Estatísticas da Wikcionário azeri

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist

Metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.
See also metrics definitions


 
Monthly counts & Quarterly rankings: junho 2015
 
DataWikcionaristasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
jun 2015+2%   +2%-10%  +63%      +1%
mai 2015+2%   +3%-26%  -14%      0%
abr 20150%   +4%-7%  +51%      0%
mar 2015+2%   +4%+20%  +44%+3%+3%0%+2%+4%0%+1%
fev 20150%   +3%+46%  +11%+1%+1%0%+1%+1%0%0%
jan 20150%   +2%-17%  -1%+1%0%0%+3%0%0%0%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
jun 20154613236 k264,1 7,6 k      103
mai 20154514135 k294 4,6 k      102
abr 201544 3234 k394 5,4 k      102
mar 20154412233 k4246203,6 k36 Mb3,2 M9,3 k322 k9,3 k530102
fev 201543 3132 k3546192,5 k35 Mb3,1 M9,3 k317 k9,0 k529101
jan 201543 3131 k2446212,2 k34 Mb3,1 M9,3 k313 k9,0 k529101
dez 201443 2130 k294,16282,3 k34 Mb3,1 M9,3 k304 k8,9 k529101
nov 201443 1129 k434,16312,5 k34 Mb3,1 M9,3 k300 k8,9 k529100
out 201443 4128 k364,26304,0 k33 Mb3,1 M9,3 k300 k8,9 k52999
set 201443 2127 k424,36545,5 k33 Mb3,0 M9,3 k285 k8,9 k52996
ago 20144313126 k354,27024,4 k32 Mb3,0 M9,3 k253 k8,9 k52994
jul 201442 3225 k384,37463,4 k31 Mb3,0 M9,3 k219 k8,9 k52992
jun 201442 4223 k464,37644,7 k31 Mb2,9 M9,2 k208 k8,7 k53091
mai 201442 4222 k584,47317,0 k29 Mb2,8 M8,6 k205 k8,0 k51787
abr 201442 2220 k534,47084,5 k27 Mb2,6 M7,5 k198 k7,1 k50978
mar 201442 3219 k454,66762,7 k24 Mb2,2 M6,8 k196 k5,7 k50775
fev 20144215217 k464,86782,8 k23 Mb2,2 M6,8 k194 k5,6 k50774
jan 201441 4216 k4956764,2 k22 Mb2,1 M6,7 k191 k5,4 k50773
dez 20134112214 k385,26904,3 k20 Mb1,9 M6,4 k176 k4,8 k50472
nov 20134023213 k445,47363,4 k19 Mb1,8 M6,2 k148 k4,3 k50072
out 20133814212 k535,77565,0 k18 Mb1,7 M6,1 k133 k4,1 k47967
set 20133724310 k576,17814,7 k16 Mb1,6 M5,9 k121 k3,7 k45565
ago 2013352428,5 k416,87513,2 k13 Mb1,3 M5,8 k116 k2,8 k11763
jul 201333 327,3 k257,57762,8 k12 Mb1,2 M5,8 k105 k2,7 k3561
jun 20133323 6,5 k1882135312 Mb1,1 M5,8 k96 k2,6 k358
mai 20133112 6,5 k 882471512 Mb1,1 M5,8 k96 k2,6 k358
abr 20133011 6,5 k 7,982432012 Mb1,1 M5,8 k95 k2,6 k358
mar 201329 5 6,5 k27,882447512 Mb1,1 M5,8 k95 k2,6 k358
fev 20132912 6,4 k 7,882747111 Mb1,1 M5,6 k94 k2,6 k357
jan 201328 2 6,4 k 7,782778611 Mb1,1 M5,6 k94 k2,6 k357
dez 201228 2 6,4 k 7,682899311 Mb1,1 M5,6 k93 k2,6 k357
nov 20122812 6,4 k 7,582852711 Mb1,1 M5,6 k91 k2,6 k357
out 201227   6,4 k 7,482782311 Mb1,1 M5,6 k91 k2,6 k356
set 201227 3 6,4 k 7,382772511 Mb1,1 M5,6 k90 k2,6 k356
ago 201227 216,4 k17,28281,2 k11 Mb1,1 M5,6 k89 k2,6 k356
jul 201227 416,3 k5783091511 Mb1,1 M5,6 k87 k2,6 k356
jun 20122713 6,2 k17,184956211 Mb1,1 M5,6 k82 k2,6 k354
mai 20122614 6,2 k 785076311 Mb1,1 M5,6 k81 k2,6 k352
abr 201225 2 6,1 k 6,984960811 Mb1,1 M5,6 k80 k2,6 k352
mar 201225 2 6,1 k 6,884959911 Mb1,1 M5,5 k79 k2,6 k352
fev 201225 216,1 k66,78501,5 k11 Mb1,1 M5,5 k79 k2,6 k352
jan 201225 745,9 k96,78192,0 k10 Mb1,0 M5,5 k75 k2,4 k352
dez 2011251315,7 k56,67912,6 k9,8 Mb953 k5,4 k72 k2,3 k351
nov 2011241415,5 k26,47822,6 k9,3 Mb920 k5,2 k68 k2,3 k351
out 201123 2 5,4 k 67812,7 k9,2 Mb907 k5,2 k67 k2,3 k351
set 201123 3 5,4 k15,57893769,1 Mb898 k5,2 k60 k2,3 k351
ago 20112311 5,4 k 5,47923579,1 Mb896 k5,2 k59 k2,2 k350
jul 201122 3 5,4 k15,47932829,0 Mb895 k5,2 k58 k2,2 k350
jun 201122 2 5,4 k 5,37958459,0 Mb888 k5,1 k58 k2,2 k350
mai 201122 3 5,3 k 5,27985998,9 Mb886 k5,1 k54 k2,2 k350
abr 201122 915,3 k85,18041,6 k8,9 Mb884 k5,1 k50 k2,2 k350
mar 201122 535,1 k1357872,0 k8,2 Mb807 k4,9 k47 k2,1 k349
fev 2011221534,7 k2357452,3 k6,9 Mb661 k4,3 k41 k1,7 k349
jan 201121 424,0 k195,36651,5 k5,5 Mb517 k2,9 k39 k961548
dez 2010211623,5 k185,77032,0 k5,1 Mb483 k2,6 k36 k754747
nov 2010201532,9 k196,17191,9 k4,3 Mb410 k1,8 k30 k502743
out 2010191532,3 k96,77251,4 k3,5 Mb342 k1,5 k26 k349743
set 201018 222,1 k46,97106763,0 Mb280 k1,3 k22 k208742
ago 2010181532,0 k476711,1 k2,6 Mb235 k1,2 k22 k208742
jul 2010172311,8 k 6,95923821,8 Mb163 k1,1 k21 k208741
jun 201015 211,8 k 6,85882551,8 Mb161 k1,1 k21 k209741
mai 201015 111,8 k 6,65893291,8 Mb160 k1,1 k20 k209741
abr 201015 111,8 k 6,45863481,8 Mb159 k1,1 k20 k209741
mar 2010151211,8 k 6,35842531,8 Mb159 k1,1 k20 k209741
fev 201014 111,8 k 6,15811921,7 Mb158 k1,1 k19 k209241
jan 201014 211,8 k 65811791,7 Mb158 k1,1 k19 k209241
dez 2009141111,8 k 5,95802331,7 Mb158 k1,1 k19 k210241
nov 200913 111,8 k 5,85802491,7 Mb158 k1,1 k19 k210241
out 200913 211,8 k 5,75812451,7 Mb158 k1,1 k19 k210241
set 2009132211,8 k 5,55793701,7 Mb157 k1,1 k18 k210241
ago 200911 111,8 k 5,45813611,7 Mb156 k1,0 k18 k210240
jul 200911 111,8 k 5,25812781,7 Mb156 k1,0 k17 k210240
jun 200911 111,8 k 55811901,7 Mb156 k1,0 k17 k210238
mai 200911 111,8 k 4,95792841,7 Mb155 k1,0 k17 k210238
abr 200911 111,8 k 4,85793941,7 Mb155 k1,0 k17 k211238
mar 200911 111,8 k 4,55806521,7 Mb155 k1,0 k16 k211238
fev 2009111211,8 k 4,25891,1 k1,7 Mb160 k1,0 k16 k211238
jan 200910 211,8 k33,66114011,6 Mb166 k1,0 k12 k212238
dez 200810 111,7 k43,65958071,5 Mb153 k96811 k225238
nov 2008101211,5 k53,35346011,3 Mb129 k8069,0 k279233
out 20089 111,4 k123,24108261014 kb94 k6997,6 k269133
set 20089 111,0 k123,6363745670 kb62 k5126,1 k126132
ago 20089   686 4,338280492 kb44 k4145,6 k109 27
jul 20089   683 4,2383117488 kb44 k4145,4 k109 27
jun 2008911 681 4,138285484 kb44 k4045,3 k109 26
mai 20088   673 4385126479 kb44 k3955,1 k108 26
abr 20088   672 3,838653475 kb44 k3954,8 k108 26
mar 20088   671 3,738665467 kb44 k3954,4 k108 26
fev 20088   671 3,638697464 kb44 k3954,2 k108 26
jan 2008811 671 3,5386100451 kb44 k3953,3 k108 26
dez 2007711 670 3,338653438 kb44 k3952,3 k108 26
nov 20076 1 67013,338579435 kb44 k3952,1 k110 26
out 2007612162653,4399404406 kb40 k3932,0 k110 24
set 20075 1148593,5364844283 kb28 k3161,1 k79 11
ago 20075 1121833,924856287 kb7,7 k33448030 9
jul 2007511 112 2,62394141 kb3,4 k1343261 3
jun 20074   104 2,5236238 kb3,1 k982901 3
mai 20074   104 2,4236538 kb3,1 k982891 3
abr 2007412 10312,42355238 kb3,1 k982861 3
mar 20073   65 32301423 kb1,9 k162801 3
fev 20073 1 63 2,92232422 kb1,9 k62761 3
