Estatísticas da Wikcionário azeri

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist

Metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.
See also metrics definitions


 
Monthly counts & Quarterly rankings: dezembro 2015
 
DataWikcionaristasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
dez 20150%   +2%-25%  +81%      +2%
nov 2015+2%   +3%+14%  +2%      +1%
out 20150%   +3%+17%  -13%      0%
set 2015+2%   +2%+7%  +34%      0%
ago 2015+4%   +2%-10%  -24%      0%
jul 20150%   +3%+19%  -9%      +2%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
dez 201550 8342 k304,6 11 k      106
nov 20155013241 k404,4 6,2 k      104
out 201549 2240 k354,4 6,1 k      103
set 20154915139 k304,3 7,0 k      103
ago 20154824238 k284,2 5,2 k      103
jul 201546 4137 k314,2 6,9 k      103
jun 20154613236 k264,1 7,5 k      101
mai 20154513135 k294 4,6 k      100
abr 201544 2234 k394 5,4 k      100
mar 20154412233 k4246203,6 k36 Mb3,2 M9,3 k322 k9,3 k530100
fev 201543 3132 k3546192,5 k35 Mb3,1 M9,3 k317 k9,0 k52999
jan 201543 3131 k244,16212,2 k34 Mb3,1 M9,3 k313 k9,0 k52999
dez 201443 2130 k294,16282,2 k34 Mb3,1 M9,3 k304 k8,9 k52999
nov 201443 1129 k434,16312,5 k34 Mb3,1 M9,3 k300 k8,9 k52998
out 201443 4128 k364,26304,0 k33 Mb3,1 M9,3 k300 k8,9 k52997
set 201443 2127 k424,36545,5 k33 Mb3,0 M9,3 k285 k8,9 k52994
ago 20144313126 k354,27024,4 k32 Mb3,0 M9,3 k253 k8,9 k52993
jul 201442 3225 k384,37463,4 k31 Mb3,0 M9,3 k219 k8,9 k52991
jun 201442 4223 k464,37644,7 k31 Mb2,9 M9,2 k208 k8,7 k53090
mai 201442 4222 k584,47317,0 k29 Mb2,8 M8,6 k205 k8,0 k51786
abr 201442 2220 k534,47084,5 k27 Mb2,6 M7,5 k198 k7,1 k50977
mar 201442 3219 k454,66762,7 k24 Mb2,2 M6,8 k196 k5,7 k50774
fev 20144215217 k464,86782,8 k23 Mb2,2 M6,8 k194 k5,6 k50773
jan 201441 4216 k4956764,2 k22 Mb2,1 M6,7 k191 k5,4 k50772
dez 20134112214 k385,26904,3 k20 Mb1,9 M6,4 k176 k4,8 k50471
nov 20134023213 k445,47363,4 k19 Mb1,8 M6,2 k148 k4,3 k50071
out 20133814212 k535,77565,0 k18 Mb1,7 M6,1 k133 k4,1 k47967
set 20133724310 k576,17814,7 k16 Mb1,6 M5,9 k121 k3,7 k45565
ago 2013352428,5 k416,87513,2 k13 Mb1,3 M5,8 k116 k2,8 k11763
jul 201333 327,3 k257,57762,8 k12 Mb1,2 M5,8 k105 k2,7 k3561
jun 20133323 6,5 k1882135312 Mb1,1 M5,8 k96 k2,6 k358
mai 20133112 6,5 k 882471512 Mb1,1 M5,8 k96 k2,6 k358
abr 20133011 6,5 k 7,982431912 Mb1,1 M5,8 k95 k2,6 k358
mar 201329 5 6,5 k27,882447512 Mb1,1 M5,8 k95 k2,6 k358
fev 20132912 6,4 k 7,882747111 Mb1,1 M5,6 k94 k2,6 k357
jan 201328 2 6,4 k 7,782778311 Mb1,1 M5,6 k94 k2,6 k357
dez 201228 2 6,4 k 7,682899311 Mb1,1 M5,6 k93 k2,6 k357
nov 20122812 6,4 k 7,582852711 Mb1,1 M5,6 k91 k2,6 k357
out 201227   6,4 k 7,482782311 Mb1,1 M5,6 k91 k2,6 k356
set 201227 3 6,4 k 7,382772511 Mb1,1 M5,6 k90 k2,6 k356
ago 201227 216,4 k17,28281,2 k11 Mb1,1 M5,6 k89 k2,6 k356
jul 201227 416,3 k5783091511 Mb1,1 M5,6 k87 k2,6 k356
jun 20122713 6,2 k17,184956211 Mb1,1 M5,6 k82 k2,6 k354
mai 20122614 6,1 k 785076311 Mb1,1 M5,6 k81 k2,6 k352
abr 201225 2 6,1 k 6,984960811 Mb1,1 M5,6 k80 k2,6 k352
mar 201225 2 6,1 k 6,884959911 Mb1,1 M5,5 k79 k2,6 k352
fev 201225 216,1 k66,78501,5 k11 Mb1,1 M5,5 k79 k2,6 k352
jan 201225 745,9 k96,78192,0 k10 Mb1,0 M5,5 k75 k2,4 k352
dez 2011251315,7 k56,67912,6 k9,8 Mb953 k5,4 k72 k2,3 k351
nov 2011241415,5 k26,47822,6 k9,3 Mb920 k5,2 k68 k2,3 k351
out 201123 2 5,4 k 67812,7 k9,2 Mb907 k5,2 k67 k2,3 k351
set 201123 3 5,4 k15,57893769,1 Mb898 k5,2 k60 k2,3 k351
ago 20112311 5,4 k 5,47923579,1 Mb896 k5,2 k59 k2,2 k350
jul 201122 3 5,4 k15,47932829,0 Mb895 k5,2 k58 k2,2 k350
jun 201122 2 5,4 k 5,37958459,0 Mb888 k5,1 k58 k2,2 k350
mai 201122 3 5,3 k 5,27985998,9 Mb886 k5,1 k54 k2,2 k350
abr 201122 915,3 k85,18041,6 k8,9 Mb884 k5,1 k50 k2,2 k350
mar 201122 535,1 k1357872,0 k8,2 Mb807 k4,9 k47 k2,1 k349
fev 2011221534,7 k2357452,3 k6,9 Mb661 k4,3 k41 k1,7 k349
jan 201121 424,0 k195,36651,5 k5,5 Mb517 k2,9 k39 k961548
dez 2010211623,5 k185,77032,0 k5,1 Mb483 k2,6 k36 k754747
nov 2010201532,9 k196,17191,9 k4,3 Mb410 k1,8 k30 k502743
out 2010191532,3 k96,77251,4 k3,5 Mb342 k1,5 k26 k349743
set 201018 222,1 k46,97106763,0 Mb280 k1,3 k22 k208742
ago 2010181532,0 k476711,1 k2,6 Mb235 k1,2 k22 k208742
jul 2010172311,8 k 6,95923821,8 Mb163 k1,1 k21 k208741
jun 201015 211,8 k 6,85882551,8 Mb161 k1,1 k21 k209741
mai 201015 111,8 k 6,65893291,8 Mb160 k1,1 k20 k209741
abr 201015 111,8 k 6,45863481,8 Mb159 k1,1 k20 k209741
mar 2010151211,8 k 6,35842531,8 Mb159 k1,1 k20 k209741
fev 201014 111,8 k 6,15811921,7 Mb158 k1,1 k19 k209241
jan 201014 211,8 k 65811791,7 Mb158 k1,1 k19 k209241
dez 2009141111,8 k 5,95802331,7 Mb158 k1,1 k19 k210241
nov 200913 111,8 k 5,85802491,7 Mb158 k1,1 k19 k210241
out 200913 211,8 k 5,75812451,7 Mb158 k1,1 k19 k210241
set 2009132211,8 k 5,55793701,7 Mb157 k1,1 k18 k210241
ago 200911 111,8 k 5,45813611,7 Mb156 k1,0 k18 k210240
jul 200911 111,8 k 5,25812781,7 Mb156 k1,0 k17 k210240
jun 200911 111,8 k 55811901,7 Mb156 k1,0 k17 k210238
mai 200911 111,8 k 4,95792841,7 Mb155 k1,0 k17 k210238
abr 200911 111,8 k 4,85793941,7 Mb155 k1,0 k17 k211238
mar 200911 111,8 k 4,55806521,7 Mb155 k1,0 k16 k211238
fev 2009111211,8 k 4,25891,1 k1,7 Mb160 k1,0 k16 k211238
jan 200910 211,8 k33,66114011,6 Mb166 k1,0 k12 k212238
dez 200810 111,7 k43,65958071,5 Mb153 k96811 k225238
nov 2008101211,5 k53,35346011,3 Mb129 k8069,0 k279233
out 20089 111,4 k123,24108261014 kb94 k6997,6 k269133
set 20089 111,0 k123,6363745670 kb62 k5126,1 k126132
ago 20089   685 4,338280492 kb44 k4145,6 k109 27
jul 20089   682 4,2383117488 kb44 k4145,4 k109 27
jun 2008911 680 4,138285484 kb44 k4045,3 k109 26
mai 20088   672 4385126479 kb44 k3955,1 k108 26
abr 20088   671 3,838653475 kb44 k3954,8 k108 26
mar 20088   670 3,738665467 kb44 k3954,4 k108 26
fev 20088   670 3,638697464 kb44 k3954,2 k108 26
jan 2008811 670 3,5386100451 kb44 k3953,3 k108 26
dez 2007711 669 3,338653438 kb44 k3952,3 k108 26
nov 20076 1 66913,338579435 kb44 k3952,1 k110 26
out 2007612162553,4399404406 kb40 k3932,0 k110 24
set 20075 1148493,5364840283 kb28 k3161,1 k79 11
ago 20075 1121833,924856287 kb7,7 k33448030 9
jul 2007511 112 2,62394141 kb3,4 k1343261 3
jun 20074   104 2,5236238 kb3,1 k982901 3
mai 20074   104 2,4236538 kb3,1 k982891 3
