Estatísticas da Wikcionário azeri

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist

Metrics have been collected from a full archive dump, which contains all revisions of every article, meta data and raw content.
See also metrics definitions


 
Monthly counts & Quarterly rankings: novembro 2014
 
DataWikcionaristasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
nov 20140%   0%   -38%+1%0%0%0%0%0%+3%
out 20140%   +5%-44%  -27%+2%+1%0%+5%0%0%+4%
set 20140%   +9%+32%  +25%+2%+1%-0%+13%0%0%0%
ago 2014+2%   +8%   +29%+2%+1%0%+15%0%0%0%
jul 20140%   +4%   -27%+2%+2%+1%+5%+2%-0%0%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
nov 201443 1117 k17,16312,5 k34 Mb3,1 M9,3 k300 k8,9 k52979
out 201443 4117 k2576314,0 k33 Mb3,1 M9,3 k300 k8,9 k52977
set 201443 2116 k457,16545,5 k33 Mb3,0 M9,3 k285 k8,9 k52974
ago 20144313115 k347,47024,4 k32 Mb3,0 M9,3 k253 k8,9 k52974
jul 201442 3214 k187,67463,4 k31 Mb3,0 M9,3 k219 k8,9 k52974
jun 201442 4213 k157,77644,7 k31 Mb2,9 M9,2 k208 k8,7 k53074
mai 201442 4213 k257,67317,0 k29 Mb2,8 M8,6 k205 k8,0 k51770
abr 201442 2212 k207,57084,5 k27 Mb2,6 M7,5 k198 k7,1 k50967
mar 201442 3211 k57,56762,7 k24 Mb2,2 M6,8 k196 k5,7 k50767
fev 20144215211 k77,46782,8 k23 Mb2,2 M6,8 k194 k5,6 k50767
jan 201441 4211 k277,26764,2 k22 Mb2,1 M6,7 k191 k5,4 k50767
dez 20134112210 k377,46904,3 k20 Mb1,9 M6,4 k176 k4,8 k50467
nov 2013402329,0 k187,97363,4 k19 Mb1,8 M6,2 k148 k4,3 k50067
out 2013381428,5 k2487565,0 k18 Mb1,7 M6,1 k133 k4,1 k47967
set 2013372437,7 k248,17814,7 k16 Mb1,6 M5,9 k121 k3,7 k45565
ago 2013352427,0 k148,37513,2 k13 Mb1,3 M5,8 k116 k2,8 k11763
jul 201333 326,6 k178,37762,8 k12 Mb1,2 M5,8 k105 k2,7 k3561
jun 20133323 6,0 k18,682035312 Mb1,1 M5,8 k96 k2,6 k358
mai 20133112 6,0 k 8,682471512 Mb1,1 M5,8 k96 k2,6 k358
abr 20133011 6,0 k 8,582432012 Mb1,1 M5,8 k95 k2,6 k358
mar 201329 5 6,0 k28,482447512 Mb1,1 M5,8 k95 k2,6 k358
fev 20132912 5,9 k 8,482747111 Mb1,1 M5,6 k94 k2,6 k357
jan 201328 2 5,9 k 8,482778711 Mb1,1 M5,6 k94 k2,6 k357
dez 201228 2 5,9 k 8,282899311 Mb1,1 M5,6 k93 k2,6 k359
nov 20122812 5,9 k 8,182852711 Mb1,1 M5,6 k91 k2,6 k359
out 201227   5,9 k 882782311 Mb1,1 M5,6 k91 k2,6 k359
set 201227 3 5,9 k 7,982772511 Mb1,1 M5,6 k90 k2,6 k359
ago 201227 215,9 k27,78281,2 k11 Mb1,1 M5,6 k89 k2,6 k359
jul 201227 415,8 k47,683091511 Mb1,1 M5,6 k87 k2,6 k360
jun 20122713 5,7 k17,784956211 Mb1,1 M5,6 k82 k2,6 k358
mai 20122614 5,7 k 7,685076311 Mb1,1 M5,6 k81 k2,6 k356
abr 201225 2 5,7 k 7,584960811 Mb1,1 M5,6 k80 k2,6 k356
mar 201225 2 5,6 k 7,484959911 Mb1,1 M5,5 k79 k2,6 k356
fev 201225 215,6 k77,38501,5 k11 Mb1,1 M5,5 k79 k2,6 k356
jan 201225 745,4 k47,38192,0 k10 Mb1,0 M5,5 k75 k2,4 k356
dez 2011251315,3 k47,17912,6 k9,8 Mb953 k5,4 k72 k2,3 k355
nov 2011241415,2 k16,77822,6 k9,3 Mb920 k5,2 k68 k2,3 k355
out 201123 2 5,2 k36,37812,7 k9,2 Mb907 k5,2 k67 k2,3 k355
set 201123 3 5,1 k15,97893769,1 Mb898 k5,2 k60 k2,3 k355
ago 20112311 5,0 k 5,87923579,1 Mb896 k5,2 k59 k2,2 k354
jul 201122 3 5,0 k25,87932829,0 Mb895 k5,2 k58 k2,2 k354
jun 201122 2 5,0 k15,87958459,0 Mb888 k5,1 k58 k2,2 k354
mai 201122 3 4,9 k25,67985998,9 Mb886 k5,1 k54 k2,2 k354
abr 201122 914,9 k75,68041,6 k8,9 Mb884 k5,1 k50 k2,2 k354
mar 201122 534,7 k135,57872,0 k8,2 Mb807 k4,9 k47 k2,1 k353
fev 2011221534,3 k225,57452,3 k6,9 Mb661 k4,3 k41 k1,7 k353
jan 201121 423,6 k135,86651,5 k5,5 Mb517 k2,9 k39 k961552
dez 2010211623,2 k156,17032,0 k5,1 Mb483 k2,6 k36 k754752
nov 2010201532,8 k176,47191,9 k4,3 Mb410 k1,8 k30 k502748
out 2010191532,2 k97,17251,4 k3,5 Mb342 k1,5 k26 k349748
set 201018 222,0 k47,37106763,0 Mb280 k1,3 k22 k208747
ago 2010181531,9 k37,46711,1 k2,6 Mb235 k1,2 k22 k208747
jul 2010172311,8 k 7,25923821,8 Mb163 k1,1 k21 k208746
jun 201015 211,7 k 75882551,8 Mb161 k1,1 k21 k209746
mai 201015 111,7 k 6,95893291,8 Mb160 k1,1 k20 k209746
abr 201015 111,7 k 6,75863481,8 Mb159 k1,1 k20 k209746
mar 2010151211,7 k 6,55842531,8 Mb159 k1,1 k20 k209746
fev 201014 111,7 k 6,45811921,7 Mb158 k1,1 k19 k209246
jan 201014 211,7 k 6,35811791,7 Mb158 k1,1 k19 k209246
dez 2009141111,7 k 6,25802331,7 Mb158 k1,1 k19 k210246
nov 200913 111,7 k 6,15802491,7 Mb158 k1,1 k19 k210246
out 200913 211,7 k 5,95812451,7 Mb158 k1,1 k19 k210246
set 2009132211,7 k 5,85793701,7 Mb157 k1,1 k18 k210246
ago 200911 111,7 k 5,65813611,7 Mb156 k1,0 k18 k210245
jul 200911 111,7 k 5,45812781,7 Mb156 k1,0 k17 k210245
jun 200911 111,7 k 5,35811901,7 Mb156 k1,0 k17 k210243
mai 200911 111,7 k 5,25792841,7 Mb155 k1,0 k17 k210243
abr 200911 111,7 k 55793941,7 Mb155 k1,0 k17 k211243
mar 200911 111,7 k-14,85806521,7 Mb155 k1,0 k16 k211243
fev 2009111211,7 k-14,35891,1 k1,7 Mb160 k1,0 k16 k211243
jan 200910 211,7 k33,66114011,6 Mb166 k1,0 k12 k212243
dez 200810 111,6 k43,65958071,5 Mb153 k96811 k225243
nov 2008101211,5 k53,45346011,3 Mb129 k8069,0 k279238
out 20089 111,4 k123,34108261014 kb94 k6997,6 k269138
set 20089 111,0 k113,7363745670 kb62 k5126,1 k126138
ago 20089   664 4,538280492 kb44 k4145,6 k109 30
jul 20089   661 4,4383117488 kb44 k4145,4 k109 30
jun 2008911 659 4,238285484 kb44 k4045,3 k109 29
mai 20088   652 4,1385126479 kb44 k3955,1 k108 29
abr 20088   651 3,938653475 kb44 k3954,8 k108 29
mar 20088   650 3,838665467 kb44 k3954,4 k108 29
fev 20088   650 3,738697464 kb44 k3954,2 k108 29
jan 2008811 649 3,6386100451 kb44 k3953,3 k108 29
dez 2007711 649 3,438653438 kb44 k3952,3 k108 29
nov 20076 1 64923,438579435 kb44 k3952,1 k110 29
out 2007612160043,5399404406 kb40 k3932,0 k110 27
set 20075 1146193,7364844283 kb28 k3161,1 k79 14
ago 20075 1119734,424856287 kb7,7 k33448030 11
jul 2007511 106 2,82394141 kb3,4 k1343261 3
jun 20074   99 2,6236238 kb3,1 k982901 3
mai 20074   99 2,6236538 kb3,1 k982891 3
abr 2007412 9912,52355238 kb3,1 k982861 3
mar 20073   63 3,12301423 kb1,9 k162801 3
fev 20073 1 63 2,92232422 kb1,9 k62761 3
jan 2007311 5922,72249921 kb1,7 k62532 3
dez 20062   9 6,633965,5 kb33461281 3
nov 20062   9 5,931935,2 kb30661281 3
out 20062   9 5,631825,2 kb30561281 3
