Estatísticas da Wikcionário azeri

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist

Metrics have been collected from a full archive dump, which contains all revisions of every article, meta data and raw content.
See also metrics definitions


 
Monthly counts & Quarterly rankings: fevereiro 2014
 
DataWikcionaristasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
fev 2014+2%   +2%   -33%+3%+3%+1%+2%+4%0%0%
jan 20140%   +8%-27%  -1%+9%+9%+4%+9%+12%+1%0%
dez 2013+2%   +13%   +25%+8%+8%+4%+18%+11%+1%0%
nov 2013+5%   +6%   -32%+6%+5%+1%+11%+7%+4%0%
out 2013+3%   +10%0%  +8%+9%+8%+3%+11%+11%+5%+3%
set 2013+6%   +10%   +46%+23%+26%+2%+4%+32%+289%+3%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
fev 20144215211 k77,36782,8 k23 Mb2,2 M6,8 k194 k5,6 k50767
jan 201441 4211 k277,26754,2 k22 Mb2,1 M6,7 k191 k5,4 k50767
dez 20134112210 k377,46894,3 k20 Mb1,9 M6,4 k176 k4,8 k50467
nov 2013402329,0 k187,97353,4 k19 Mb1,8 M6,2 k148 k4,3 k50067
out 2013381428,5 k2487555,0 k18 Mb1,7 M6,1 k133 k4,1 k47967
set 2013372437,7 k248,17804,7 k16 Mb1,6 M6,0 k121 k3,7 k45565
ago 2013352427,0 k148,37493,2 k13 Mb1,3 M5,8 k116 k2,8 k11763
jul 201333 326,6 k178,37742,8 k12 Mb1,2 M5,9 k105 k2,7 k3561
jun 20133323 6,0 k18,681935412 Mb1,1 M5,8 k96 k2,6 k358
mai 20133112 6,0 k 8,682271712 Mb1,1 M5,8 k96 k2,6 k358
abr 20133011 6,0 k 8,582332112 Mb1,1 M5,8 k95 k2,6 k358
mar 201329 5 6,0 k28,482347512 Mb1,1 M5,8 k95 k2,6 k358
fev 20132912 5,9 k 8,482647211 Mb1,1 M5,7 k94 k2,6 k357
jan 201328 2 5,9 k 8,382578711 Mb1,1 M5,7 k94 k2,6 k357
dez 201228 2 5,9 k 8,282699511 Mb1,1 M5,6 k93 k2,6 k359
nov 20122812 5,9 k 8,182653711 Mb1,1 M5,6 k91 k2,6 k359
out 201227   5,9 k 882782311 Mb1,1 M5,6 k91 k2,6 k359
set 201227 3 5,9 k 7,982672511 Mb1,1 M5,6 k90 k2,6 k359
ago 201227 215,9 k27,78271,2 k11 Mb1,1 M5,6 k89 k2,6 k359
jul 201227 415,8 k47,682991511 Mb1,1 M5,6 k87 k2,6 k360
jun 20122713 5,7 k17,784856211 Mb1,1 M5,6 k82 k2,6 k358
mai 20122614 5,7 k 7,684976311 Mb1,1 M5,6 k81 k2,6 k356
abr 201225 2 5,7 k 7,584960811 Mb1,1 M5,6 k80 k2,6 k356
mar 201225 2 5,6 k 7,484859911 Mb1,1 M5,6 k79 k2,6 k356
fev 201225 215,6 k77,38491,5 k11 Mb1,1 M5,6 k79 k2,6 k356
jan 201225 745,4 k47,38182,0 k10 Mb1,0 M5,5 k75 k2,4 k356
dez 2011251315,3 k47,17912,6 k9,8 Mb954 k5,4 k72 k2,3 k355
nov 2011241415,2 k16,77822,6 k9,3 Mb920 k5,2 k68 k2,3 k355
out 201123 2 5,2 k36,37812,7 k9,2 Mb907 k5,2 k67 k2,3 k355
set 201123 3 5,1 k15,97893789,1 Mb898 k5,2 k60 k2,3 k355
ago 20112311 5,0 k 5,87923579,1 Mb896 k5,2 k59 k2,2 k354
jul 201122 3 5,0 k25,77932829,0 Mb895 k5,2 k58 k2,2 k354
jun 201122 2 5,0 k15,87948459,0 Mb888 k5,1 k58 k2,2 k354
mai 201122 3 4,9 k25,67985998,9 Mb887 k5,1 k54 k2,2 k354
abr 201122 914,9 k75,68031,6 k8,9 Mb884 k5,1 k50 k2,2 k354
mar 201122 534,7 k135,57862,0 k8,2 Mb807 k4,9 k47 k2,1 k353
fev 2011221534,3 k225,57442,3 k6,9 Mb661 k4,3 k41 k1,7 k353
jan 201121 423,6 k135,86651,5 k5,5 Mb517 k2,9 k39 k961552
dez 2010211623,2 k156,17022,0 k5,1 Mb483 k2,6 k36 k754752
nov 2010201532,8 k176,47181,9 k4,3 Mb410 k1,8 k30 k502748
out 2010191532,2 k977241,4 k3,5 Mb342 k1,5 k26 k349748
set 201018 222,0 k47,37096763,0 Mb280 k1,3 k22 k208747
ago 2010181531,9 k37,46701,1 k2,6 Mb235 k1,2 k22 k208747
jul 2010172311,8 k 7,25913821,8 Mb163 k1,1 k21 k208746
jun 201015 211,7 k 75872551,8 Mb161 k1,1 k21 k209746
mai 201015 111,7 k 6,95883291,8 Mb161 k1,1 k20 k209746
abr 201015 111,7 k 6,75863481,8 Mb160 k1,1 k20 k209746
mar 2010151211,7 k 6,55832531,8 Mb159 k1,1 k20 k209746
fev 201014 111,7 k 6,45801921,7 Mb158 k1,1 k19 k209246
jan 201014 211,7 k 6,35801791,7 Mb158 k1,1 k19 k209246