abr 2007412 10312,42355238 kb3,1 k982861 3
mar 20073   65 32301423 kb1,9 k162801 3
fev 20073 1 63 2,92232422 kb1,9 k62761 3
jan 2007311 5922,72249921 kb1,7 k62532 3
dez 20062   12 4,933965,5 kb33461281 3
nov 20062   11 4,831935,2 kb30661281 3
out 20062   11 4,531825,2 kb30561281 3
set 2006211 11 4,431375,2 kb29961281 3
ago 20061   7 5,9365 4,6 kb26461281 3
jul 20061   7 5,936514,6 kb26461281 3
jun 20061   6 6,7406164,5 kb25061281 3
mai 20061   2 121474 5,9 kb357 127 293
abr 20061   2 12147415,9 kb357 127 293
mar 20061   1 231442 4,0 kb228 127 293
fev 20061   1 23144274,0 kb228 127 293
jan 20061   1 16143294,0 kb227 127 291
dez 20051   1 732761,7 kb41 127  1
nov 20051   1 1  14       
out 20051   1 1  14       
set 20051   1 1  14       
ago 20051   1 1  14       
jul 20051   1 1  14       
jun 20051   1 1  14       
mai 20051   1 1  14       
abr 20051   1 1  14       
mar 20051   1 1  14       
fev 20051   1 1  14       
jan 20051   1 1  14       
dez 200411  1 1 114       
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
The following table ranks this project in relation to projects in other languages with 1000+ articles
out 201550 4829482082 29      136
jul 201550 3335481881 38      136
abr 201551 4931491683 31      136
jan 20155132413651237984138319047734136
out 20144940293351177373036308745734136
jul 20145033352653216862937308751733136
abr 20145033452861166862240319051734136
jan 20145041312563126262542349250734136
out 20135028322569134662143369155734136
jul 20135040422774202463551449157878136
abr 201351246251776419469534592618107136
jan 201353455354766723364524392618105136
out 201252368049736324360504189628104136
jul 201251483537714227359494087608106136
abr 201252395152716529366494086617106136
jan 2012513523177034323415343836110105136
out 2011533953486867374465345816112103136
jul 2011534345486756464635243806211104136
abr 2011533319366634483484841806210102136
jan 201153353924682241643575183641897136
out 201058273331753531748615591682994136
jul 2010602050597966261074706497703789136
abr 2010614678597757281071676295673690136
jan 20106232555374603110716660936335100136
out 2009624060547355311068656092633398136
jul 200967407655735937967635593623298136
abr 200964507953695338961635487612798136
jan 200964595435693949950615386642899136
out 20086236573473255415336959916923101135
jul 20086232724579597575727771997234114135
abr 20086442774978647171777570987033109135
jan 20086035565174596868727165947229108135
out 20077129473872366464527160907126110135
jul 200773305644905964647697921009788106134
abr 20077831464787566161849690979582105134
jan 20078533524491455555749891110926499134
out 200694396643101535050106108111107966597134
jul 2006107406738105534646111109110104905596134
abr 20061043753351074842428410199110805438134
jan 200691455934101413737719695100734439126
out 200584   95    114     114
jul 200578   89    109     109
abr 200574   82    97     97
jan 200564   70    85     85
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100ediçõesbytes
 WikcionaristasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikcionaristas (usuários registrados)
A = Wikcionaristas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikcionaristas que editaram pelo menos dez vezes desde que chegaram
C = Wikcionaristas que contribuíram cinco vezes ou mais este mês
D = Wikcionaristas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  2500  5  10  100  1000  1  3  5  10  25  5  10  1  3  5  10  25  100  250  1000  5  10  100 
dez 20152410854332 333252221  11543322 221
nov 201563333222122213      9222111 222
out 2015114222222 33312      105321   321
set 2015107533111 4441621    105321   222
ago 2015105433221 44412      82222   222
jul 201565411111 33311      422211  222
jun 201585332211 33311      21      221
mai 201564322111 333121     73322   221
abr 201583222221 443231   2263221   321
mar 201593222221 332 2    11331     221
fev 201594322111 222 32     103      221
jan 201586322111 442 41     93311   221
dez 201473221111 332 1      3       221
nov 201462111111 11  21     71      22 
out 201484421111 1111       411     2  
set 201463222111 11114      822     22 
ago 201483321111 22211      411     11 
jul 201474322221 222        311111  111
jun 201475443222 331 321    7422111 111
mai 20141064332221332 22222  63322211111
abr 201484222222 221 311    13311111 111
mar 201473333211 222 31     621     11 
fev 201485554221 222 3      7111       
jan 201484444221 443 42     125322   22 
out 2015114222222 33312      105321   321
jul 201565411111 33311      422211  222
abr 201583222221 443231   2263221   321
jan 201586322111 442 41     93311   221
out 201484421111 1111       411     2  
jul 201474322221 222        311111  111
abr 201484222222 221 311    13311111 111
jan 201484444221 443 42     125322   22 
out 201364443222 222 3      9431111 1  
jul 20136333222  221 111    911111  21 
abr 201331111   541        3       221
jan 201352211   761 31     211     21 
out 201291     332 31     631     22 
jul 2012764311   542 7222   154311   22 
abr 20128421    653 22     311     22 
jan 201212875441  761 6431   954211  32 
out 201152221   5431211    6       11 
jul 20117432    431 311    71      11 
abr 201114995511  431 522    85432   11 
jan 201110442222  541 4331   811111  11 
out 20105555532      7431   127752   11 
jul 20105533211      2221   42222      
abr 20104311111             5411    22 
jan 2010622111   1   3      5111    1  
out 2009322111       11     3          
jul 20092111111  1          41      11 
abr 20093211111  11         211        
jan 20094321111  22         72211   11 
out 20083211111  22  42     953111     
jul 20081      11  1      3          
abr 20082      11         1          
jan 20081111    11  2      2          
out 2007222221   11  2      42222      
jul 200731111                         
abr 200732221              22111      
jan 200711111   11         11         
out 2006                  1          
jul 2006                  1          
abr 20061          1      1          
jan 200611         4      521        
out 2005                             
jul 2005                             
abr 2005                             
jan 2005                             