set 2006211 9 5,331375,2 kb29961281 3
ago 20061   7 5,9365 4,6 kb26461281 3
jul 20061   7 5,936514,6 kb26461281 3
jun 20061   6 6,7406164,5 kb25061281 3
mai 20061   2 121474 5,9 kb357 127 293
abr 20061   2 12147415,9 kb357 127 293
mar 20061   1 231442 4,0 kb228 127 293
fev 20061   1 23144274,0 kb228 127 293
jan 20061   1 16143294,0 kb227 127 291
dez 20051   1 732761,7 kb41 127  1
nov 20051        14       
out 20051        14       
set 20051        14       
ago 20051        14       
jul 20051        14       
jun 20051        14       
mai 20051        14       
abr 20051        14       
mar 20051        14       
fev 20051        14       
jan 20051        14       
dez 200411      114       
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
The following table ranks this project in relation to projects in other languages with 1000+ articles
out 20145036303666233173036308145832107
jul 20145029382666242562937308151831107
abr 20145031452668212762340318451832107
jan 20145041352466153362542338550932107
out 201350293325662023621433684551432107
jul 201350394026722523634504384571769107
abr 201351266248746121466524485591789107
jan 201351435352726525362514285591787107
out 201252327246705725358494082601786107
jul 201250443739684327357483981581788107
abr 201252375051696327363483980591788107
jan 201251352420684128341524278591987107
out 201153405347674435445514477592086107
jul 201153394645654740461504276602087107
abr 201153331937643343348464076601985107
jan 201153334027682739643554979623080107
out 201057283632693531748595382664279107
jul 201059205160716126971686284684975107
abr 201062447057705528968656082654875107
jan 201060285449665629868645880614781107
out 200961385852665531866635879614679107
jul 200965376954665735763615380604679107
abr 200962447353644938760615276594178107
jan 200962575234623954749595175624079107
out 2008623656356824551333665778663483106
jul 2008612865427254717166706681684691106
abr 2008624270457158676770686581674488106
jan 2008593856486655646467656276674088106
out 2007642944396537616151655775673687106
jul 2007673453427554616170807882807884106
abr 2007703346437451585873817681797282106
jan 2007773154417542515168847891796679106
out 2006823761408648474788899189826376106
jul 2006953960358948444491919287785778106
abr 2006933649339144404072858491695335106
jan 2006824154338640363665848285664637101
out 200576        97     97
jul 200572        94     94
abr 200566        83     83
jan 200561        74     74
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100ediçõesbytes
 WikcionaristasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikcionaristas (usuários registrados)
A = Wikcionaristas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikcionaristas que editaram pelo menos dez vezes desde que chegaram
C = Wikcionaristas que contribuíram cinco vezes ou mais este mês
D = Wikcionaristas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  2500  5  10  100  1000  1  3  5  10  25  1  3  5  10  25  100  250  1000  5  10  100 
Monthly counts for recent history of wiki
dez 2014                            
nov 201462111111 11  21    71      22 
out 201484421111 11111     411     2  
set 201463222111 11114     1033     22 
ago 201493321111 22211     411     11 
jul 201474322221 222       311111  111
jun 201475443222 331 321   7422111 111
mai 20141064332221332 22222 63322211111
abr 201484222222 221 311   15311111 111
mar 201473333211 222 31    721     11 
fev 201485554221 222 3     9111       
jan 201484444221 443 42    146432   22 
dez 201363222221 44213     82111   11 
nov 201384332221 222 31    141111   11 
out 201364443222 222 3     9441111 1  
set 201354433322 331 42    953311  11 
ago 201384433221 541132    1022     11 
jul 20136333222  221 111   921111  21 
jun 201375322   221 211   21      11 
mai 201353211   331 53    51      11 
abr 201331111   541       3       221
mar 201386532   431 1     611     331
fev 20137321    551 2     72      11 
jan 201352211   761 31    311     21 
dez 201292221   652 2     632111  1  
nov 20124222    752 5111  71      11 
out 201291     332 31    631     22 
set 201253321   751 111   61      22 
ago 20125321111  662 611   742111  221
jul 2012764311   542 7222  165311   22 
jun 201263321   641 311   7331    1  
mai 201284431   653 5111  101      11 
abr 20128421    653 22    3111    22 
mar 20125321    444 31    72      11 
fev 20126421111  332 51    73211   11 
jan 201212875441  761 6431  964211  32 
Quarterly counts for entire history of wiki
out 201484421111 11111     411     2  
jul 201474322221 222       311111  111
abr 201484222222 221 311   15311111 111
jan 201484444221 443 42    146432   22 
out 201364443222 222 3     9441111 1  
jul 20136333222  221 111   921111  21 
abr 201331111   541       3       221
jan 201352211   761 31    311     21 
out 201291     332 31    631     22 
jul 2012764311   542 7222  165311   22 
abr 20128421    653 22    3111    22 
jan 201212875441  761 6431  964211  32 
out 201152221   5431211   6       11 
jul 20117432    431 311   811     11 
abr 201114995511  431 522   85442   11 
jan 201110442222  541 4331  821111  11 
out 20105555532      7431  127752   11 
jul 20105533211      2221  52222      
abr 20104311111            6411    22 
jan 2010522111   1   3     5111    1  
out 2009322111       11    3          
jul 20092111111  1         41      11 
abr 20093211111  11        211        
jan 20094321111  22        82211   11 
out 20083211111  22  42    953111     
jul 20081      11  1     3          
abr 20082      11        1          
jan 20081111    11  2     2          
out 2007222221   11  2     42222      
jul 200731111                        
abr 200732221             22111      
jan 200711111   11        11         
out 2006                 1          
jul 2006                 1          
abr 20061          1     1          
jan 200611         4     521        
out 2005                            
jul 2005                            
abr 2005                            
jan 2005                            