jan 2007311 5922,72249921 kb1,7 k62532 3
dez 20062   12 4,933965,5 kb33461281 3
nov 20062   11 4,831935,2 kb30661281 3
out 20062   11 4,531825,2 kb30561281 3
set 2006211 11 4,431375,2 kb29961281 3
ago 20061   7 5,9365 4,6 kb26461281 3
jul 20061   7 5,936514,6 kb26461281 3
jun 20061   6 6,7406164,5 kb25061281 3
mai 20061   2 121474 5,9 kb357 127 293
abr 20061   2 12147415,9 kb357 127 293
mar 20061   1 231442 4,0 kb228 127 293
fev 20061   1 23144274,0 kb228 127 293
jan 20061   1 16143294,0 kb227 127 291
dez 20051   1 732761,7 kb41 127  1
nov 20051   1 1  14       
out 20051   1 1  14       
set 20051   1 1  14       
ago 20051   1 1  14       
jul 20051   1 1  14       
jun 20051   1 1  14       
mai 20051   1 1  14       
abr 20051   1 1  14       
mar 20051   1 1  14       
fev 20051   1 1  14       
jan 20051   1 1  14       
dez 200411  1 1 114       
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
The following table ranks this project in relation to projects in other languages with 1000+ articles
abr 201551 4532501684 32      140
jan 20155135413752248094238319147734140
out 20144938283451177383036308845734140
jul 20145033352553216872937308851733140
abr 20145032462661176872340319151734140
jan 20145043332563126372542349250734140
out 20135029322569134672143369155734140
jul 20135041422674202473552449157882140
abr 201351246451776419569544592618109140
jan 201352455454766723364524392618108140
out 201252368249736424360504189628106140
jul 201250493638714327359494087608108140
abr 201252395052716629366494086617108140
jan 2012513523187034323415343836110107140
out 2011534055486868374465345816112105140
jul 2011534444496755464645243806211106140
abr 2011533419346634473484841806210104140
jan 201153353925692341643575184641898140
out 201057263531763532748615592682995140
jul 2010602050598066261074706498703790140
abr 2010614680567858281072676296673691140
jan 20106333554974613110726660946335102140
out 20096240615373563110696560936333100140
jul 2009684078547359379676355946232100140
abr 2009645079506953389626354886127100140
jan 2009645952336939499506153876428101140
out 20086436573373255415336959936923105139
jul 200863327245795975757278711017234117139
abr 200864427849786471717776701007033112139
jan 20086036565174596868727265967229111139
out 20076928463772356464527260927126112139
jul 20077433564493586464761009510210086108138
abr 2007793345479055616185100921009880107138
jan 2007893053449444555574101941139464100138
out 200697396743104535050108110113110976397138
jul 2006113406838109534646114112113108915497138
abr 200611038543511049424286104102113815439138
jan 200694445934104413737739897102744540131
out 200585   98    118     118
jul 200579   92    113     113
abr 200573   84    100     100
jan 200564   71    87     87
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100ediçõesbytes
 WikcionaristasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikcionaristas (usuários registrados)
A = Wikcionaristas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikcionaristas que editaram pelo menos dez vezes desde que chegaram
C = Wikcionaristas que contribuíram cinco vezes ou mais este mês
D = Wikcionaristas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  2500  5  10  100  1000  1  3  5  10  25  5  10  1  3  5  10  25  100  250  1000  5  10  100 
jun 201595332211 33311      21      221
mai 201564422111 333121     73322   221
abr 201594332221 443231   2263221   321
mar 201593222221 332 2    11331     221
fev 201594322111 222 32     103      221
jan 201586322111 442 41     93311   221
dez 201473221111 332 1      3       221
nov 201462111111 11  21     71      22 
out 201484421111 11111      411     2  
set 201463222111 11114      832     22 
ago 201493321111 22211      411     11 
jul 201474322221 222        311111  111
jun 201475443222 331 321    7422111 111
mai 20141064332221332 22222  63322211111
abr 201484222222 221 311    13311111 111
mar 201473333211 222 31     621     11 
fev 201485554221 222 3      7111       
jan 201484444221 443 42     135422   22 
dez 201363222221 44213      42111   11 
nov 201384332221 222 31     131111   11 
out 201364443222 222 3      9441111 1  
set 201354433322 331 42     953311  11 
ago 201384433221 541132     1022     11 
jul 20136333222  221 111    921111  21 
jun 201375322   221 211    21      11 
mai 201353211   331 53     41      11 
abr 201331111   541        3       221
mar 201386532   431 1      611     331
fev 20137321    551 2      62      11 
jan 201352211   761 31     211     21 
abr 201594332221 443231   2263221   321
jan 201586322111 442 41     93311   221
out 201484421111 11111      411     2  
jul 201474322221 222        311111  111
abr 201484222222 221 311    13311111 111
jan 201484444221 443 42     135422   22 
out 201364443222 222 3      9441111 1  
jul 20136333222  221 111    921111  21 
abr 201331111   541        3       221
jan 201352211   761 31     211     21 
out 201291     332 31     631     22 
jul 2012764311   542 7222   154311   22 
abr 20128421    653 22     311     22 
jan 201212875441  761 6431   964211  32 
out 201152221   5431211    6       11 
jul 20117432    431 311    71      11 
abr 201114995511  431 522    85432   11 
jan 201110442222  541 4331   821111  11 
out 20105555532      7431   127752   11 
jul 20105533211      2221   42222      
abr 20104311111             5411    22 
jan 2010622111   1   3      5111    1  
out 2009322111       11     3          
jul 20092111111  1          41      11 
abr 20093211111  11         211        
jan 20094321111  22         72211   11 
out 20083211111  22  42     953111     
jul 20081      11  1      3          
abr 20082      11         1          
jan 20081111    11  2      2          
out 2007222221   11  2      42222      
jul 200731111                         
abr 200732221              22111      
jan 200711111   11         11         
out 2006                  1          
jul 2006                  1          
abr 20061          1      1          
jan 200611         4      521        
out 2005                             
jul 2005                             
abr 2005                             
jan 2005                             