dez 2009141111,7 k 6,25792331,7 Mb158 k1,1 k19 k210246
nov 200913 111,7 k 6,15792491,7 Mb158 k1,1 k19 k210246
out 200913 211,7 k 5,95802451,7 Mb158 k1,1 k19 k210246
set 2009132211,7 k 5,85783701,7 Mb157 k1,1 k18 k210246
ago 200911 111,7 k 5,65803611,7 Mb156 k1,0 k18 k210245
jul 200911 111,7 k 5,45802781,7 Mb156 k1,0 k17 k210245
jun 200911 111,7 k 5,35801911,7 Mb156 k1,0 k17 k210243
mai 200911 111,7 k 5,15782841,7 Mb155 k1,0 k17 k210243
abr 200911 111,7 k 55783941,7 Mb155 k1,0 k17 k211243
mar 200911 111,7 k-14,85796521,7 Mb155 k1,0 k16 k211243
fev 2009111211,7 k-14,35881,1 k1,7 Mb160 k1,0 k16 k211243
jan 200910 211,7 k33,66104011,6 Mb166 k1,0 k12 k212243
dez 200810 111,6 k43,65948101,5 Mb154 k97111 k225243
nov 2008101211,5 k53,45346011,3 Mb130 k8069,1 k279238
out 20089 111,4 k123,34108261015 kb95 k6997,6 k269138
set 20089 111,0 k113,7363745671 kb62 k5126,1 k126138
ago 20089   667 4,438180493 kb44 k4145,6 k109 30
jul 20089   664 4,3382117489 kb44 k4145,4 k109 30
jun 2008911 662 4,238185485 kb44 k4045,3 k109 29
mai 20088   655 4,1384126480 kb44 k3955,1 k108 29
abr 20088   654 3,938553476 kb44 k3954,8 k108 29
mar 20088   653 3,838565468 kb44 k3954,4 k108 29
fev 20088   653 3,738597465 kb44 k3954,2 k108 29
jan 2008811 652 3,6385100452 kb44 k3953,3 k108 29
dez 2007711 652 3,438553439 kb44 k3952,3 k108 29
nov 20076 1 65223,438479436 kb44 k3952,2 k110 29
out 2007612160343,5398404407 kb40 k3932,0 k110 27
set 20075 1146493,7363846284 kb28 k3161,1 k79 14
ago 20075 1119934,324856288 kb7,8 k33448030 11
jul 2007511 108 2,82384142 kb3,5 k1343261 3
jun 20074   101 2,6235239 kb3,2 k982901 3
mai 20074   101 2,5235539 kb3,2 k982891 3
abr 2007412 10112,52355538 kb3,2 k982861 3
mar 20073   63 3,12301423 kb1,9 k162801 3
fev 20073 1 63 2,92232422 kb1,9 k62761 3
jan 2007311 5922,72249921 kb1,7 k62532 3
dez 20062   9 6,633965,5 kb33461281 3
nov 20062   9 5,931935,2 kb30661281 3
out 20062   9 5,631825,2 kb30561281 3
set 2006211 9 5,331375,2 kb29961281 3
ago 20061   7 5,9365 4,6 kb26461281 3
jul 20061   7 5,936514,6 kb26461281 3
jun 20061   6 6,7406164,5 kb25061281 3
mai 20061   2 121474 5,9 kb357 127 293
abr 20061   2 12147415,9 kb357 127 293
mar 20061   1 231442 4,0 kb228 127 293
fev 20061   1 23144274,0 kb228 127 293
jan 20061   1 16143294,0 kb227 127 291
dez 20051   1 732761,7 kb41 127  1
nov 20051        14       
out 20051        14       
set 20051        14       
ago 20051        14       
jul 20051        14       
jun 20051        14       
mai 20051        14       
abr 20051        14       
mar 20051        14       
fev 20051        14       
jan 20051        14       
dez 200411      114       
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
The following table ranks this project in relation to projects in other languages with 1000+ articles
jan 20145043352768153672542339150934118
out 201350323425682025721433690551434118
jul 201350404327752624735514490571776118
abr 201351256551776522569534591611799118
jan 201352445554756726464524391611797118
out 201252358048725927460514188621795118
jul 201250463741704530459494086601797118
abr 201252405252706630466494085611797118
jan 201251352420694229441534382611996118
out 201153415648684536546534580612096118
jul 201153434648664943563524379622097118
abr 201153341939653344448484179621995118
jan 201153354028712740743575182643189118
out 201057303632743533848615589684387118
jul 2010592052637665271174706493705083118
abr 2010634675597556291170676291674984118
jan 2010623058527159301071666189634891118
out 2009633961547156321068656088634789118