 

Distribuição de edições de artigos por wikcionaristas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikcionaristasEdições total
1175100.0%77,472100.0%
36235.4%77,28699.8%
104324.6%77,17799.6%
322514.3%76,83099.2%
100179.7%76,35098.6%
316137.4%75,54597.5%
100095.1%73,70995.1%
316231.7%63,10681.5%
1000021.1%56,11172.4%
3162310.6%32,15341.5%

 

6 wikcionaristas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions
agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
Faiq ƏsgərUC2 023,9581,933261dez 01, 201336313,8441,024141
Lo XimiendoUC10 0626128-nov 22, 201014689-9-
123snake45UC12 0361120-mai 11, 2013567103-14-
CommonsDelinkerUC19 0742161dez 07, 20072549----
Turan-kamalsoyUC83...33--nov 22, 20147----
Marcus CyronUC174...1121nov 23, 20146--1-

 

20 wikcionaristas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
SinanUC132,153jul 13, 20072696out 12, 201448
InterwicketUC36,995jan 29, 20092130nov 08, 20101482
SinekUC42,190set 07, 20091909abr 22, 2013586
Hacı FaiqUC52,063out 01, 2013424out 31, 2013394
Hacı ƏsgərUC61,951nov 01, 2013393nov 30, 2013364
Hacı FətullaUC71,793set 01, 2013454set 30, 2013425
Mirzə MəmmədquluUC81,547ago 01, 2013485ago 31, 2013455
Mirza HasanquluUC91,059jun 19, 2013528jul 31, 2013486
Remedios44UC11507fev 07, 20111391ago 25, 20111192
Cekli829UC13342set 15, 20091901fev 22, 2014280
Sabri76UC14283jun 20, 20101623mar 31, 2013608
VagoUC15190jul 12, 20101601jul 07, 20111241
SafaviUC16185jun 05, 2012907jul 22, 2012860
MalafayaUC17147out 05, 20082246jun 23, 2014159
AydınUC1894out 15, 20072602out 21, 20072596
YurdumquluUC2071jun 25, 2013522ago 22, 2013464
Baki66UC2161jan 06, 20072884set 24, 20072623
NKOziUC2259mar 31, 20111339dez 29, 20111066
MehridadUC2355mai 02, 2013576mai 27, 2014186
TaryelUC2433dez 25, 20072531dez 25, 20072531