 

Distribuição de edições de artigos por wikcionaristas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikcionaristasEdições total
1219100.0%107,802100.0%
37333.3%107,57599.8%
105022.8%107,44499.7%
322913.2%107,05399.3%
100219.6%106,55998.8%
316156.8%105,49997.9%
1000104.6%102,98195.5%
316241.8%92,38185.7%
1000020.9%77,90572.3%
3162320.9%77,90572.3%

 

24 wikcionaristas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions
agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
SinanUC2 038,3621,3248,613324jul 13, 200730928,3771363,36986
Əsgər FUC3+17,4821,564202ago 23, 20151293,55074571
Lo XimiendoUC11 068435322nov 22, 201018649-9-
Aabdullayev851UC12+15582535472470nov 17, 20154349474948
Cekli829UC15-1351481746set 15, 2009229710-59945
Sabri76UC16-1305870-jun 20, 201020191-19-
MalafayaUC19-116373253out 05, 2008264229-1261
Dalmo PereiraUC20 01101540-mai 02, 201524294101-
BikarhênerUC21-210754-ago 16, 2015136----
MehridadUC27-15619-mai 02, 2013972111-
CalqUC41+1171--jan 15, 20131079----
Elmeddin82UC67+13412-mai 27, 20102043--1-
SerkanlandUC96+303182out 24, 2015671-51
BeyazaltınUC97...33--dez 28, 2015211--
Sabuhi from BakuUC128...22--dez 11, 201519----
Sübhan Nebiyev04UC210...11--dez 02, 20152811--
এম আবু সাঈদUC211...11--dez 03, 201527----
Sefer azeriUC212...11--dez 11, 201519----
Araz YaqubogluUC213...116-dez 11, 201519--3-
Calal99UC214...11--dez 11, 201519----
AzerifactoryUC215...11--dez 11, 201519----
QolcomaqUC216...11--dez 11, 201519----
MarcoAurelioUC217...11--dez 22, 20158----
IvanScrooge98UC218...11--dez 24, 20156----

 

20 wikcionaristas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
Faiq ƏsgərUC139,543dez 01, 2013759ago 23, 2015129
InterwicketUC46,994jan 29, 20092526nov 08, 20101878
Sinek~azwiktionaryUC52,190set 07, 20092305abr 22, 2013982
Hacı FaiqUC62,063out 01, 2013820out 31, 2013790
Hacı ƏsgərUC71,950nov 01, 2013789nov 30, 2013760
Hacı FətullaUC81,791set 01, 2013850set 30, 2013821
Mirzə MəmmədquluUC91,547ago 01, 2013881ago 31, 2013851
Mirza HasanquluUC101,059jun 19, 2013924jul 31, 2013882
SalicynaUC13507fev 07, 20111787ago 25, 20111588
123snake45UC14394mai 11, 2013963jul 04, 2015179
VagoUC17190jul 12, 20101997jul 07, 20111637
Safavi~azwiktionaryUC18185jun 05, 20121303jul 22, 20121256
AydınUC2294out 15, 20072998out 21, 20072992
CommonsDelinkerUC2387dez 07, 20072945out 11, 201580
YurdumquluUC2471jun 25, 2013918ago 22, 2013860
Baki66UC2561jan 06, 20073280set 24, 20073019
NKOziUC2659mar 31, 20111735dez 29, 20111462
TaryelUC2833dez 25, 20072927dez 25, 20072927
Stern88888UC2933mar 14, 20102117mar 14, 20102117
MehrdadUC3030dez 10, 20053672jul 13, 20082726

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 2.745 edições foram feitas por usuários anônimos, de um total de 191.643 edições ( 1e %)
  