jul 200968407659716036967635589624789118
abr 200964498057685239962635484614288118
jan 200964595335664055950615383644189118
out 2008643658377124571533685987693593117
jul 20086331724577587474727570937147103117
abr 2008654276497662707075736992704598117
jan 2008613856506959666671696487714197117
out 2007692945416839636352695984703798117
jul 2007723454438355636373898691898594116
abr 2007753548458353606078898589887892116
jan 20078331554483445353729286100877088116
out 20069038654393534949959810097906786116
jul 200610338653796504545999910095856086116
abr 200610237533599474141789493100745636116
jan 2006884458349241363670898892695037110
out 200581        102     102
jul 200575        97     97
abr 200569        87     87
jan 200563        78     78
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100ediçõesbytes
 WikcionaristasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikcionaristas (usuários registrados)
A = Wikcionaristas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikcionaristas que editaram pelo menos dez vezes desde que chegaram
C = Wikcionaristas que contribuíram cinco vezes ou mais este mês
D = Wikcionaristas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  5  10  100  1000  1  3  5  10  25  1  3  5  10  25  100  250  5  10  100 
fev 2014105554221222 4     11411      
jan 201484444221443 42    156432  22 
dez 20136322222144214     83111  11 
nov 201384332221222 31    151111  11 
out 201364443222222 31    104411111  
set 201354433322331 42    1153321 11 
ago 201384433221541132    1022    11 
jul 20136333222 221 111   921111 21 
jun 201375322  221 211   31     11 
mai 201353211  331 53    51     11 
abr 201331111  541       3      221
mar 201386532  431 1     611    331
fev 20137321   551 2     821    11 
jan 201352211  761 31    411    22 
dez 201292221  652 2     632111 1  
nov 20124222   752 5111  71     11 
out 201291    332 31    631    22 
set 201253321  751 111   611    22 
ago 20125321111 662 611   742111 221
jul 2012764311  542 7222  165311  22 
jun 201263321  641 311   7331   1  
mai 201284431  653 5111  102     11 
abr 20128421   653 22    4111   22 
mar 20125321   444 31    721    11 
fev 20126421111 332 51    73221  11 
jan 201212875441 761 6431  964211 32 
jan 201484444221443 42    156432  22 
out 201364443222222 31    104411111  
jul 20136333222 221 111   921111 21 
abr 201331111  541       3      221
jan 201352211  761 31    411    22 
out 201291    332 31    631    22 
jul 2012764311  542 7222  165311  22 
abr 20128421   653 22    4111   22 
jan 201212875441 761 6431  964211 32 
out 201152221  5431211   611    11 
jul 20117432   431 311   811    11 
abr 201114995511 431 522   85442  11 
jan 201110442222 541 4331  821111 11 
out 20105555532     7431  127752  11 
jul 20105533211     2221  52222     
abr 20104311111           6531   22 
jan 2010522111  1   3     5111   1  
out 2009322111      11    3         
jul 20092111111 1         41     11 
abr 20093211111 11        211       
jan 20094321111 22        82211  11 
out 20083211111 22  42    953111    
jul 20081     11  1     3         
abr 20082     11        1         
jan 20081111   11  2     2         
out 2007222221  11  2     42222     
jul 200731111                      
abr 200732221            22111     
jan 200711111  11        11        
out 2006                1         
jul 2006                1         
abr 20061         1     1         
jan 200611        4     521       
out 2005                          
jul 2005                          
abr 2005                          
jan 2005                          