 

usuários anônimos, ordenados por número de contribuições
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
80.222.151.206372
187.58.203.197199
78.111.55.187121
200.130.64.1114
177.96.207.123107
177.17.142.3290
200.172.66.11455
201.15.77.3635
177.17.232.2629
80.222.146.22228

No total 2.231 edições foram feitas por usuários anônimos, de um total de 121.037 edições ( 1e %)
  


19 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
JAnDbotUC111,565mai 18, 20111291nov 25, 20144--
HydrizBotUC27,495abr 23, 2012950ago 23, 2013463--
Luckas-botUC36,051mar 03, 20092097jan 27, 2014306--
MalafayaBotUC45,218nov 18, 20111107jun 12, 2014170--
KamikazeBotUC54,181out 18, 20111138mar 06, 2013633--
YS-BotUC62,141set 08, 2012812ago 29, 201492--
VolkovBotUC7972out 01, 20072616abr 05, 2013603--
AvocatoBotUC8631out 31, 20111125ago 25, 2013461--
WikitanvirBotUC9630abr 14, 20111325jan 19, 20121045--
ArthurBotUC10620nov 14, 20101476nov 12, 20111113--
RoggBotUC11443fev 07, 20092121jun 12, 20111266--
SpaceBirdyBotUC12378jul 07, 20082336dez 30, 20091795--
MjbmrbotUC13356jan 18, 20111411mar 28, 20111342--
WarddrBOTUC14300jul 25, 2012857ago 18, 2013468--
RobotGMwiktUC15212jan 09, 20072881jun 06, 20082367--
CarsracBotUC16107out 16, 20091870mai 30, 2013548--
Makecat-botUC1723nov 10, 2012749abr 05, 2013603--
GhalyBotUC182jan 06, 2013692jan 06, 2013692--
MelancholieBotUC191out 07, 20091879out 07, 20091879--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110JpgOggSvg
nov 201429 k545241051,5 k32,6 k      1893811
out 201428 k54024951,5 k32,4 k      21238 1
set 201427 k53924951,5 k32,4 k      23398 1
ago 201426 k53324951,5 k32,4 k      19588 1
jul 201425 k52824951,5 k32,4 k      25498 1
jun 201423 k52724951,5 k32,3 k      43188 1
mai 201422 k52524951,4 k32,1 k      56778 1
abr 201420 k52424951,1 k31,5 k      42878 1
mar 201419 k51924951,1 k31,4 k      23688 1
fev 201417 k51524951,1 k31,4 k      23838 1
jan 201416 k51024951,1 k31,4 k      28528 1
dez 201314 k49824951,1 k31,3 k      22258 1
nov 201313 k49624951,1 k31,3 k      25018 1
out 201312 k48924951,1 k31,2 k      41608 1
set 201310 k48524951,1 k31,1 k      40058 1
ago 20138,6 k46524951,0 k31,1 k      19628 1
jul 20137,3 k45924851,0 k31,1 k      18167 1
jun 20136,6 k45124751,0 k31,0 k      1376 1
mai 20136,5 k45024751,0 k31,0 k      546 1
abr 20136,5 k44724751,0 k31,0 k      286 1
mar 20136,5 k44324751,0 k31,0 k      1466 1
fev 20136,4 k43324751,0 k31,0 k      276 1
jan 20136,4 k42624751,0 k31,0 k      546 1
dez 20126,4 k42124751,0 k31,0 k      536 1
nov 20126,4 k41424751,0 k31,0 k      296 1
out 20126,4 k41124751,0 k31,0 k      136 1
set 20126,4 k40724751,0 k31,0 k      666 1
ago 20126,4 k40124751,0 k31,0 k      3006 1
jul 20126,4 k39424751,0 k31,0 k      2076 1
jun 20126,2 k38824751,0 k31,0 k      716 1
mai 20126,2 k37324751,0 k31,0 k      756 1
abr 20126,2 k36324751,0 k21,0 k      346 1
mar 20126,2 k35224751,0 k21,0 k      226 1
fev 20126,2 k34924751,0 k21,0 k      7826 1
jan 20126,0 k33624751,0 k21,0 k      14146 1
dez 20115,7 k32924759602980      12346 1
nov 20115,5 k32424759332721      3456 1
out 20115,5 k30724759262698      606 1
set 20115,5 k30124759262697      536 1
ago 20115,4 k29524759232697      266 1
jul 20115,4 k28824759222671      546 1
jun 20115,4 k27624759202671      326 1
mai 20115,4 k27324759192668      496 1
abr 20115,4 k26024759182638      9916 1
mar 20115,1 k24724759072557      15046 1
fev 20114,7 k24424758722538      20726 1
jan 20114,1 k23123658322520      12755 1
dez 20103,5 k22323358182509      15092 1
nov 20103,0 k22023257552369      14291 1
out 20102,4 k21523246652339      14361 1
set 20102,1 k20823146182319      671  1
ago 20102,0 k20122 46152318      1046   
jul 20101,9 k18222 44802318      375   
jun 20101,9 k18022 44352318      255   
mai 20101,9 k16122 44332318      325   
abr 20101,9 k15922 44332318      343   
mar 20101,9 k15522 44332318      252   
fev 20101,8 k15022 44332318      189   
jan 20101,8 k14822 44332318      170   
dez 20091,8 k13122 44322318      226   
nov 20091,8 k13022 44312318      242   
out 20091,8 k12622 44312318      238   
set 20091,8 k12422 44312318      370   
ago 20091,8 k11422 44302318      359   
jul 20091,8 k11422 44302318      269   
jun 20091,8 k11221 44302318      184   
mai 20091,8 k11021 44292318      263   
abr 20091,8 k10821 44292317      377   
mar 20091,8 k10021 44292317      562   
fev 20091,8 k9319 44292317      811   
jan 20091,8 k8419 44252317      294   
dez 20081,7 k8119 44172295      715   
nov 20081,6 k7919 43512163      484   
out 20081,4 k6419 12872101      785   
set 20081,1 k5119 1204286      696   
ago 20087135017 1189272      1   
jul 20087105017 1189272      2   
jun 20087074816 1189272      28   
mai 20086994316 1187272      2   
abr 20086984316 1187272      2   
mar 20086974216 1187272      1   
fev 20086974016 1187272      1   
jan 20086974016 1187272      11   
dez 20076963816 1187271      35   
nov 20076963616 1187270      64   
out 20076503516 1185268      329   
set 20074963116 1178252      806   
ago 20072272915 1157220      530   
jul 20071152514 111322      30   
jun 20071072514 111322          
mai 20071072514 111322          
abr 20071062514 111322      47   
mar 2007681714 111022      5   
fev 2007661614 111022      6   
jan 2007621614 110922      52   
dez 2006151513 110822      1   
nov 2006141513 110722          
out 2006141513 110722          
set 2006141313 110722      7   
ago 2006101212 19612          
jul 2006101212 19612          
jun 200691112 19512      3   
mai 200651110 18011          
abr 200651110 18011      1   
mar 200641110 18011          
fev 200641110 18011      6   
jan 200621010 18011      4   
dez 2005255 1791           
nov 2005111  78            
out 2005111  78            
set 2005111  78            
ago 2005111  78            
jul 2005111  78            
jun 2005111  78            
mai 2005111  78            
abr 2005111  78            
mar 20051 1  78            
fev 20051 1  78            
jan 20051 1  78            
dez 20041 1  78            