19 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
HydrizBotUC131,216abr 23, 20121346dez 31, 2015---
JAnDbotUC219,106mai 18, 20111687dez 30, 2015---
MalafayaBotUC310,361nov 18, 20111503dez 23, 20157--
Luckas-botUC46,051mar 03, 20092493jan 27, 2014702--
YS-BotUC55,502set 08, 20121208out 19, 201572--
KamikazeBotUC64,181out 18, 20111534mar 06, 20131029--
VolkovBotUC7972out 01, 20073012abr 05, 2013999--
AvocatoBotUC8631out 31, 20111521ago 25, 2013857--
WikitanvirBotUC9630abr 14, 20111721jan 19, 20121441--
ArthurBotUC10620nov 14, 20101872nov 12, 20111509--
RoggBotUC11443fev 07, 20092517jun 12, 20111662--
SpaceBirdyBotUC12378jul 07, 20082732dez 30, 20092191--
MjbmrbotUC13356jan 18, 20111807mar 28, 20111738--
WarddrBOTUC14300jul 25, 20121253ago 18, 2013864--
RobotGMwiktUC15212jan 09, 20073277jun 06, 20082763--
CarsracBotUC16107out 16, 20092266mai 30, 2013944--
Makecat-botUC1723nov 10, 20121145abr 05, 2013999--
GhalyBotUC182jan 06, 20131088jan 06, 20131088--
MelancholieBotUC191out 07, 20092275out 07, 20092275--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110JpgOggSvg
dez 201542 k479241151,6 k33,5 k       911
nov 201541 k473241151,5 k33,3 k       911
out 201540 k471241151,5 k33,1 k       911
set 201539 k470241051,5 k33,1 k       811
ago 201538 k469241051,5 k33,1 k       811
jul 201537 k468241051,5 k32,9 k       811
jun 201536 k466241051,5 k32,8 k       811
mai 201535 k466241051,5 k32,8 k       811
abr 201535 k465241051,5 k32,7 k       811
mar 201533 k464241051,5 k32,6 k      2705811
fev 201532 k464241051,5 k32,6 k      1892811
jan 201531 k458241051,5 k32,6 k      1401811
dez 201430 k453241051,5 k32,6 k      1401811
nov 201429 k451241051,5 k32,6 k      1893811
out 201428 k44624951,5 k32,4 k      21238 1
set 201427 k44524951,5 k32,4 k      23358 1
ago 201426 k44024951,5 k32,4 k      19568 1
jul 201425 k43524951,5 k32,4 k      25488 1
jun 201423 k43424951,5 k32,3 k      43188 1
mai 201422 k43224951,4 k32,1 k      56748 1
abr 201420 k43124951,1 k31,5 k      42878 1
mar 201419 k42824951,1 k31,4 k      23688 1
fev 201417 k42524951,1 k31,4 k      23828 1
jan 201416 k42024951,1 k31,4 k      28528 1
dez 201314 k41324951,1 k31,3 k      22258 1
nov 201313 k41324951,1 k31,3 k      24998 1
out 201312 k40724951,1 k31,2 k      41608 1
set 201310 k40424951,1 k31,1 k      40038 1
ago 20138,6 k39024951,0 k31,1 k      19628 1
jul 20137,3 k38424851,0 k31,1 k      18157 1
jun 20136,6 k37724751,0 k31,0 k      1376 1
mai 20136,5 k37624751,0 k31,0 k      546 1
abr 20136,5 k37424751,0 k31,0 k      286 1
mar 20136,5 k37024751,0 k31,0 k      1466 1
fev 20136,4 k36124751,0 k31,0 k      276 1
jan 20136,4 k35424751,0 k31,0 k      526 1
dez 20126,4 k35124751,0 k31,0 k      536 1
nov 20126,4 k34424751,0 k31,0 k      296 1
out 20126,4 k34224751,0 k31,0 k      136 1
set 20126,4 k33824751,0 k31,0 k      666 1
ago 20126,4 k33224751,0 k31,0 k      3006 1
jul 20126,4 k32724751,0 k31,0 k      2076 1
jun 20126,2 k32424751,0 k31,0 k      716 1
mai 20126,2 k31124751,0 k31,0 k      756 1
abr 20126,2 k30424751,0 k21,0 k      346 1
mar 20126,2 k29724751,0 k21,0 k      226 1
fev 20126,2 k29624751,0 k21,0 k      7826 1
jan 20126,0 k28924751,0 k21,0 k      14136 1
dez 20115,7 k28424759562974      12346 1
nov 20115,5 k27924759292715      3456 1
out 20115,5 k26324759222692      606 1
set 20115,5 k25724759222691      536 1
ago 20115,4 k25124759192691      266 1
jul 20115,4 k24724759182665      546 1
jun 20115,4 k23924759162665      326 1
mai 20115,4 k23624759152662      496 1
abr 20115,4 k22624759142632      9916 1
mar 20115,1 k21724759032551      15046 1
fev 20114,7 k21424758682532      20726 1
jan 20114,1 k20423658282514      12755 1
dez 20103,5 k19823358142503      15092 1
nov 20103,0 k19523257512363      14291 1
out 20102,4 k19123246612333      14361 1
set 20102,1 k18423146142313      671  1
ago 20102,0 k17822 46112312      1045   
jul 20101,9 k16122 44762312      375   
jun 20101,9 k16022 44312312      255   
mai 20101,9 k14822 44292312      325   
abr 20101,9 k14622 44292312      343   
mar 20101,9 k14222 44292312      252   
fev 20101,8 k13722 44292312      189   
jan 20101,8 k13522 44292312      170   
dez 20091,8 k12022 44282312      226   
nov 20091,8 k11922 44272312      242   
out 20091,8 k11522 44272312      238   
set 20091,8 k11322 44272312      370   
ago 20091,8 k10622 44262312      359   
jul 20091,8 k10622 44262312      269   
jun 20091,8 k10421 44262312      184   
mai 20091,8 k10221 44252312      263   
abr 20091,8 k10021 44252311      377   
mar 20091,8 k9321 44252311      562   
fev 20091,8 k9019 44252311      810   
jan 20091,8 k8119 44212311      294   
dez 20081,7 k7819 44132289      715   
nov 20081,6 k7619 43472157      484   
out 20081,4 k6319 1284297      785   
set 20081,1 k5019 1201283      696   
ago 20087124917 1186270      1   
jul 20087094917 1186270      2   
jun 20087064716 1186270      28   
mai 20086984216 1184270      2   
abr 20086974216 1184270      2   
mar 20086964116 1184270      1   
fev 20086964016 1184270      1   
jan 20086964016 1184270      11   
dez 20076953816 1184269      35   
nov 20076953616 1184268      64   
out 20076493516 1182266      329   
set 20074953116 1175252      802   
ago 20072272915 1155220      530   
jul 20071152514 111222      30   
jun 20071072514 111222          
mai 20071072514 111222          
abr 20071062514 111222      47   
mar 2007681714 110922      5   
fev 2007661614 110922      6   
jan 2007621614 110822      52   
dez 2006151513 110722      1   
nov 2006141513 110622          
out 2006141513 110622          
set 2006141313 110622      7   
ago 2006101212 19512          
jul 2006101212 19512          
jun 200691112 19412      3   
mai 200651110 18011          
abr 200651110 18011      1   
mar 200641110 18011          
fev 200641110 18011      6   
jan 200621010 18011      4   
dez 2005255 1791           
nov 2005111  78            
out 2005111  78            
set 2005111  78            
ago 2005111  78            
jul 2005111  78            
jun 2005111  78            
mai 2005111  78            
abr 2005111  78            
mar 20051 1  78            
fev 20051 1  78            
jan 20051 1  78            
dez 20041 1  78            