 

Distribuição de edições de artigos por wikcionaristas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikcionaristasEdições total
1154100.0%49,979100.0%
35938.3%49,83099.7%
104126.6%49,72799.5%
322616.9%49,44998.9%
1001610.4%48,89597.8%
316127.8%47,92895.9%
100095.8%46,48993.0%
316231.9%35,88571.8%
1000010.6%23,24446.5%

 

10 wikcionaristas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions
agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
SinanUC1 023,2442665,1002jul 13, 200724216,000721,9561
Faiq ƏsgərUC3 05,6442,20651dez 01, 2013883,4931,292--
Cekli829UC12 0342256041set 15, 2009162610-448-
123snake45UC13+130960191mai 11, 20132929027141
CommonsDelinkerUC19 0651113dez 07, 20072274----
Keete 37UC35...17171515fev 02, 2014257711
Borovi4okUC45+382--abr 19, 2012679----
Mulder1982UC151...11--fev 01, 201426----
2001:A98:C060:80:C0C:365A:2370:6A8DUC152...1111fev 21, 201461111
2001:738:4050:2:4CEB:3CBD:4EEA:2D35UC153...11--fev 25, 20142----

 

20 wikcionaristas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
InterwicketUC26,997jan 29, 20091855nov 08, 20101207
SinekUC42,190set 07, 20091634abr 22, 2013311
Hacı FaiqUC52,064out 01, 2013149out 31, 2013119
Hacı ƏsgərUC61,951nov 01, 2013118nov 30, 201389
Hacı FətullaUC71,793set 01, 2013179set 30, 2013150
Mirzə MəmmədquluUC81,547ago 01, 2013210ago 31, 2013180
Mirza HasanquluUC91,059jun 19, 2013253jul 31, 2013211
Lo XimiendoUC10590nov 22, 20101193nov 23, 201396
Remedios44UC11507fev 07, 20111116ago 25, 2011917
Sabri76UC14283jun 20, 20101348mar 31, 2013333
VagoUC15190jul 12, 20101326jul 07, 2011966
SafaviUC16185jun 05, 2012632jul 22, 2012585
AydınUC1794out 15, 20072327out 21, 20072321
YurdumquluUC1871jun 25, 2013247ago 22, 2013189
Baki66UC2061jan 06, 20072609set 24, 20072348
NKOziUC2159mar 31, 20111064dez 29, 2011791
MalafayaUC2258out 05, 20081971out 16, 2013134
MehridadUC2348mai 02, 2013301ago 05, 2013206
TaryelUC2433dez 25, 20072256dez 25, 20072256
Stern88888UC2533mar 14, 20101446mar 14, 20101446

 

usuários anônimos, ordenados por número de contribuições
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
80.222.151.206313
78.111.55.187106
200.172.66.11455
201.15.77.3635
80.222.146.22228
200.163.7.23027
177.6.103.17725
83.200.225.13823
201.25.79.10921
200.181.89.20921

No total 1.527 edições foram feitas por usuários anônimos, de um total de 82.333 edições ( 1e %)
  