 

Distribuição de edições de artigos por wikcionaristas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikcionaristasEdições total
1197100.0%91,038100.0%
36734.0%90,83499.8%
104623.4%90,71799.6%
322613.2%90,34599.2%
100178.6%89,76598.6%
316136.6%88,95797.7%
100094.6%87,05795.6%
316231.5%76,45684.0%
1000021.0%69,46176.3%
3162321.0%69,46176.3%

 

9 wikcionaristas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions
agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
Faiq ƏsgərUC1 036,2491,658714dez 01, 201357520,113799524
SinanUC2 033,2121047,9772jul 13, 200729087,624243,060-
123snake45UC12 040212241mai 11, 2013779112715-
CalqUC38+1163--jan 15, 2013895----
MalaysiaboyUC46+81034-ago 16, 2014317522-
TropicalkittyUC193...111-jun 08, 201521----
Trafo BUC194...11--jun 15, 201514----
WieraleeUC195...11--jun 19, 201510----
MydreamsparrowUC196...11--jun 30, 2015 ----

 

20 wikcionaristas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
InterwicketUC36,995jan 29, 20092342nov 08, 20101694
Sinek~azwiktionaryUC42,190set 07, 20092121abr 22, 2013798
Hacı FaiqUC52,063out 01, 2013636out 31, 2013606
Hacı ƏsgərUC61,951nov 01, 2013605nov 30, 2013576
Hacı FətullaUC71,791set 01, 2013666set 30, 2013637
Mirzə MəmmədquluUC81,547ago 01, 2013697ago 31, 2013667
Mirza HasanquluUC91,059jun 19, 2013740jul 31, 2013698
Lo XimiendoUC10649nov 22, 20101680fev 06, 2015143
SalicynaUC11507fev 07, 20111603ago 25, 20111404
Cekli829UC13342set 15, 20092113fev 22, 2014492
Sabri76UC14283jun 20, 20101835mar 31, 2013820
VagoUC15190jul 12, 20101813jul 07, 20111453
Safavi~azwiktionaryUC16185jun 05, 20121119jul 22, 20121072
MalafayaUC17150out 05, 20082458abr 30, 201560
Dalmo PereiraUC1895mai 02, 201558mai 02, 201558
AydınUC1994out 15, 20072814out 21, 20072808
CommonsDelinkerUC2079dez 07, 20072761jan 31, 2015149
YurdumquluUC2171jun 25, 2013734ago 22, 2013676
Baki66UC2261jan 06, 20073096set 24, 20072835
NKOziUC2359mar 31, 20111551dez 29, 20111278

