k19162282871215550      11
jun 20061,8 k15162282871215550     25511
mai 20061,8 k14142281861214550     611
abr 20061,8 k14142280861214450     13911
mar 20061,7 k14142280831213450     27911
fev 20061,6 k14141279681212227     1797 1
jan 20061,6 k13141278681211927     6 1
dez 20051,6 k11121278681211926     345 1
nov 20051,5 k611 2746249626     1  
out 20051,5 k611 2726249626     12  
set 20051,5 k611 2726249626     38  
ago 20051,4 k610 2715439626     158  
jul 20051,3 k510 2705229526     257  
jun 20051,2 k48 2654828025     1160  
mai 200546436 238312458     719  
abr 20058232 23828 86     4  
mar 20058022 23828 82     46  
fev 20055111 2379 71     111  
jan 200514 1 2375 11     36  
dez 20041   236            
nov 20041                

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

nov 2004: 1 1 main Page

jan 2005: 1 2 Sunnandæg , 2 1 endelīf

fev 2005: 1 1 oþstandan (Gebīgednes)

mar 2005: 1 1 whose

abr 2005: 1 1 lēohtgēar

mai 2005: 1 1 hniton

jun 2005: 1 1 twig

jul 2005: 1 1 twig

ago 2005: 1 1 angsum

set 2005: 1 1 ān

out 2005: 1 1 bæcere

nov 2005: 1 1 dagur

dez 2005: 1 1 fāh (declīnung)

jan 2006: 1 1 farmer

fev 2006: 1 2 mercredi , 2 2 geágen , 3 2 gerǽden , 4 2 gewróten , 5 2 geswógen , 6 2 gerówen , 7 2 gehwósen , 8 2 gehwópen , 9 2 gewópen , 10 2 gesáwen , 11 2 gewáwen , 12 2 geswápen , 13 2 gescáden , 14 2 gehléapen , 15 2 gehwésen , 16 2 gelǽten , 17 2 gelácen , 18 2 gehéawen , 19 2 geháten , 20 2 gegrówen , 21 2 geglówen , 22 2 geflówen , 23 2 mót , 24 2 déag , 25 2 wát

mar 2006: 1 2 æppel , 2 2 goose , 3 1 twig

abr 2006: 1 1 bēacenfȳr

mai 2006: 1 1 willan

jun 2006: 1 1 manst

ago 2006: 1 1 bócon

set 2006: 1 1 gebróht

out 2006: 1 1 berunnon

fev 2007: 1 1 lufian

mar 2007: 1 1 lufian

mai 2007: 1 1 Hēafodtramet

jun 2007: 1 1 triskaidekaphobia

jul 2007: 1 1 Port:Mōnþas

ago 2007: 1 1 gnád

set 2007: 1 1 handicap

nov 2007: 1 1 ābacen

dez 2007: 1 1 asf.

jan 2008: 1 1 ābacen

fev 2008: 1 2 uproar , 2 2 boat , 3 1 stān

mar 2008: 1 2 ābacen , 2 1 ábacen

abr 2008: 1 1 ád

mai 2008: 1 1 Hēafodtramet

jun 2008: 1 1 goddess

jul 2008: 1 1 ymbstandan

ago 2008: 1 1 lukewarm

set 2008: 1 1 Weorc:Gemǣnscipes Port

out 2008: 1 1 Hēafodtramet

nov 2008: 1 1 Hēafodtramet

dez 2008: 1 1 difficult

jan 2009: 1 1 tīene

fev 2009: 1 2 Hēafodtramet , 2 2 folc , 3 2 dēaþ , 4 2 cyning , 5 2 difficult , 6 2 child , 7 2 ship , 8 2 English

mar 2009: 1 2 hira , 2 2 hine , 3 2 hīe , 4 2 hit , 5 2 him , 6 2 hire , 7 2 hēo , 8 2 his , 9 2 , 10 2 , 11 1 Hēafodtramet

abr 2009: 1 1 reveal

mai 2009: 1 1 twig

jun 2009: 1 2 ele

jul 2009: 1 2 Fisch , 2 2 Dienstag , 3 1 montag

ago 2009: 1 3 Hēafodtramet , 2 2 Affrica

set 2009: 1 1 his

out 2009: 1 1 ele

nov 2009: 1 1 twig

dez 2009: 1 1 hira

jan 2010: 1 1 unc

fev 2010: 1 1 twig

mar 2010: 1 1 ele

abr 2010: 1 1 ele

mai 2010: 1 1 hit

jun 2010: 1 1 hira

jul 2010: 1 1 proficient

ago 2010: 1 1 wit

set 2010: 1 2 sprǣc , 2 1 hit

out 2010: 1 1 twig

nov 2010: 1 1 humanity

dez 2010: 1 1 Hēafodtramet

jan 2011: 1 1 burning

fev 2011: 1 2 burning , 2 1 bonjour

jul 2011: 1 1 dæg

set 2011: 1 1 måndag

out 2011: 1 1

nov 2011: 1 2 heathen , 2 2 gecalen

fev 2012: 1 1 bucket

mar 2012: 1 1 Weorc:Gemǣnscipes Port

abr 2012: 1 1

mai 2012: 1 1 insanity

jun 2012: 1 1 perdition

jul 2012: 1 1 hēo

ago 2012: 1 1 cild

out 2012: 1 1 bearn

nov 2012: 1 1

dez 2012: 1 1 cyning

jan 2013: 1 1 asf.

fev 2013: 1 1 naht

mar 2013: 1 1 Hrēþmōnaþ

abr 2013: 1 1 dēaþ

mai 2013: 1 1 Eald Seaxisc

jun 2013: 1 1 heard

jul 2013: 1 1 Hēafodtramet

ago 2013: 1 2 Niðerlendisc , 2 2 hēafod , 3 2 Þēodisc , 4 2 land , 5 2 maandag , 6 1 Wasserpflanze

set 2013: 1 1 silofr

out 2013: 1 1 Niðerlendisc

nov 2013: 1 2 dēaþ , 2 2 thiu , 3 1 Baðanceaster

dez 2013: 1 1 Héafodtramet

jan 2014: 1 1 beorn

fev 2014: 1 1 they

mar 2014: 1 2 language , 2 2 English , 3 1 Old English

abr 2014: 1 1 Monday

mai 2014: 1 1 punish

jun 2014: 1 1 áihta

jul 2014: 1 2 engelsk , 2 1 folc

ago 2014: 1 1 favor

set 2014: 1 1 reveal

out 2014: 1 1 sēon

nov 2014: 1 1 Hēafodtramet

dez 2014: 1 2 Hēafodtramet

jan 2015: 1 2 Januari

fev 2015: 1 1 Februari

mar 2015: 1 1 size

No data on this page have been normalized to 30 day months (as WMF does on certain traffic reports).
Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Quinta-feira, 7 de maio 2015 18:46

Dump file angwiktionary-20150401-pages-meta-history.xml.7z (full dump), size 2.6 Mb as 7z -> 54 Mb
Dump processed till Mar 31, 2015, on server stat1002, ready at Fri-03/04/2015-14:57 after 28 sec.

Versão do script:2.6
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.