19 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
HydrizBotUC17,503abr 23, 2012675ago 23, 2013188--
Luckas-botUC26,052mar 03, 20091822jan 27, 201431--
MalafayaBotUC34,299nov 18, 2011832jan 26, 201432--
KamikazeBotUC44,181out 18, 2011863mar 06, 2013358--
JAnDbotUC53,600mai 18, 20111016fev 28, 2014---
VolkovBotUC6972out 01, 20072341abr 05, 2013328--
AvocatoBotUC7631out 31, 2011850ago 25, 2013186--
WikitanvirBotUC8630abr 14, 20111050jan 19, 2012770--
ArthurBotUC9620nov 14, 20101201nov 12, 2011838--
YS-BotUC10509set 08, 2012537fev 25, 20142--
RoggBotUC11443fev 07, 20091846jun 12, 2011991--
SpaceBirdyBotUC12378jul 07, 20082061dez 30, 20091520--
MjbmrbotUC13356jan 18, 20111136mar 28, 20111067--
WarddrBOTUC14300jul 25, 2012582ago 18, 2013193--
RobotGMwiktUC15212jan 09, 20072606jun 06, 20082092--
CarsracBotUC16107out 16, 20091595mai 30, 2013273--
Makecat-botUC1723nov 10, 2012474abr 05, 2013328--
GhalyBotUC182jan 06, 2013417jan 06, 2013417--
MelancholieBotUC191out 07, 20091604out 07, 20091604--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110JpgSvg
fev 201417 k57924951,1 k31,6 k      238881
jan 201416 k57124951,1 k31,6 k      285281
dez 201314 k55824951,1 k31,5 k      222581
nov 201313 k55524951,1 k31,4 k      250181
out 201312 k54424951,1 k31,4 k      416181
set 201310 k53724951,1 k31,3 k      400581
ago 20138,6 k51024951,0 k31,2 k      196281
jul 20137,4 k50424851,0 k31,2 k      181671
jun 20136,6 k49624751,0 k31,2 k      13761
mai 20136,5 k49524751,0 k31,2 k      5461
abr 20136,5 k49124751,0 k31,2 k      2861
mar 20136,5 k48724751,0 k31,2 k      14661
fev 20136,5 k47624751,0 k31,2 k      2761
jan 20136,5 k46624751,0 k31,2 k      5461
dez 20126,5 k46024751,0 k31,2 k      5361
nov 20126,4 k45224751,0 k31,2 k      2961
out 20126,4 k44924751,0 k31,2 k      1361
set 20126,4 k44524751,0 k31,2 k      6661
ago 20126,4 k43824751,0 k31,2 k      30061
jul 20126,4 k42724751,0 k31,2 k      20761
jun 20126,2 k42124751,0 k31,2 k      7161
mai 20126,2 k40624751,0 k31,2 k      7561
abr 20126,2 k39524751,0 k21,2 k      3461
mar 20126,2 k38324751,0 k21,2 k      2261
fev 20126,2 k37824751,0 k21,2 k      78261
jan 20126,0 k36224751,0 k21,2 k      141461
dez 20115,7 k354247596221,1 k      123561
nov 20115,5 k34924759352877      34661
out 20115,5 k33224759282854      6061
set 20115,5 k32324759282853      5361
ago 20115,5 k31624759252853      2661
jul 20115,4 k30924759242825      5461
jun 20115,4 k29624759222825      3261
mai 20115,4 k29224759212822      4961
abr 20115,4 k27724759202771      99161
mar 20115,1 k26424759092674      150461
fev 20114,7 k26124758742655      207261
jan 20114,1 k24723658342635      127551
dez 20103,5 k23923358202624      151021
nov 20103,0 k23623257572458      142911
out 20102,4 k23023246672421      143611
set 20102,1 k22323146202400      671 1
ago 20102,0 k21622 46172399      1046  
jul 20101,9 k19722 44812399      375  
jun 20101,9 k19522 44362399      255  
mai 20101,9 k17222 44342399      325  
abr 20101,9 k16922 44342399      343  
mar 20101,9 k16122 44342399      252  
fev 20101,9 k15622 44342399      189  
jan 20101,9 k15422 44342399      170  
dez 20091,9 k13722 44332399      226  
nov 20091,9 k13622 44322399      242  
out 20091,9 k13222 44322399      238  
set 20091,8 k12922 44322399      370  
ago 20091,8 k11922 44312399      359  
jul 20091,8 k11922 44312399      269  
jun 20091,8 k11721 44312399      185  
mai 20091,8 k11521 44302399      263  
abr 20091,8 k11321 44302398      377  
mar 20091,8 k10421 44302398      562  
fev 20091,8 k9619 44302398      812  
jan 20091,8 k8719 44262398      294  
dez 20081,7 k8419 44182373      718  
nov 20081,6 k8219 43522212      484  
out 20081,4 k6419 12882136      785  
set 20081,1 k5119 12052107      696  
ago 20087165017 1190291      1  
jul 20087135017 1190291      2  
jun 20087104816 1190291      28  
mai 20087024316 1188291      2  
abr 20087014316 1188291      2  
mar 20087004216 1188291      1  
fev 20087004016 1188291      1  
jan 20087004016 1188291      11  
dez 20076993816 1188290      35  
nov 20076993616 1188289      64  
out 20076533516 1186287      329  
set 20074993116 1179269      808  
ago 20072292915 1157220      530  
jul 20071172514 111322      30  
jun 20071092514 111322         
mai 20071092514 111322         
abr 20071082514 111322      50  
mar 2007681714 111022      5  
fev 2007661614 111022      6  
jan 2007621614 110922      52  
dez 2006151513 110822      1  
nov 2006141513 110722         
out 2006141513 110722         
set 2006141313 110722      7  
ago 2006101212 19612         
jul 2006101212 19612         
jun 200691112 19512      3  
mai 200651110 18011         
abr 200651110 18011      1  
mar 200641110 18011         
fev 200641110 18011      6  
jan 200621010 18011      4  
dez 2005255 1791          
nov 2005111  78           
out 2005111  78           
set 2005111  78           
ago 2005111  78           
jul 2005111  78           
jun 2005111  78           
mai 2005111  78           
abr 2005111  78           
mar 20051 1  78           
fev 20051 1  78           
jan 20051 1  78           
dez 20041 1  78           