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 2.641 edições foram feitas por usuários anônimos, de um total de 149.110 edições ( 1e %)
  


19 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
JAnDbotUC116,452mai 18, 20111503jun 27, 20152--
HydrizBotUC215,050abr 23, 20121162jun 30, 2015---
Luckas-botUC36,051mar 03, 20092309jan 27, 2014518--
MalafayaBotUC45,304nov 18, 20111319abr 30, 201560--
KamikazeBotUC54,181out 18, 20111350mar 06, 2013845--
YS-BotUC63,715set 08, 20121024jun 30, 2015---
VolkovBotUC7972out 01, 20072828abr 05, 2013815--
AvocatoBotUC8631out 31, 20111337ago 25, 2013673--
WikitanvirBotUC9630abr 14, 20111537jan 19, 20121257--
ArthurBotUC10620nov 14, 20101688nov 12, 20111325--
RoggBotUC11443fev 07, 20092333jun 12, 20111478--
SpaceBirdyBotUC12378jul 07, 20082548dez 30, 20092007--
MjbmrbotUC13356jan 18, 20111623mar 28, 20111554--
WarddrBOTUC14300jul 25, 20121069ago 18, 2013680--
RobotGMwiktUC15212jan 09, 20073093jun 06, 20082579--
CarsracBotUC16107out 16, 20092082mai 30, 2013760--
Makecat-botUC1723nov 10, 2012961abr 05, 2013815--
GhalyBotUC182jan 06, 2013904jan 06, 2013904--
MelancholieBotUC191out 07, 20092091out 07, 20092091--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110JpgOggSvg
jun 201536 k492241051,5 k32,8 k       811
mai 201535 k492241051,5 k32,8 k       811
abr 201535 k491241051,5 k32,7 k       811
mar 201533 k490241051,5 k32,7 k      2705811
fev 201532 k490241051,5 k32,7 k      1894811
jan 201531 k484241051,5 k32,7 k      1401811
dez 201430 k479241051,5 k32,6 k      1402811
nov 201429 k477241051,5 k32,6 k      1893811
out 201428 k47224951,5 k32,4 k      21238 1
set 201427 k47124951,5 k32,4 k      23398 1
ago 201426 k46624951,5 k32,4 k      19588 1
jul 201425 k46124951,5 k32,4 k      25488 1
jun 201423 k46024951,5 k32,3 k      43188 1
mai 201422 k45824951,4 k32,1 k      56748 1
abr 201420 k45724951,1 k31,5 k      42878 1
mar 201419 k45424951,1 k31,4 k      23688 1
fev 201417 k45124951,1 k31,4 k      23838 1
jan 201416 k44624951,1 k31,4 k      28528 1
dez 201314 k43824951,1 k31,3 k      22258 1
nov 201313 k43824951,1 k31,3 k      25018 1
out 201312 k43224951,1 k31,2 k      41608 1
set 201310 k42824951,1 k31,1 k      40038 1
ago 20138,6 k41124951,0 k31,1 k      19628 1
jul 20137,3 k40524851,0 k31,1 k      18167 1
jun 20136,6 k39724751,0 k31,0 k      1376 1
mai 20136,5 k39624751,0 k31,0 k      546 1
abr 20136,5 k39424751,0 k31,0 k      286 1
mar 20136,5 k39024751,0 k31,0 k      1466 1
fev 20136,4 k38024751,0 k31,0 k      276 1
jan 20136,4 k37324751,0 k31,0 k      546 1
dez 20126,4 k37024751,0 k31,0 k      536 1
nov 20126,4 k36324751,0 k31,0 k      296 1
out 20126,4 k36024751,0 k31,0 k      136 1
set 20126,4 k35624751,0 k31,0 k      666 1
ago 20126,4 k35024751,0 k31,0 k      3006 1
jul 20126,4 k34424751,0 k31,0 k      2076 1
jun 20126,2 k34024751,0 k31,0 k      716 1
mai 20126,2 k32724751,0 k31,0 k      756 1
abr 20126,2 k31824751,0 k21,0 k      346 1
mar 20126,2 k31124751,0 k21,0 k      226 1
fev 20126,2 k30824751,0 k21,0 k      7826 1
jan 20126,0 k29924751,0 k21,0 k      14146 1
dez 20115,7 k29224759592979      12346 1
nov 20115,5 k28724759322720      3456 1
out 20115,5 k27124759252697      606 1
set 20115,5 k26524759252696      536 1
ago 20115,4 k25924759222696      266 1
jul 20115,4 k25524759212670      546 1
jun 20115,4 k24724759192670      326 1
mai 20115,4 k24424759182667      496 1
abr 20115,4 k23324759172637      9916 1
mar 20115,1 k22224759062556      15046 1
fev 20114,7 k21924758712537      20726 1
jan 20114,1 k20923658312519      12755 1
dez 20103,5 k20223358172508      15092 1
nov 20103,0 k19923257542368      14291 1
out 20102,4 k19523246642338      14361 1
set 20102,1 k18823146172318      671  1
ago 20102,0 k18222 46142317      1046   
jul 20101,9 k16522 44792317      375   
jun 20101,9 k16422 44342317      255   
mai 20101,9 k15022 44322317      325   
abr 20101,9 k14822 44322317      343   
mar 20101,9 k14422 44322317      252   
fev 20101,8 k13922 44322317      189   
jan 20101,8 k13722 44322317      170   
dez 20091,8 k12222 44312317      226   
nov 20091,8 k12122 44302317      242   
out 20091,8 k11722 44302317      238   
set 20091,8 k11522 44302317      370   
ago 20091,8 k10822 44292317      359   
jul 20091,8 k10822 44292317      269   
jun 20091,8 k10621 44292317      184   
mai 20091,8 k10421 44282317      263   
abr 20091,8 k10221 44282316      377   
mar 20091,8 k9421 44282316      562   
fev 20091,8 k9019 44282316      811   
jan 20091,8 k8119 44242316      294   
dez 20081,7 k7819 44162294      715   
nov 20081,6 k7619 43502162      484   
out 20081,4 k6319 12862100      785   
set 20081,1 k5019 1203286      696   
ago 20087134917 1188272      1   
jul 20087104917 1188272      2   
jun 20087074716 1188272      28   
mai 20086994216 1186272      2   
abr 20086984216 1186272      2   
mar 20086974116 1186272      1   
fev 20086974016 1186272      1   
jan 20086974016 1186272      11   
dez 20076963816 1186271      35   
nov 20076963616 1186270      64   
out 20076503516 1184268      329   
set 20074963116 1177252      806   
ago 20072272915 1156220      530   
jul 20071152514 111322      30   
jun 20071072514 111322          
mai 20071072514 111322          
abr 20071062514 111322      47   
mar 2007681714 111022      5   
fev 2007661614 111022      6   
jan 2007621614 110922      52   
dez 2006151513 110822      1   
nov 2006141513 110722          
out 2006141513 110722          
set 2006141313 110722      7   
ago 2006101212 19612          
jul 2006101212 19612          
jun 200691112 19512      3   
mai 200651110 18011          
abr 200651110 18011      1   
mar 200641110 18011          
fev 200641110 18011      6   
jan 200621010 18011      4   
dez 2005255 1791           
nov 2005111  78            
out 2005111  78            
set 2005111  78            
ago 2005111  78            
jul 2005111  78            
jun 2005111  78            
mai 2005111  78            
abr 2005111  78            
mar 20051 1  78            
fev 20051 1  78            
jan 20051 1  78            
dez 20041 1  78            