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

dez 2005: 1 1 main Page

jan 2006: 1 1 Ana Səhifə

fev 2006: 1 2 Main Page , 2 2 Ana Səhifə , 3 1 ana Səhifə

abr 2006: 1 1 Azərbaycan dili

jun 2006: 1 1 qartal

set 2006: 1 1 آتا

dez 2006: 1 1 kiçik

jan 2007: 1 1 arzu

fev 2007: 1 1 əl telefonu

mar 2007: 1 1 cənub

abr 2007: 1 1 səyahət

jul 2007: 1 1 armud

ago 2007: 1 2 türkcə , 2 1 köpək

set 2007: 1 2 yaşamaq , 2 1 april

out 2007: 1 2 ülgü , 2 2 görüş , 3 2 qorumaq , 4 1 gül

nov 2007: 1 1 səhra

dez 2007: 1 1 boşqab

jan 2008: 1 1 Moskva

fev 2008: 1 1 türkcə

mar 2008: 1 1 Ana Səhifə

abr 2008: 1 1 виноград

mai 2008: 1 1 August

jun 2008: 1 1 krım tatarca

jul 2008: 1 1 جالگاه

ago 2008: 1 1 Wolf

set 2008: 1 2 afrikaans , 2 2 Afrika dili , 3 2 Qırım Tatarca , 4 2 Ana Səhifə , 5 1 od

out 2008: 1 2 мак , 2 2 ana , 3 1 teatr

nov 2008: 1 2 patlıcan , 2 2 Finlandiya , 3 2 alt , 4 2 Məkkə , 5 2 nənə , 6 2 nar , 7 2 armud , 8 2 Ana Səhifə , 9 1 qovaq

dez 2008: 1 2 ürək , 2 1 fişəng

jan 2009: 1 2 lüğət , 2 2 zər , 3 2 qaynar , 4 1 гусь

fev 2009: 1 2 yarasa , 2 2 Kullanıcı:Mardetanha , 3 1 hörümçək

mar 2009: 1 1 döngə

abr 2009: 1 2 august , 2 1 Азербайджанский язык

mai 2009: 1 3 qozu , 2 3 qoy

jun 2009: 1 2 suiti

jul 2009: 1 2 Arbeit , 2 2 Katze , 3 1 katze

ago 2009: 1 2 птица , 2 2 bayraq , 3 1 mənzərə

set 2009: 1 2 cekcə , 2 2 Cek dili , 3 2 self control , 4 2 page

out 2009: 1 2 həftə , 2 1 qapaq

nov 2009: 1 1 qapaq

dez 2009: 1 2 qovun , 2 2 banan , 3 2 Ana Səhifə , 4 1 həftə

jan 2010: 1 2 kəfgir , 2 2 pendir , 3 1 süzgəc

fev 2010: 1 1 page

mar 2010: 1 2 iribaş , 2 2 Kaulquappe

abr 2010: 1 2 skripka , 2 2 saqqal , 3 1 iribaş

mai 2010: 1 2 Ana Səhifə , 2 1 həftə

jun 2010: 1 2 Ellenbogen , 2 2 Ellbogen , 3 2 elbow

jul 2010: 1 2 teleskop , 2 2 hamam , 3 2 tiraj , 4 2 Opponent , 5 2 Cek dili , 6 2 qaşıq , 7 2 günəş , 8 2 Azərbaycan dili

ago 2010: 1 4 evlənmək , 2 3 çalma , 3 3 qızılquş , 4 3 lil , 5 3 öskürək , 6 3 ağartmaq , 7 3 yaralanmamaq , 8 3 konj , 9 3 çiyələk , 10 3 gecə , 11 3 heyva , 12 3 təsirlik , 13 3 ayı , 14 2 cover , 15 2 paxla , 16 2 palto , 17 2 menecer , 18 2 laboratoriya , 19 2 zərf , 20 2 gec , 21 2 kabel , 22 2 küknar , 23 2 yumaq , 24 2 katır , 25 2 qatır

set 2010: 1 2 brom , 2 2 шурин , 3 2 деверь , 4 2 qayın , 5 2 fıstıq , 6 2 золото , 7 2 altun , 8 2 sink , 9 2 mis , 10 2 Kimyəvi elementlərin dövri sistemi , 11 2 arsen , 12 2 мышьяк , 13 2 малахит , 14 2 meruňka , 15 2 кајсија , 16 2 кайсия , 17 2 marelica , 18 2 morela

out 2010: 1 4 sumaq , 2 3 türk , 3 3 yunan , 4 3 zəfər , 5 3 kürü , 6 3 dolma , 7 3 qırxayaq , 8 3 düymələmək , 9 3 yenot , 10 3 γαρύφαλλο , 11 3 nightingale , 12 3 süngü , 13 3 qəssab , 14 3 ekmek , 15 3 mesafe , 16 3 talaşa , 17 3 qonşu , 18 3 ayı , 19 2 верный , 20 2 alman , 21 2 помидор , 22 2 огурец , 23 2 француженка , 24 2 гречанка , 25 2 fransız

nov 2010: 1 3 nəticə , 2 3 yengeç , 3 3 maye , 4 3 ləngitmək , 5 3 yarpaq , 6 3 avokado , 7 3 kəpənək , 8 3 qələbə , 9 3 zoğ , 10 3 лягушка , 11 3 xərçəng , 12 3 üzüm , 13 2 çömçəquyruq , 14 2 otobüslerde , 15 2 domingo , 16 2 ორშაბათი , 17 2 siçovul , 18 2 salı , 19 2 pazartesi , 20 2 şahmatçı , 21 2 vücut , 22 2 safran , 23 2 xəzinə , 24 2 xəstələnmək , 25 2 heykeltıraş