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

dez 2005: 1 1 main Page

jan 2006: 1 1 Ana Səhifə

fev 2006: 1 2 Main Page , 2 2 Ana Səhifə , 3 1 ana Səhifə

abr 2006: 1 1 Azərbaycan dili

jun 2006: 1 1 qartal

set 2006: 1 1 آتا

dez 2006: 1 1 kiçik

jan 2007: 1 1 arzu

fev 2007: 1 1 əl telefonu

mar 2007: 1 1 cənub

abr 2007: 1 1 səyahət

jul 2007: 1 1 armud

ago 2007: 1 2 türkcə , 2 1 köpək

set 2007: 1 2 yaşamaq , 2 1 april

out 2007: 1 2 ülgü , 2 2 görüş , 3 2 qorumaq , 4 1 gül

nov 2007: 1 1 səhra

dez 2007: 1 1 boşqab

jan 2008: 1 1 Moskva

fev 2008: 1 1 türkcə

mar 2008: 1 1 Ana Səhifə

abr 2008: 1 1 виноград

mai 2008: 1 1 August

jun 2008: 1 1 krım tatarca

jul 2008: 1 1 جالگاه

ago 2008: 1 1 Wolf

set 2008: 1 2 afrikaans , 2 2 Afrika dili , 3 2 Qırım Tatarca , 4 2 Ana Səhifə , 5 1 od

out 2008: 1 2 мак , 2 2 ana , 3 1 teatr

nov 2008: 1 2 patlıcan , 2 2 Finlandiya , 3 2 alt , 4 2 Məkkə , 5 2 nənə , 6 2 nar , 7 2 armud , 8 2 Ana Səhifə , 9 1 qovaq

dez 2008: 1 2 ürək , 2 1 fişəng

jan 2009: 1 2 lüğət , 2 2 zər , 3 2 qaynar , 4 1 гусь

fev 2009: 1 2 yarasa , 2 2 Kullanıcı:Mardetanha , 3 1 hörümçək

mar 2009: 1 1 döngə

abr 2009: 1 2 august , 2 1 Азербайджанский язык

mai 2009: 1 3 qozu , 2 3 qoy

jun 2009: 1 2 suiti

jul 2009: 1 2 Arbeit , 2 2 Katze , 3 1 katze

ago 2009: 1 2 птица , 2 2 bayraq , 3 1 mənzərə

set 2009: 1 2 cekcə , 2 2 Cek dili , 3 2 self control , 4 2 page

out 2009: 1 2 həftə , 2 1 qapaq

nov 2009: 1 1 qapaq

dez 2009: 1 2 qovun , 2 2 banan , 3 2 Ana Səhifə , 4 1 həftə

jan 2010: 1 2 kəfgir , 2 2 pendir , 3 1 süzgəc

fev 2010: 1 1 page

mar 2010: 1 2 iribaş , 2 2 Kaulquappe

abr 2010: 1 2 skripka , 2 2 saqqal , 3 1 iribaş

mai 2010: 1 2 Ana Səhifə , 2 1 həftə

jun 2010: 1 2 Ellenbogen , 2 2 Ellbogen , 3 2 elbow

jul 2010: 1 2 teleskop , 2 2 hamam , 3 2 tiraj , 4 2 Opponent , 5 2 Cek dili , 6 2 qaşıq , 7 2 günəş , 8 2 Azərbaycan dili

ago 2010: 1 4 evlənmək , 2 3 çalma , 3 3 qızılquş , 4 3 lil , 5 3 öskürək , 6 3 ağartmaq , 7 3 yaralanmamaq , 8 3 konj , 9 3 çiyələk , 10 3 gecə , 11 3 heyva , 12 3 təsirlik , 13 3 ayı , 14 2 cover , 15 2 paxla , 16 2 palto , 17 2 menecer , 18 2 laboratoriya , 19 2 zərf , 20 2 gec , 21 2 kabel , 22 2 küknar , 23 2 yumaq , 24 2 katır , 25 2 qatır