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

dez 2005: 1 1 main Page

jan 2006: 1 1 Ana Səhifə

fev 2006: 1 2 Main Page , 2 2 Ana Səhifə , 3 1 ana Səhifə

abr 2006: 1 1 Azərbaycan dili

jun 2006: 1 1 qartal

set 2006: 1 1 آتا

dez 2006: 1 1 kiçik

jan 2007: 1 1 arzu

fev 2007: 1 1 əl telefonu

mar 2007: 1 1 cənub

abr 2007: 1 1 səyahət

jul 2007: 1 1 armud

ago 2007: 1 2 türkcə , 2 1 köpək

set 2007: 1 2 yaşamaq , 2 1 april

out 2007: 1 2 ülgü , 2 2 görüş , 3 2 qorumaq , 4 1 gül

nov 2007: 1 1 səhra

dez 2007: 1 1 boşqab

jan 2008: 1 1 Moskva

fev 2008: 1 1 türkcə

mar 2008: 1 1 Ana Səhifə

abr 2008: 1 1 виноград

mai 2008: 1 1 August

jun 2008: 1 1 krım tatarca

jul 2008: 1 1 جالگاه

ago 2008: 1 1 Wolf

set 2008: 1 2 afrikaans , 2 2 Afrika dili , 3 2 Qırım Tatarca , 4 2 Ana Səhifə , 5 1 od

out 2008: 1 2 мак , 2 2 ana , 3 1 teatr

nov 2008: 1 2 patlıcan , 2 2 Finlandiya , 3 2 alt , 4 2 Məkkə , 5 2 nənə , 6 2 nar , 7 2 armud , 8 2 Ana Səhifə , 9 1 qovaq

dez 2008: 1 2 ürək , 2 1 fişəng

jan 2009: 1 2 lüğət , 2 2 zər , 3 2 qaynar , 4 1 гусь

fev 2009: 1 2 yarasa , 2 2 Kullanıcı:Mardetanha , 3 1 hörümçək

mar 2009: 1 1 döngə

abr 2009: 1 2 august , 2 1 Азербайджанский язык

mai 2009: 1 3 qozu , 2 3 qoy

jun 2009: 1 2 suiti

jul 2009: 1 2 Arbeit , 2 2 Katze , 3 1 katze

ago 2009: 1 2 птица , 2 2 bayraq , 3 1 mənzərə

set 2009: 1 2 cekcə , 2 2 Cek dili , 3 2 self control , 4 2 page

out 2009: 1 2 həftə , 2 1 qapaq

nov 2009: 1 1 qapaq

dez 2009: 1 2 qovun , 2 2 banan , 3 2 Ana Səhifə , 4 1 həftə

jan 2010: 1 2 kəfgir , 2 2 pendir , 3 1 süzgəc

fev 2010: 1 1 page

mar 2010: 1 2 iribaş , 2 2 Kaulquappe

abr 2010: 1 2 skripka , 2 2 saqqal , 3 1 iribaş

mai 2010: 1 2 Ana Səhifə , 2 1 həftə

jun 2010: 1 2 Ellenbogen , 2 2 Ellbogen , 3 2 elbow

jul 2010: 1 2 teleskop , 2 2 hamam , 3 2 tiraj , 4 2 Opponent , 5 2 Cek dili , 6 2 qaşıq , 7 2 günəş , 8 2 Azərbaycan dili

ago 2010: 1 4 evlənmək , 2 3 çalma , 3 3 qızılquş , 4 3 lil , 5 3 öskürək , 6 3 ağartmaq , 7 3 yaralanmamaq , 8 3 konj , 9 3 çiyələk , 10 3 gecə , 11 3 heyva , 12 3 təsirlik , 13 3 ayı , 14 2 cover , 15 2 paxla , 16 2 palto , 17 2 menecer , 18 2 laboratoriya , 19 2 zərf , 20 2 gec , 21 2 kabel , 22 2 küknar , 23 2 yumaq , 24 2 katır , 25 2 qatır

set 2010: 1 2 brom , 2 2 шурин , 3 2 деверь , 4 2 qayın , 5 2 fıstıq , 6 2 золото , 7 2 altun , 8 2 sink , 9 2 mis , 10 2 Kimyəvi elementlərin dövri sistemi , 11 2 arsen , 12 2 мышьяк , 13 2 малахит , 14 2 meruňka , 15 2 кајсија , 16 2 кайсия , 17 2 marelica , 18 2 morela