dez 2010: 1 3 təsdiqləmək , 2 2 πάπια , 3 2 Golf , 4 2 valyuta , 5 2 ördəkburun , 6 2 körfəz , 7 2 nərd , 8 2 döymə , 9 2 əzələ , 10 2 solaxay , 11 2 yelkən , 12 2 zürafa , 13 2 nauka , 14 2 tamaşaçı , 15 2 şənbə , 16 2 octopus , 17 2 ördek , 18 2 Aubergine , 19 2 tərəvəz , 20 2 Affe , 21 2 ördək , 22 2 Wolf , 23 1 черепахи

jan 2011: 1 3 üstəgəl , 2 2 vegetasiya , 3 2 diod , 4 2 qovluq , 5 2 söğüt , 6 2 sfenks , 7 2 eyelash , 8 2 tavsiye , 9 2 видишь , 10 2 sevinmək , 11 2 çovğun , 12 2 strategiya , 13 2 velosiped , 14 2 abide , 15 2 sing , 16 2 speak , 17 1 lens

fev 2011: 1 3 barometr , 2 3 balıqçı , 3 3 yaltaqlıq , 4 3 mikrocərrahiyyə , 5 3 səkkiz , 6 3 əl telefonu , 7 3 Ana Səhifə , 8 2 xardal , 9 2 ilə , 10 2 hörük , 11 2 boyun , 12 2 çünki , 13 2 diktor , 14 2 yaltaqlanmaq , 15 2 yaltaq , 16 2 güzəşt , 17 2 külüng , 18 2 zənci , 19 2 qübbə , 20 2 incir , 21 2 on iki , 22 2 on bir , 23 2 dwadzieścia cztery , 24 2 dwadzieścia trzy , 25 2 hər

mar 2011: 1 3 yastıq , 2 3 şaquli , 3 3 üfüqi , 4 3 erkək , 5 3 maraqlı , 6 3 lava , 7 3 yaba , 8 3 hinduşka , 9 3 ovsunlamaq , 10 3 sześćdziesiąt pięć , 11 3 gəmi , 12 3 dekabr , 13 3 noyabr , 14 3 oktyabr , 15 3 sentyabr , 16 3 avqust , 17 2 pääsuke , 18 2 Fərat , 19 2 Dəclə , 20 2 itkin , 21 2 növbə , 22 2 ünsiyyət , 23 2 sərhədçi , 24 2 sahib , 25 2 yiyə

abr 2011: 1 3 cüyür , 2 3 qaratoyuq , 3 3 buket , 4 3 anlamaq , 5 3 ayçiçeği , 6 2 oiseau , 7 2 riyaziyyat , 8 2 eyvan , 9 2 tükətmək , 10 2 xəsis , 11 2 xəta , 12 2 xasiyyət , 13 2 təhqiqat , 14 2 dərs , 15 2 məşğələ , 16 2 təəccüb , 17 2 marş , 18 2 təxmin , 19 2 təhqiq , 20 2 təhdid , 21 2 təhqir , 22 2 tarif , 23 2 tərif , 24 2 izah , 25 2 təfsir

mai 2011: 1 3 Xorvatiya

jun 2011: 1 2 göbələk , 2 2 tərcümə , 3 1 claymore

jul 2011: 1 2 Serbiya , 2 2 Slovakiya , 3 1 çobanyastığı

ago 2011: 1 3 hədəf , 2 1 patlamak

set 2011: 1 2 γκέισα , 2 2 əqrəb , 3 1 kuyu

out 2011: 1 1 oyar

nov 2011: 1 2 maçã , 2 2 renk , 3 2 elma , 4 2 Pluton , 5 2 merkez , 6 2 manzana , 7 2 ailə , 8 2 alma , 9 1 mouse

dez 2011: 1 2 Misir , 2 2 tartaruga , 3 2 uğur , 4 2 krowa , 5 2 ποδήλατο , 6 2 geyinmək , 7 2 hazırlaşmaq , 8 2 vektor , 9 2 mizrab , 10 2 qarğıdalı , 11 2 mühərrik , 12 2 tumurcuq , 13 2 пчела , 14 2 şahmat , 15 1 marzo

jan 2012: 1 3 kenquru , 2 3 osminoq , 3 3 dinozavr , 4 3 arvad , 5 3 gəlin , 6 3 Lixtenşteyn , 7 3 böyürtkən , 8 2 xloroform , 9 2 platinum , 10 2 chloroform , 11 2 chemistry , 12 2 akustik , 13 2 velosipedçi , 14 2 idmançı , 15 2 təyyarəçi , 16 2 dəmir , 17 2 Qana , 18 2 Bosniya və Herseqovina , 19 2 oğul , 20 2 növbə , 21 2 koramal , 22 2 bibioğlu , 23 2 bibiqızı , 24 2 kitabxana , 25 2 tüstü

fev 2012: 1 2 Əskişəhər , 2 2 səhabə , 3 2 həvari , 4 2 mezarlık , 5 2 rəqəm , 6 2 nömrə , 7 1 Naxçıvan

mar 2012: 1 2 Azerbaijan , 2 1 choose

abr 2012: 1 2 arx , 2 1 donna

mai 2012: 1 2 ölkə , 2 1 panno

jun 2012: 1 2 aigua , 2 1 Aserbajdsjan

jul 2012: 1 3 body , 2 2 מים , 3 2 para , 4 2 bed , 5 2 ur , 6 2 Allah , 7 1 böcek

ago 2012: 1 2 Afghanistan , 2 2 əl , 3 1 miercuri

set 2012: 1 1 düğün

out 2012: 1 1 yumruq

nov 2012: 1 2 Versicherung , 2 2 owl , 3 2 Apfel , 4 1 Biləsuvar

dez 2012: 1 2 Cibuti , 2 1 çırpı

jan 2013: 1 2 Əlcəzair , 2 2 kəpənək , 3 1 Yugoslavya

fev 2013: 1 2 yardım , 2 1 xaç

mar 2013: 1 3 dırmıq , 2 3 Xocalı , 3 2 masturbasiya , 4 2 bambuq , 5 2 koreyalı , 6 1 մաստուրբացիա

abr 2013: 1 1 Balakən

mai 2013: 1 1 artmaq

jun 2013: 1 2 rojo , 2 2 axtarmaq , 3 1 hacer

jul 2013: 1 2 ti , 2 2 aimer , 3 2 Zaragoza , 4 2 копчёный , 5 2 fem , 6 2 اندک , 7 2 الان , 8 2 اسم , 9 2 biçmək , 10 2 sombra , 11 2 səbət , 12 2 копьё , 13 2 корзина , 14 2 aqua , 15 2 kingdom , 16 2 krallıq , 17 2 кормить , 18 2 лаваш , 19 2 косой , 20 2 косолапый , 21 2 костёр , 22 2 Stadt , 23 2 vedere , 24 2 vendere , 25 2 venire