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

dez 2005: 1 1 main Page

jan 2006: 1 1 Ana Səhifə

fev 2006: 1 2 Main Page , 2 2 Ana Səhifə , 3 1 ana Səhifə

abr 2006: 1 1 Azərbaycan dili

jun 2006: 1 1 qartal

set 2006: 1 1 آتا

dez 2006: 1 1 kiçik

jan 2007: 1 1 arzu

fev 2007: 1 1 əl telefonu

mar 2007: 1 1 cənub

abr 2007: 1 1 səyahət

jul 2007: 1 1 armud

ago 2007: 1 2 türkcə , 2 1 köpək

set 2007: 1 2 yaşamaq , 2 1 april

out 2007: 1 2 ülgü , 2 2 görüş , 3 2 qorumaq , 4 1 gül

nov 2007: 1 1 səhra

dez 2007: 1 1 boşqab

jan 2008: 1 1 Moskva

fev 2008: 1 1 türkcə

mar 2008: 1 1 Ana Səhifə

abr 2008: 1 1 виноград

mai 2008: 1 1 August

jun 2008: 1 1 krım tatarca

jul 2008: 1 1 جالگاه

ago 2008: 1 1 Wolf

set 2008: 1 2 afrikaans , 2 2 Afrika dili , 3 2 Qırım Tatarca , 4 2 Ana Səhifə , 5 1 od

out 2008: 1 2 мак , 2 2 ana , 3 1 teatr

nov 2008: 1 2 patlıcan , 2 2 Finlandiya , 3 2 alt , 4 2 Məkkə , 5 2 nənə , 6 2 nar , 7 2 armud , 8 2 Ana Səhifə , 9 1 qovaq

dez 2008: 1 2 ürək , 2 1 fişəng

jan 2009: 1 2 lüğət , 2 2 zər , 3 2 qaynar , 4 1 гусь

fev 2009: 1 2 yarasa , 2 2 Kullanıcı:Mardetanha , 3 1 hörümçək

mar 2009: 1 1 döngə

abr 2009: 1 2 august , 2 1 Азербайджанский язык

mai 2009: 1 3 qozu , 2 3 qoy

jun 2009: 1 2 suiti

jul 2009: 1 2 Arbeit , 2 2 Katze , 3 1 katze

ago 2009: 1 2 птица , 2 2 bayraq , 3 1 mənzərə

set 2009: 1 2 cekcə , 2 2 Cek dili , 3 2 self control , 4 2 page

out 2009: 1 2 həftə , 2 1 qapaq

nov 2009: 1 1 qapaq

dez 2009: 1 2 qovun , 2 2 banan , 3 2 Ana Səhifə , 4 1 həftə

jan 2010: 1 2 kəfgir , 2 2 pendir , 3 1 süzgəc

fev 2010: 1 1 page

mar 2010: 1 2 iribaş , 2 2 Kaulquappe

abr 2010: 1 2 skripka , 2 2 saqqal , 3 1 iribaş

mai 2010: 1 2 Ana Səhifə , 2 1 həftə

jun 2010: 1 2 Ellenbogen , 2 2 Ellbogen , 3 2 elbow

jul 2010: 1 2 teleskop , 2 2 hamam , 3 2 tiraj , 4 2 Opponent , 5 2 Cek dili , 6 2 qaşıq , 7 2 günəş , 8 2 Azərbaycan dili