set 2010: 1 2 brom , 2 2 шурин , 3 2 деверь , 4 2 qayın , 5 2 fıstıq , 6 2 золото , 7 2 altun , 8 2 sink , 9 2 mis , 10 2 Kimyəvi elementlərin dövri sistemi , 11 2 arsen , 12 2 мышьяк , 13 2 малахит , 14 2 meruňka , 15 2 кајсија , 16 2 кайсия , 17 2 marelica , 18 2 morela

out 2010: 1 4 sumaq , 2 3 türk , 3 3 yunan , 4 3 zəfər , 5 3 kürü , 6 3 dolma , 7 3 qırxayaq , 8 3 düymələmək , 9 3 yenot , 10 3 γαρύφαλλο , 11 3 nightingale , 12 3 süngü , 13 3 qəssab , 14 3 ekmek , 15 3 mesafe , 16 3 talaşa , 17 3 qonşu , 18 3 ayı , 19 2 верный , 20 2 alman , 21 2 помидор , 22 2 огурец , 23 2 француженка , 24 2 гречанка , 25 2 fransız

nov 2010: 1 3 nəticə , 2 3 yengeç , 3 3 maye , 4 3 ləngitmək , 5 3 yarpaq , 6 3 avokado , 7 3 kəpənək , 8 3 qələbə , 9 3 zoğ , 10 3 лягушка , 11 3 xərçəng , 12 3 üzüm , 13 2 çömçəquyruq , 14 2 otobüslerde , 15 2 domingo , 16 2 ორშაბათი , 17 2 siçovul , 18 2 salı , 19 2 pazartesi , 20 2 şahmatçı , 21 2 vücut , 22 2 safran , 23 2 xəzinə , 24 2 xəstələnmək , 25 2 heykeltıraş

dez 2010: 1 3 təsdiqləmək , 2 2 πάπια , 3 2 Golf , 4 2 valyuta , 5 2 ördəkburun , 6 2 körfəz , 7 2 nərd , 8 2 döymə , 9 2 əzələ , 10 2 solaxay , 11 2 yelkən , 12 2 zürafa , 13 2 nauka , 14 2 tamaşaçı , 15 2 şənbə , 16 2 octopus , 17 2 ördek , 18 2 Aubergine , 19 2 tərəvəz , 20 2 Affe , 21 2 ördək , 22 2 Wolf , 23 1 черепахи

jan 2011: 1 3 üstəgəl , 2 2 vegetasiya , 3 2 diod , 4 2 qovluq , 5 2 söğüt , 6 2 sfenks , 7 2 eyelash , 8 2 tavsiye , 9 2 видишь , 10 2 sevinmək , 11 2 çovğun , 12 2 strategiya , 13 2 velosiped , 14 2 abide , 15 2 sing , 16 2 speak , 17 1 lens

fev 2011: 1 3 barometr , 2 3 balıqçı , 3 3 yaltaqlıq , 4 3 mikrocərrahiyyə , 5 3 səkkiz , 6 3 əl telefonu , 7 3 Ana Səhifə , 8 2 xardal , 9 2 ilə , 10 2 hörük , 11 2 boyun , 12 2 çünki , 13 2 diktor , 14 2 yaltaqlanmaq , 15 2 yaltaq , 16 2 güzəşt , 17 2 külüng , 18 2 zənci , 19 2 qübbə , 20 2 incir , 21 2 on iki , 22 2 on bir , 23 2 dwadzieścia cztery , 24 2 dwadzieścia trzy , 25 2 hər

mar 2011: 1 3 yastıq , 2 3 şaquli , 3 3 üfüqi , 4 3 erkək , 5 3 maraqlı , 6 3 lava , 7 3 yaba , 8 3 hinduşka , 9 3 ovsunlamaq , 10 3 sześćdziesiąt pięć , 11 3 gəmi , 12 3 dekabr , 13 3 noyabr , 14 3 oktyabr , 15 3 sentyabr , 16 3 avqust , 17 2 pääsuke , 18 2 Fərat , 19 2 Dəclə , 20 2 itkin , 21 2 növbə , 22 2 ünsiyyət , 23 2 sərhədçi , 24 2 sahib , 25 2 yiyə

abr 2011: 1 3 cüyür , 2 3 qaratoyuq , 3 3 buket , 4 3 anlamaq , 5 3 ayçiçeği , 6 2 oiseau , 7 2 riyaziyyat , 8 2 eyvan , 9 2 tükətmək , 10 2 xəsis , 11 2 xəta , 12 2 xasiyyət , 13 2 təhqiqat , 14 2 dərs , 15 2 məşğələ , 16 2 təəccüb , 17 2 marş , 18 2 təxmin , 19 2 təhqiq , 20 2 təhdid , 21 2 təhqir , 22 2 tarif , 23 2 tərif , 24 2 izah , 25 2 təfsir

mai 2011: 1 3 Xorvatiya

jun 2011: 1 2 göbələk , 2 2 tərcümə , 3 1 claymore

jul 2011: 1 2 Serbiya , 2 2 Slovakiya , 3 1 çobanyastığı

ago 2011: 1 3 hədəf , 2 1 patlamak

set 2011: 1 2 γκέισα , 2 2 əqrəb , 3 1 kuyu

out 2011: 1 1 oyar

nov 2011: 1 2 maçã , 2 2 renk , 3 2 elma , 4 2 Pluton , 5 2 merkez , 6 2 manzana , 7 2 ailə , 8 2 alma , 9 1 mouse