ago 2013: 1 2 helado , 2 2 batir , 3 2 mezclar , 4 2 reír , 5 2 moreno , 6 2 кличка , 7 2 suivre , 8 2 başsağlığı , 9 2 qamçı , 10 2 careful , 11 2 birləşmək , 12 2 gün , 13 2 şam , 14 2 candle , 15 2 but , 16 2 Apia , 17 2 Samoa , 18 2 козёл , 19 2 enmək , 20 2 peigne , 21 2 öö , 22 2 yığmaq , 23 2 oğul , 24 2 Braziliya , 25 2 ya

set 2013: 1 3 yırtmaq , 2 3 yanmaq , 3 3 qısa , 4 3 qırıcı , 5 3 acı , 6 3 pəncərə , 7 3 göz , 8 3 qız , 9 3 qara , 10 2 yorğun , 11 2 Dunay , 12 2 qul , 13 2 parıltı , 14 2 balqabaq , 15 2 olmaq , 16 2 dağ , 17 2 bilet , 18 2 vicdansız , 19 2 daha , 20 2 hamilə , 21 2 yordam , 22 2 qiymət , 23 2 window , 24 2 исступлённый , 25 2 истерзать

out 2013: 1 3 ღვინო , 2 3 aldatmaq , 3 2 basdırmaq , 4 2 Maldiv adaları , 5 2 جزر المالديف , 6 2 Qərbi Sahara , 7 2 Batı Sahra , 8 2 Sahara Occidental , 9 2 Алабама , 10 2 planet , 11 2 Nasáu , 12 2 Nassau , 13 2 Нассау , 14 2 махуэ , 15 2 гъэ , 16 2 адэ , 17 2 бзэ , 18 2 пхъэгулъ , 19 2 bura , 20 2 suçlu , 21 2 изменить , 22 2 измениться , 23 2 изменник , 24 2 tutmak , 25 2 rüşvet

nov 2013: 1 2 zəhər , 2 2 yükləmək , 3 2 È un libro , 4 2 звать , 5 2 Dili , 6 2 Doha , 7 2 çağırmaq , 8 2 móðir , 9 2 mor , 10 2 sındırmaq , 11 2 söymək , 12 2 derramar , 13 2 o'ttiz , 14 2 sakkiz , 15 2 yetti , 16 2 besh , 17 2 uch , 18 2 ikki , 19 2 Solomon adaları , 20 2 Solomon Islands , 21 2 məqsəd , 22 2 Valletta , 23 2 qapıçı , 24 2 meyvə , 25 2 düzənlik

dez 2013: 1 2 Məhəmməd , 2 2 Yeni iliniz mübarək! , 3 2 qayə , 4 2 занимательный , 5 2 заниматься , 6 2 заноза , 7 2 заносчивый , 8 2 занятие , 9 2 заочный , 10 2 zabit , 11 2 yük , 12 2 yalan , 13 2 заунывный , 14 2 işğal etmək , 15 2 миндаль , 16 2 şəkər , 17 2 zarafat , 18 2 əməl , 19 2 boran , 20 2 cərimə , 21 2 müdafiəçi , 22 2 ərizə , 23 2 lemon , 24 2 bite , 25 2 Qambiya

jan 2014: 1 3 məna , 2 2 Ərəbistan dənizi , 3 2 bükmək , 4 2 təbiət , 5 2 peyk , 6 2 süni , 7 2 qanacaq , 8 2 hərf , 9 2 əski , 10 2 old , 11 2 əhəmiyyətli , 12 2 əhəmiyyətsiz , 13 2 hürriyyət , 14 2 önemsiz , 15 2 azadlıq , 16 2 etkisiz , 17 2 etkili , 18 2 güncel , 19 2 özgürlük , 20 2 səhv , 21 2 buğ , 22 2 buxar , 23 2 örtülü , 24 2 tədarük , 25 2 tədarük etmək

fev 2014: 1 3 udmaq , 2 2 Кишинёв , 3 2 Chișinău , 4 2 cüt , 5 2 Birləşmiş Ərəb Əmirlikləri , 6 2 cavab , 7 2 cavab vermək , 8 2 parlaq , 9 2 cəllad , 10 2 vergi , 11 2 rapu , 12 2 testa , 13 2 giornale , 14 2 frutto , 15 2 egli , 16 2 dente , 17 2 bambina , 18 2 bambino , 19 2 cambra , 20 2 бал , 21 2 siekiera , 22 1 Irlande

mar 2014: 1 2 Mərkəzi Afrika Respublikası , 2 2 kütlə , 3 2 balet , 4 2 televiziya , 5 2 cin , 6 2 şeytan , 7 2 adi , 8 2 rəf , 9 2 cinayət , 10 2 zəncir , 11 2 qəsəbə , 12 2 vadi , 13 2 qüllə , 14 2 qısa , 15 2 occasion , 16 2 Georgia , 17 2 Türkmənistan , 18 2 vəzifə , 19 2 Bosniya və Herseqovina , 20 2 Gürcüstan , 21 2 yeni , 22 2 bacı , 23 2 Azerbaijan , 24 2 saat , 25 1 бачыць

abr 2014: 1 2 adroit , 2 2 ödəniş , 3 2 abandonner , 4 2 tərk etmək , 5 2 mirvari , 6 2 Xoş gəlmisiniz! , 7 2 əsir , 8 2 sərbəst , 9 2 şüar , 10 2 действие , 11 2 çat , 12 2 daxma , 13 2 azad , 14 2 bölən , 15 2 dərnək , 16 2 varlı , 17 2 buzlaq , 18 2 çalışqan , 19 2 Асмэра , 20 2 Qırmızı dəniz , 21 2 شتر , 22 2 شارب , 23 2 Ostsee , 24 2 Балтыйскае мора , 25 2 İssık-Kul

mai 2014: 1 3 İsveçrə , 2 3 balıq , 3 3 pəncərə , 4 2 Bazel , 5 2 porco , 6 2 abacaxi , 7 2 Düşənbə , 8 2 Pamir , 9 2 jöl , 10 2 vinte , 11 2 Bugarska , 12 2 nida , 13 2 təşəkkür , 14 2 София , 15 2 Кура , 16 2 Augustus , 17 2 Julie , 18 2 Junie , 19 2 Mei , 20 2 Maart , 21 2 Februarie , 22 2 Januarie , 23 2 Desember , 24 2 Παραγουάη , 25 2 Парагвай