out 2010: 1 4 sumaq , 2 3 türk , 3 3 yunan , 4 3 zəfər , 5 3 kürü , 6 3 dolma , 7 3 qırxayaq , 8 3 düymələmək , 9 3 yenot , 10 3 γαρύφαλλο , 11 3 nightingale , 12 3 süngü , 13 3 qəssab , 14 3 ekmek , 15 3 mesafe , 16 3 talaşa , 17 3 qonşu , 18 3 ayı , 19 2 верный , 20 2 alman , 21 2 помидор , 22 2 огурец , 23 2 француженка , 24 2 гречанка , 25 2 fransız

nov 2010: 1 3 nəticə , 2 3 yengeç , 3 3 maye , 4 3 ləngitmək , 5 3 yarpaq , 6 3 avokado , 7 3 kəpənək , 8 3 qələbə , 9 3 zoğ , 10 3 лягушка , 11 3 xərçəng , 12 3 üzüm , 13 2 çömçəquyruq , 14 2 otobüslerde , 15 2 domingo , 16 2 ორშაბათი , 17 2 siçovul , 18 2 salı , 19 2 pazartesi , 20 2 şahmatçı , 21 2 vücut , 22 2 safran , 23 2 xəzinə , 24 2 xəstələnmək , 25 2 heykeltıraş

dez 2010: 1 3 təsdiqləmək , 2 2 πάπια , 3 2 Golf , 4 2 valyuta , 5 2 ördəkburun , 6 2 körfəz , 7 2 nərd , 8 2 döymə , 9 2 əzələ , 10 2 solaxay , 11 2 yelkən , 12 2 zürafa , 13 2 nauka , 14 2 tamaşaçı , 15 2 şənbə , 16 2 octopus , 17 2 ördek , 18 2 Aubergine , 19 2 tərəvəz , 20 2 Affe , 21 2 ördək , 22 2 Wolf , 23 1 черепахи

jan 2011: 1 3 üstəgəl , 2 2 vegetasiya , 3 2 diod , 4 2 qovluq , 5 2 söğüt , 6 2 sfenks , 7 2 eyelash , 8 2 tavsiye , 9 2 видишь , 10 2 sevinmək , 11 2 çovğun , 12 2 strategiya , 13 2 velosiped , 14 2 abide , 15 2 sing , 16 2 speak , 17 1 lens

fev 2011: 1 3 barometr , 2 3 balıqçı , 3 3 yaltaqlıq , 4 3 mikrocərrahiyyə , 5 3 səkkiz , 6 3 əl telefonu , 7 3 Ana Səhifə , 8 2 xardal , 9 2 ilə , 10 2 hörük , 11 2 boyun , 12 2 çünki , 13 2 diktor , 14 2 yaltaqlanmaq , 15 2 yaltaq , 16 2 güzəşt , 17 2 külüng , 18 2 zənci , 19 2 qübbə , 20 2 incir , 21 2 on iki , 22 2 on bir , 23 2 dwadzieścia cztery , 24 2 dwadzieścia trzy , 25 2 hər

mar 2011: 1 3 yastıq , 2 3 şaquli , 3 3 üfüqi , 4 3 erkək , 5 3 maraqlı , 6 3 lava , 7 3 yaba , 8 3 hinduşka , 9 3 ovsunlamaq , 10 3 sześćdziesiąt pięć , 11 3 gəmi , 12 3 dekabr , 13 3 noyabr , 14 3 oktyabr , 15 3 sentyabr , 16 3 avqust , 17 2 pääsuke , 18 2 Fərat , 19 2 Dəclə , 20 2 itkin , 21 2 növbə , 22 2 ünsiyyət , 23 2 sərhədçi , 24 2 sahib , 25 2 yiyə

abr 2011: 1 3 cüyür , 2 3 qaratoyuq , 3 3 buket , 4 3 anlamaq , 5 3 ayçiçeği , 6 2 oiseau , 7 2 riyaziyyat , 8 2 eyvan , 9 2 tükətmək , 10 2 xəsis , 11 2 xəta , 12 2 xasiyyət , 13 2 təhqiqat , 14 2 dərs , 15 2 məşğələ , 16 2 təəccüb , 17 2 marş , 18 2 təxmin , 19 2 təhqiq , 20 2 təhdid , 21 2 təhqir , 22 2 tarif , 23 2 tərif , 24 2 izah , 25 2 təfsir

mai 2011: 1 3 Xorvatiya

jun 2011: 1 2 göbələk , 2 2 tərcümə , 3 1 claymore

jul 2011: 1 2 Serbiya , 2 2 Slovakiya , 3 1 çobanyastığı

ago 2011: 1 3 hədəf , 2 1 patlamak

set 2011: 1 2 γκέισα , 2 2 əqrəb , 3 1 kuyu

out 2011: 1 1 oyar

nov 2011: 1 2 maçã , 2 2 renk , 3 2 elma , 4 2 Pluton , 5 2 merkez , 6 2 manzana , 7 2 ailə , 8 2 alma , 9 1 mouse

dez 2011: 1 2 Misir , 2 2 tartaruga , 3 2 uğur , 4 2 krowa , 5 2 ποδήλατο , 6 2 geyinmək , 7 2 hazırlaşmaq , 8 2 vektor , 9 2 mizrab , 10 2 qarğıdalı , 11 2 mühərrik , 12 2 tumurcuq , 13 2 пчела , 14 2 şahmat , 15 1 marzo

jan 2012: 1 3 kenquru , 2 3 osminoq , 3 3 dinozavr , 4 3 arvad , 5 3 gəlin , 6 3 Lixtenşteyn , 7 3 böyürtkən , 8 2 xloroform , 9 2 platinum , 10 2 chloroform , 11 2 chemistry , 12 2 akustik , 13 2 velosipedçi , 14 2 idmançı , 15 2 təyyarəçi , 16 2 dəmir , 17 2 Qana , 18 2 Bosniya və Herseqovina , 19 2 oğul , 20 2 növbə , 21 2 koramal , 22 2 bibioğlu , 23 2 bibiqızı , 24 2 kitabxana , 25 2 tüstü