dez 2011: 1 2 Misir , 2 2 tartaruga , 3 2 uğur , 4 2 krowa , 5 2 ποδήλατο , 6 2 geyinmək , 7 2 hazırlaşmaq , 8 2 vektor , 9 2 mizrab , 10 2 qarğıdalı , 11 2 mühərrik , 12 2 tumurcuq , 13 2 пчела , 14 2 şahmat , 15 1 marzo

jan 2012: 1 3 kenquru , 2 3 osminoq , 3 3 dinozavr , 4 3 arvad , 5 3 gəlin , 6 3 Lixtenşteyn , 7 3 böyürtkən , 8 2 xloroform , 9 2 platinum , 10 2 chloroform , 11 2 chemistry , 12 2 akustik , 13 2 velosipedçi , 14 2 idmançı , 15 2 təyyarəçi , 16 2 dəmir , 17 2 Qana , 18 2 Bosniya və Herseqovina , 19 2 oğul , 20 2 növbə , 21 2 koramal , 22 2 bibioğlu , 23 2 bibiqızı , 24 2 kitabxana , 25 2 tüstü

fev 2012: 1 2 Əskişəhər , 2 2 səhabə , 3 2 həvari , 4 2 mezarlık , 5 2 rəqəm , 6 2 nömrə , 7 1 Naxçıvan

mar 2012: 1 2 Azerbaijan , 2 1 choose

abr 2012: 1 2 arx , 2 1 donna

mai 2012: 1 2 ölkə , 2 1 panno

jun 2012: 1 2 aigua , 2 1 Aserbajdsjan

jul 2012: 1 3 body , 2 2 מים , 3 2 para , 4 2 bed , 5 2 ur , 6 2 Allah , 7 1 böcek

ago 2012: 1 2 Afghanistan , 2 2 əl , 3 1 miercuri

set 2012: 1 1 düğün

out 2012: 1 1 yumruq

nov 2012: 1 2 Versicherung , 2 2 owl , 3 2 Apfel , 4 1 Biləsuvar

dez 2012: 1 2 Cibuti , 2 1 çırpı

jan 2013: 1 2 Əlcəzair , 2 2 kəpənək , 3 1 Yugoslavya

fev 2013: 1 2 yardım , 2 1 xaç

mar 2013: 1 3 dırmıq , 2 3 Xocalı , 3 2 masturbasiya , 4 2 bambuq , 5 2 koreyalı , 6 1 մաստուրբացիա

abr 2013: 1 1 Balakən

mai 2013: 1 1 artmaq

jun 2013: 1 2 rojo , 2 2 axtarmaq , 3 1 hacer

jul 2013: 1 2 ti , 2 2 aimer , 3 2 Zaragoza , 4 2 копчёный , 5 2 fem , 6 2 اندک , 7 2 الان , 8 2 اسم , 9 2 biçmək , 10 2 sombra , 11 2 səbət , 12 2 копьё , 13 2 корзина , 14 2 aqua , 15 2 kingdom , 16 2 krallıq , 17 2 кормить , 18 2 лаваш , 19 2 косой , 20 2 косолапый , 21 2 костёр , 22 2 Stadt , 23 2 vedere , 24 2 vendere , 25 2 venire

ago 2013: 1 2 helado , 2 2 batir , 3 2 mezclar , 4 2 reír , 5 2 moreno , 6 2 кличка , 7 2 suivre , 8 2 başsağlığı , 9 2 qamçı , 10 2 careful , 11 2 birləşmək , 12 2 gün , 13 2 şam , 14 2 candle , 15 2 but , 16 2 Apia , 17 2 Samoa , 18 2 козёл , 19 2 enmək , 20 2 peigne , 21 2 öö , 22 2 yığmaq , 23 2 oğul , 24 2 Braziliya , 25 2 ya

set 2013: 1 3 yırtmaq , 2 3 yanmaq , 3 3 qısa , 4 3 qırıcı , 5 3 acı , 6 3 pəncərə , 7 3 göz , 8 3 qız , 9 3 qara , 10 2 yorğun , 11 2 Dunay , 12 2 qul , 13 2 parıltı , 14 2 balqabaq , 15 2 olmaq , 16 2 dağ , 17 2 bilet , 18 2 vicdansız , 19 2 daha , 20 2 hamilə , 21 2 yordam , 22 2 qiymət , 23 2 window , 24 2 исступлённый , 25 2 истерзать

out 2013: 1 3 ღვინო , 2 3 aldatmaq , 3 2 basdırmaq , 4 2 Maldiv adaları , 5 2 جزر المالديف , 6 2 Qərbi Sahara , 7 2 Batı Sahra , 8 2 Sahara Occidental , 9 2 Алабама , 10 2 planet , 11 2 Nasáu , 12 2 Nassau , 13 2 Нассау , 14 2 махуэ , 15 2 гъэ , 16 2 адэ , 17 2 бзэ , 18 2 пхъэгулъ , 19 2 bura , 20 2 suçlu , 21 2 изменить , 22 2 измениться , 23 2 изменник , 24 2 tutmak , 25 2 rüşvet

nov 2013: 1 2 zəhər , 2 2 yükləmək , 3 2 È un libro , 4 2 звать , 5 2 Dili , 6 2 Doha , 7 2 çağırmaq , 8 2 móðir , 9 2 mor , 10 2 sındırmaq , 11 2 söymək , 12 2 derramar , 13 2 o'ttiz , 14 2 sakkiz , 15 2 yetti , 16 2 besh , 17 2 uch , 18 2 ikki , 19 2 Solomon adaları , 20 2 Solomon Islands , 21 2 məqsəd , 22 2 Valletta , 23 2 qapıçı , 24 2 meyvə , 25 2 düzənlik