jun 2014: 1 3 açmaq , 2 3 çuğundur , 3 2 aprikoos , 4 2 নাক , 5 2 कान , 6 2 কান , 7 2 Шуэц , 8 2 Suécia , 9 2 əjdəha , 10 2 Estocolmo , 11 2 pencər , 12 2 вьюга , 13 2 Belqrad , 14 2 Niş , 15 2 , 16 2 Voyevodina , 17 2 South America , 18 2 Zaltsburq , 19 2 Vyana , 20 2 Wien , 21 2 ящерица , 22 2 Гондурас , 23 2 Tequsiqalpa , 24 2 Portu , 25 2 Berno

jul 2014: 1 2 Minsk , 2 2 çıxıb getmək , 3 2 aýy , 4 2 çıxarış , 5 2 leikur , 6 2 Cotonou , 7 2 Porto-Novo , 8 2 Порто-Ново , 9 2 ბენინი , 10 2 بنين , 11 2 Μπενίν , 12 2 Bénin , 13 2 кафта , 14 2 кьюб , 15 2 zwee , 16 2 duo , 17 2 două , 18 2 lien , 19 2 rate , 20 2 croupe , 21 2 rond , 22 2 dahi , 23 2 constant , 24 2 intérieur , 25 2 génie

ago 2014: 1 2 öpmək , 2 2 qalxan , 3 2 mühasirə , 4 2 xüsusi , 5 1 хьед

set 2014: 1 2 Yunoniston , 2 2 Yunanistan , 3 2 Yunanıstan , 4 1 scarabeo

out 2014: 1 2 coraggioso , 2 2 morrer , 3 2 yazıçı , 4 2 ölmək , 5 2 krava , 6 1 akã

nov 2014: 1 2 sındırmaq , 2 2 bardaq , 3 2 alın , 4 1 rust

dez 2014: 1 2 turp , 2 2 siçan , 3 2 qız , 4 1 беркайчан

jan 2015: 1 2 əbədi , 2 2 tender , 3 2 Burkina-Faso , 4 2 Januari , 5 2 göndərmək , 6 2 Florida , 7 1 mein

fev 2015: 1 2 qayğı , 2 2 завръщам , 3 2 muzey , 4 2 мы , 5 1 mukayyet olmak

mar 2015: 1 2 mərhələ , 2 2 pillə , 3 2 Çukot dənizi , 4 2 femton , 5 2 yağmaq , 6 2 mötəbər , 7 2 kəlləmayallaq , 8 2 etibar , 9 2 etimad , 10 2 ανάμνηση , 11 2 yel , 12 2 vint , 13 2 baldır , 14 2 quinze , 15 2 quince , 16 2 qıf , 17 2 sərhəd , 18 2 musiqi , 19 1 Bukareszt

abr 2015: 1 3 Buxarest , 2 2 rəy , 3 2 Сирия , 4 2 Syria , 5 2 Siria , 6 2 Suriya , 7 2 kar , 8 2 səs , 9 2 Bukarest , 10 2 qarğa , 11 2 on , 12 2 Rumıniya , 13 2 saqqal , 14 1 sizär

mai 2015: 1 2 yollamaq , 2 2 balta , 3 1 claudo

jun 2015: 1 2 tənqid , 2 2 üfunət , 3 2 Oxot dənizi , 4 2 daimi , 5 1 ولادى وستوک

jul 2015: 1 2 ເມກ , 2 2 oğurlamaq , 3 2 təbil , 4 2 arabir , 5 2 tərəfdar , 6 2 xaç , 7 2 yubatmaq , 8 2 ləngimək , 9 2 mən , 10 1 d'abord

ago 2015: 1 3 eşşək , 2 3 gün , 3 3 damcı , 4 3 lüğət , 5 3 quş , 6 3 yumurta , 7 3 qan , 8 2 prijatelj , 9 2 lisica , 10 2 noga , 11 2 strah , 12 2 страх , 13 2 лице , 14 2 káva , 15 2 пес , 16 2 bomull , 17 2 kaffe , 18 2 barn , 19 2 brun , 20 2 əziz , 21 2 Yəmən , 22 2 tikili , 23 2 birə , 24 2 uçmaq , 25 2 vurmaq

set 2015: 1 2 вораг , 2 2 evn , 3 2 dóttir , 4 2 barn , 5 2 Sinqapur , 6 2 koza , 7 2 şəkər , 8 2 fərq , 9 2 kömür , 10 2 vəzifə , 11 2 kəpənək , 12 2 палец , 13 2 barmaq , 14 2 qaçmaq , 15 2 böyük , 16 2 dəqiqə , 17 2 körpü , 18 1 fontaine

out 2015: 1 2 Berinq dənizi , 2 2 vergül , 3 2 urbo , 4 2 gicgah , 5 2 İrkutsk vilayəti , 6 2 nälkä , 7 2 kana , 8 2 erdő , 9 2 okno , 10 2 oheň , 11 2 nepřítel , 12 2 mięso , 13 2 Mósambík , 14 2 hədsiz , 15 2 көрші , 16 2 Mozambique , 17 2 øye , 18 2 เลือด , 19 2 noga , 20 2 лук , 21 2 Atlantik okean , 22 2 med , 23 2 ulu , 24 2 Mozambik , 25 2 kəpənək

nov 2015: 1 3 baba , 2 3 at , 3 2 Anqara , 4 2 addımlamaq , 5 2 vaza , 6 2 Krasnoyarsk , 7 2 Yenisey , 8 2 ortiga , 9 2 görkəmli , 10 2 Qızıl , 11 2 serán , 12 2 Xakasiya , 13 2 tongolo , 14 2 Tıva , 15 2 geydirmək , 16 2 dolaşa , 17 2 Himalay , 18 2 मेंढक , 19 2 अग्नि , 20 2 general , 21 2 işlətmək , 22 2 Katmandu , 23 2 काठमाडौं , 24 2 geyim , 25 2 fərz etmək

dez 2015: 1 12 Vikilüğət:İdarəçi namizədi/Aabdullayev851 , 2 3 xəbər almaq , 3 3 tanışmaq , 4 3 bildirmək , 5 3 yaymaq , 6 3 dəvət etmək , 7 3 bumbac , 8 3 Kirsche , 9 3 ət , 10 2 unga , 11 2 пынцӏа , 12 2 myydä , 13 2 ажвар , 14 2 ажва , 15 2 manqo , 16 2 Mango , 17 2 Maulbeere , 18 2 Feige , 19 2 Avocado , 20 2 Himbeere , 21 2 Erdbeere , 22 2 Pflaume , 23 2 Hartriegel , 24 2 аща , 25 2 Pfirsich

Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Quinta-feira, 21 de janeiro 2016 20:37

Dump file azwiktionary-20160111-stub-meta-history.xml.gz (edits only), size 14 Mb as gz -> 107 Mb
Dump processed till Dec 31, 2015, on server stat1002, ready at Tue-12/01/2016-11:42 after 1 min, 50 sec.

Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.