fev 2012: 1 2 Əskişəhər , 2 2 səhabə , 3 2 həvari , 4 2 mezarlık , 5 2 rəqəm , 6 2 nömrə , 7 1 Naxçıvan

mar 2012: 1 2 Azerbaijan , 2 1 choose

abr 2012: 1 2 arx , 2 1 donna

mai 2012: 1 2 ölkə , 2 1 panno

jun 2012: 1 2 aigua , 2 1 Aserbajdsjan

jul 2012: 1 3 body , 2 2 מים , 3 2 para , 4 2 bed , 5 2 ur , 6 2 Allah , 7 1 böcek

ago 2012: 1 2 Afghanistan , 2 2 əl , 3 1 miercuri

set 2012: 1 1 düğün

out 2012: 1 1 yumruq

nov 2012: 1 2 Versicherung , 2 2 owl , 3 2 Apfel , 4 1 Biləsuvar

dez 2012: 1 2 Cibuti , 2 1 çırpı

jan 2013: 1 2 Əlcəzair , 2 2 kəpənək , 3 1 Yugoslavya

fev 2013: 1 2 yardım , 2 1 xaç

mar 2013: 1 3 dırmıq , 2 3 Xocalı , 3 2 masturbasiya , 4 2 bambuq , 5 2 koreyalı , 6 1 մաստուրբացիա

abr 2013: 1 1 Balakən

mai 2013: 1 1 artmaq

jun 2013: 1 2 rojo , 2 2 axtarmaq , 3 1 hacer

jul 2013: 1 2 ti , 2 2 aimer , 3 2 Zaragoza , 4 2 копчёный , 5 2 fem , 6 2 اندک , 7 2 الان , 8 2 اسم , 9 2 biçmək , 10 2 sombra , 11 2 səbət , 12 2 копьё , 13 2 корзина , 14 2 aqua , 15 2 kingdom , 16 2 krallıq , 17 2 кормить , 18 2 лаваш , 19 2 косой , 20 2 косолапый , 21 2 костёр , 22 2 Stadt , 23 2 vedere , 24 2 vendere , 25 2 venire

ago 2013: 1 2 helado , 2 2 batir , 3 2 mezclar , 4 2 reír , 5 2 moreno , 6 2 кличка , 7 2 suivre , 8 2 başsağlığı , 9 2 qamçı , 10 2 careful , 11 2 birləşmək , 12 2 gün , 13 2 şam , 14 2 candle , 15 2 but , 16 2 Apia , 17 2 Samoa , 18 2 козёл , 19 2 enmək , 20 2 peigne , 21 2 öö , 22 2 yığmaq , 23 2 oğul , 24 2 Braziliya , 25 2 ya

set 2013: 1 3 yırtmaq , 2 3 yanmaq , 3 3 qısa , 4 3 qırıcı , 5 3 acı , 6 3 pəncərə , 7 3 göz , 8 3 qız , 9 3 qara , 10 2 yorğun , 11 2 Dunay , 12 2 qul , 13 2 parıltı , 14 2 balqabaq , 15 2 olmaq , 16 2 dağ , 17 2 bilet , 18 2 vicdansız , 19 2 daha , 20 2 hamilə , 21 2 yordam , 22 2 qiymət , 23 2 window , 24 2 исступлённый , 25 2 истерзать

out 2013: 1 3 ღვინო , 2 3 aldatmaq , 3 2 basdırmaq , 4 2 Maldiv adaları , 5 2 جزر المالديف , 6 2 Qərbi Sahara , 7 2 Batı Sahra , 8 2 Sahara Occidental , 9 2 Алабама , 10 2 planet , 11 2 Nasáu , 12 2 Nassau , 13 2 Нассау , 14 2 махуэ , 15 2 гъэ , 16 2 адэ , 17 2 бзэ , 18 2 пхъэгулъ , 19 2 bura , 20 2 suçlu , 21 2 изменить , 22 2 измениться , 23 2 изменник , 24 2 tutmak , 25 2 rüşvet

nov 2013: 1 2 zəhər , 2 2 yükləmək , 3 2 È un libro , 4 2 звать , 5 2 Dili , 6 2 Doha , 7 2 çağırmaq , 8 2 móðir , 9 2 mor , 10 2 sındırmaq , 11 2 söymək , 12 2 derramar , 13 2 o'ttiz , 14 2 sakkiz , 15 2 yetti , 16 2 besh , 17 2 uch , 18 2 ikki , 19 2 Solomon adaları , 20 2 Solomon Islands , 21 2 məqsəd , 22 2 Valletta , 23 2 qapıçı , 24 2 meyvə , 25 2 düzənlik

dez 2013: 1 2 Məhəmməd , 2 2 Yeni iliniz mübarək! , 3 2 qayə , 4 2 занимательный , 5 2 заниматься , 6 2 заноза , 7 2 заносчивый , 8 2 занятие , 9 2 заочный , 10 2 zabit , 11 2 yük , 12 2 yalan , 13 2 заунывный , 14 2 işğal etmək , 15 2 миндаль , 16 2 şəkər , 17 2 zarafat , 18 2 əməl , 19 2 boran , 20 2 cərimə , 21 2 müdafiəçi , 22 2 ərizə , 23 2 lemon , 24 2 bite , 25 2 Qambiya

jan 2014: 1 3 məna , 2 2 Ərəbistan dənizi , 3 2 bükmək , 4 2 təbiət , 5 2 peyk , 6 2 süni , 7 2 qanacaq , 8 2 hərf , 9 2 əski , 10 2 old , 11 2 əhəmiyyətli , 12 2 əhəmiyyətsiz , 13 2 hürriyyət , 14 2 önemsiz , 15 2 azadlıq , 16 2 etkisiz , 17 2 etkili , 18 2 güncel , 19 2 özgürlük , 20 2 səhv , 21 2 buğ , 22 2 buxar , 23 2 örtülü , 24 2 tədarük , 25 2 tədarük etmək