dez 2013: 1 2 Məhəmməd , 2 2 Yeni iliniz mübarək! , 3 2 qayə , 4 2 занимательный , 5 2 заниматься , 6 2 заноза , 7 2 заносчивый , 8 2 занятие , 9 2 заочный , 10 2 zabit , 11 2 yük , 12 2 yalan , 13 2 заунывный , 14 2 işğal etmək , 15 2 миндаль , 16 2 şəkər , 17 2 zarafat , 18 2 əməl , 19 2 boran , 20 2 cərimə , 21 2 müdafiəçi , 22 2 ərizə , 23 2 lemon , 24 2 bite , 25 2 Qambiya

jan 2014: 1 3 məna , 2 2 Ərəbistan dənizi , 3 2 bükmək , 4 2 təbiət , 5 2 peyk , 6 2 süni , 7 2 qanacaq , 8 2 hərf , 9 2 əski , 10 2 old , 11 2 əhəmiyyətli , 12 2 əhəmiyyətsiz , 13 2 hürriyyət , 14 2 önemsiz , 15 2 azadlıq , 16 2 etkisiz , 17 2 etkili , 18 2 güncel , 19 2 özgürlük , 20 2 səhv , 21 2 buğ , 22 2 buxar , 23 2 örtülü , 24 2 tədarük , 25 2 tədarük etmək

fev 2014: 1 3 udmaq , 2 2 Кишинёв , 3 2 Chișinău , 4 2 cüt , 5 2 Birləşmiş Ərəb Əmirlikləri , 6 2 cavab , 7 2 cavab vermək , 8 2 parlaq , 9 2 cəllad , 10 2 vergi , 11 2 rapu , 12 2 testa , 13 2 giornale , 14 2 frutto , 15 2 egli , 16 2 dente , 17 2 bambina , 18 2 bambino , 19 2 cambra , 20 2 бал , 21 2 siekiera , 22 1 Irlande

mar 2014: 1 2 Mərkəzi Afrika Respublikası , 2 2 kütlə , 3 2 balet , 4 2 televiziya , 5 2 cin , 6 2 şeytan , 7 2 adi , 8 2 rəf , 9 2 cinayət , 10 2 zəncir , 11 2 qəsəbə , 12 2 vadi , 13 2 qüllə , 14 2 qısa , 15 2 occasion , 16 2 Georgia , 17 2 Türkmənistan , 18 2 vəzifə , 19 2 Bosniya və Herseqovina , 20 2 Gürcüstan , 21 2 yeni , 22 2 bacı , 23 2 Azerbaijan , 24 2 saat , 25 1 бачыць

abr 2014: 1 2 adroit , 2 2 ödəniş , 3 2 abandonner , 4 2 tərk etmək , 5 2 mirvari , 6 2 Xoş gəlmisiniz! , 7 2 əsir , 8 2 sərbəst , 9 2 şüar , 10 2 действие , 11 2 çat , 12 2 daxma , 13 2 azad , 14 2 bölən , 15 2 dərnək , 16 2 varlı , 17 2 buzlaq , 18 2 çalışqan , 19 2 Асмэра , 20 2 Qırmızı dəniz , 21 2 شتر , 22 2 شارب , 23 2 Ostsee , 24 2 Балтыйскае мора , 25 2 İssık-Kul

mai 2014: 1 3 İsveçrə , 2 3 balıq , 3 3 pəncərə , 4 2 Bazel , 5 2 porco , 6 2 abacaxi , 7 2 Düşənbə , 8 2 Pamir , 9 2 jöl , 10 2 vinte , 11 2 Bugarska , 12 2 nida , 13 2 təşəkkür , 14 2 София , 15 2 Кура , 16 2 Augustus , 17 2 Julie , 18 2 Junie , 19 2 Mei , 20 2 Maart , 21 2 Februarie , 22 2 Januarie , 23 2 Desember , 24 2 Παραγουάη , 25 2 Парагвай

jun 2014: 1 3 açmaq , 2 3 çuğundur , 3 2 aprikoos , 4 2 নাক , 5 2 कान , 6 2 কান , 7 2 Шуэц , 8 2 Suécia , 9 2 əjdəha , 10 2 Estocolmo , 11 2 pencər , 12 2 вьюга , 13 2 Belqrad , 14 2 Niş , 15 2 , 16 2 Voyevodina , 17 2 South America , 18 2 Zaltsburq , 19 2 Vyana , 20 2 Wien , 21 2 ящерица , 22 2 Гондурас , 23 2 Tequsiqalpa , 24 2 Portu , 25 2 Berno

jul 2014: 1 2 Minsk , 2 2 çıxıb getmək , 3 2 aýy , 4 2 çıxarış , 5 2 leikur , 6 2 Cotonou , 7 2 Porto-Novo , 8 2 Порто-Ново , 9 2 ბენინი , 10 2 بنين , 11 2 Μπενίν , 12 2 Bénin , 13 2 кафта , 14 2 кьюб , 15 2 zwee , 16 2 duo , 17 2 două , 18 2 lien , 19 2 rate , 20 2 croupe , 21 2 rond , 22 2 dahi , 23 2 constant , 24 2 intérieur , 25 2 génie

ago 2014: 1 2 öpmək , 2 2 qalxan , 3 2 mühasirə , 4 2 xüsusi , 5 1 хьед

set 2014: 1 2 Yunoniston , 2 2 Yunanistan , 3 2 Yunanıstan , 4 1 scarabeo

out 2014: 1 2 coraggioso , 2 2 morrer , 3 2 yazıçı , 4 2 ölmək , 5 2 krava , 6 1 akã

nov 2014: 1 2 sındırmaq , 2 2 bardaq , 3 2 alın , 4 1 rust

No data on this page have been normalized to 30 day months (as WMF does on certain traffic reports).
Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Sábado, 24 de janeiro 2015 00:53

Dump file azwiktionary-20141212-pages-meta-history.xml.7z (full dump), size 11 Mb as 7z -> 388 Mb
Dump processed till Nov 30, 2014, on server stat1002, ready at Sun-14/12/2014-10:46 after 1 min, 49 sec.

Versão do script:2.6
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.