fev 2014: 1 3 udmaq , 2 2 Кишинёв , 3 2 Chișinău , 4 2 cüt , 5 2 Birləşmiş Ərəb Əmirlikləri , 6 2 cavab , 7 2 cavab vermək , 8 2 parlaq , 9 2 cəllad , 10 2 vergi , 11 2 rapu , 12 2 testa , 13 2 giornale , 14 2 frutto , 15 2 egli , 16 2 dente , 17 2 bambina , 18 2 bambino , 19 2 cambra , 20 2 бал , 21 2 siekiera , 22 1 Irlande

mar 2014: 1 2 Mərkəzi Afrika Respublikası , 2 2 kütlə , 3 2 balet , 4 2 televiziya , 5 2 cin , 6 2 şeytan , 7 2 adi , 8 2 rəf , 9 2 cinayət , 10 2 zəncir , 11 2 qəsəbə , 12 2 vadi , 13 2 qüllə , 14 2 qısa , 15 2 occasion , 16 2 Georgia , 17 2 Türkmənistan , 18 2 vəzifə , 19 2 Bosniya və Herseqovina , 20 2 Gürcüstan , 21 2 yeni , 22 2 bacı , 23 2 Azerbaijan , 24 2 saat , 25 1 бачыць

abr 2014: 1 2 adroit , 2 2 ödəniş , 3 2 abandonner , 4 2 tərk etmək , 5 2 mirvari , 6 2 Xoş gəlmisiniz! , 7 2 əsir , 8 2 sərbəst , 9 2 şüar , 10 2 действие , 11 2 çat , 12 2 daxma , 13 2 azad , 14 2 bölən , 15 2 dərnək , 16 2 varlı , 17 2 buzlaq , 18 2 çalışqan , 19 2 Асмэра , 20 2 Qırmızı dəniz , 21 2 شتر , 22 2 شارب , 23 2 Ostsee , 24 2 Балтыйскае мора , 25 2 İssık-Kul

mai 2014: 1 3 İsveçrə , 2 3 balıq , 3 3 pəncərə , 4 2 Bazel , 5 2 porco , 6 2 abacaxi , 7 2 Düşənbə , 8 2 Pamir , 9 2 jöl , 10 2 vinte , 11 2 Bugarska , 12 2 nida , 13 2 təşəkkür , 14 2 София , 15 2 Кура , 16 2 Augustus , 17 2 Julie , 18 2 Junie , 19 2 Mei , 20 2 Maart , 21 2 Februarie , 22 2 Januarie , 23 2 Desember , 24 2 Παραγουάη , 25 2 Парагвай

jun 2014: 1 3 açmaq , 2 3 çuğundur , 3 2 aprikoos , 4 2 নাক , 5 2 कान , 6 2 কান , 7 2 Шуэц , 8 2 Suécia , 9 2 əjdəha , 10 2 Estocolmo , 11 2 pencər , 12 2 вьюга , 13 2 Belqrad , 14 2 Niş , 15 2 , 16 2 Voyevodina , 17 2 South America , 18 2 Zaltsburq , 19 2 Vyana , 20 2 Wien , 21 2 ящерица , 22 2 Гондурас , 23 2 Tequsiqalpa , 24 2 Portu , 25 2 Berno

jul 2014: 1 2 Minsk , 2 2 çıxıb getmək , 3 2 aýy , 4 2 çıxarış , 5 2 leikur , 6 2 Cotonou , 7 2 Porto-Novo , 8 2 Порто-Ново , 9 2 ბენინი , 10 2 بنين , 11 2 Μπενίν , 12 2 Bénin , 13 2 кафта , 14 2 кьюб , 15 2 zwee , 16 2 duo , 17 2 două , 18 2 lien , 19 2 rate , 20 2 croupe , 21 2 rond , 22 2 dahi , 23 2 constant , 24 2 intérieur , 25 2 génie

ago 2014: 1 2 öpmək , 2 2 qalxan , 3 2 mühasirə , 4 2 xüsusi , 5 1 хьед

set 2014: 1 2 Yunoniston , 2 2 Yunanistan , 3 2 Yunanıstan , 4 1 scarabeo

out 2014: 1 2 coraggioso , 2 2 morrer , 3 2 yazıçı , 4 2 ölmək , 5 2 krava , 6 1 akã

nov 2014: 1 2 sındırmaq , 2 2 bardaq , 3 2 alın , 4 1 rust

dez 2014: 1 2 turp , 2 2 siçan , 3 2 qız , 4 1 беркайчан

jan 2015: 1 2 əbədi , 2 2 tender , 3 2 Burkina-Faso , 4 2 Januari , 5 2 göndərmək , 6 2 Florida , 7 1 mein

fev 2015: 1 2 qayğı , 2 2 завръщам , 3 2 muzey , 4 2 мы , 5 1 mukayyet olmak

mar 2015: 1 2 mərhələ , 2 2 pillə , 3 2 Çukot dənizi , 4 2 femton , 5 2 yağmaq , 6 2 mötəbər , 7 2 kəlləmayallaq , 8 2 etibar , 9 2 etimad , 10 2 ανάμνηση , 11 2 yel , 12 2 vint , 13 2 baldır , 14 2 quinze , 15 2 quince , 16 2 qıf , 17 2 sərhəd , 18 2 musiqi , 19 1 Bukareszt

abr 2015: 1 3 Buxarest , 2 2 rəy , 3 2 Сирия , 4 2 Syria , 5 2 Siria , 6 2 Suriya , 7 2 kar , 8 2 səs , 9 2 Bukarest , 10 2 qarğa , 11 2 on , 12 2 Rumıniya , 13 2 saqqal , 14 1 sizär

mai 2015: 1 2 yollamaq , 2 2 balta , 3 1 claudo

jun 2015: 1 2 בירזוביג׳ן , 2 2 tənqid , 3 2 üfunət , 4 2 Oxot dənizi , 5 2 daimi , 6 1 ولادى وستوک

No data on this page have been normalized to 30 day months (as WMF does on certain traffic reports).
Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Quinta-feira, 30 de julho 2015 22:11

Dump file azwiktionary-20150702-stub-meta-history.xml.gz (edits only), size 11 Mb as gz -> 83 Mb
Dump processed till Jun 30, 2015, on server stat1002, ready at Sat-04/07/2015-21:48 after 1 min, 10 sec.

Versão do script:2.6
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.