ago 2010: 1 4 evlənmək , 2 3 çalma , 3 3 qızılquş , 4 3 lil , 5 3 öskürək , 6 3 ağartmaq , 7 3 yaralanmamaq , 8 3 konj , 9 3 çiyələk , 10 3 gecə , 11 3 heyva , 12 3 təsirlik , 13 3 ayı , 14 2 cover , 15 2 paxla , 16 2 palto , 17 2 menecer , 18 2 laboratoriya , 19 2 zərf , 20 2 gec , 21 2 kabel , 22 2 küknar , 23 2 yumaq , 24 2 katır , 25 2 qatır

set 2010: 1 2 brom , 2 2 шурин , 3 2 деверь , 4 2 qayın , 5 2 fıstıq , 6 2 золото , 7 2 altun , 8 2 sink , 9 2 mis , 10 2 dövri cədvəl , 11 2 arsen , 12 2 мышьяк , 13 2 малахит , 14 2 meruňka , 15 2 кајсија , 16 2 кайсия , 17 2 marelica , 18 2 morela

out 2010: 1 4 sumaq , 2 3 türk , 3 3 yunan , 4 3 zəfər , 5 3 kürü , 6 3 dolma , 7 3 qırxayaq , 8 3 düymələmək , 9 3 yenot , 10 3 γαρύφαλλο , 11 3 nightingale , 12 3 süngü , 13 3 qəssab , 14 3 ekmek , 15 3 mesafe , 16 3 talaşa , 17 3 qonşu , 18 3 ayı , 19 2 верный , 20 2 alman , 21 2 помидор , 22 2 огурец , 23 2 француженка , 24 2 гречанка , 25 2 fransız

nov 2010: 1 3 nəticə , 2 3 yengeç , 3 3 maye , 4 3 ləngitmək , 5 3 yarpaq , 6 3 avokado , 7 3 kəpənək , 8 3 qələbə , 9 3 zoğ , 10 3 лягушка , 11 3 xərçəng , 12 3 üzüm , 13 2 çömçəquyruq , 14 2 otobüslerde , 15 2 domingo , 16 2 ორშაბათი , 17 2 siçovul , 18 2 salı , 19 2 pazartesi , 20 2 şahmatçı , 21 2 vücut , 22 2 safran , 23 2 xəzinə , 24 2 xəstələnmək , 25 2 heykeltıraş

dez 2010: 1 3 təsdiqləmək , 2 2 πάπια , 3 2 Golf , 4 2 valyuta , 5 2 ördəkburun , 6 2 körfəz , 7 2 nərd , 8 2 döymə , 9 2 əzələ , 10 2 solaxay , 11 2 yelkən , 12 2 zürafa , 13 2 nauka , 14 2 tamaşaçı , 15 2 şənbə , 16 2 octopus , 17 2 ördek , 18 2 Aubergine , 19 2 tərəvəz , 20 2 Affe , 21 2 ördək , 22 2 Wolf , 23 1 черепахи

jan 2011: 1 3 üstəgəl , 2 2 vegetasiya , 3 2 diod , 4 2 qovluq , 5 2 söğüt , 6 2 sfenks , 7 2 eyelash , 8 2 tavsiye , 9 2 видишь , 10 2 sevinmək , 11 2 çovğun , 12 2 strategiya , 13 2 velosiped , 14 2 abide , 15 2 sing , 16 2 speak , 17 1 lens

fev 2011: 1 3 barometr , 2 3 balıqçı , 3 3 yaltaqlıq , 4 3 mikrocərrahiyyə , 5 3 səkkiz , 6 3 əl telefonu , 7 3 Ana Səhifə , 8 2 xardal , 9 2 ilə , 10 2 hörük , 11 2 boyun , 12 2 çünki , 13 2 diktor , 14 2 yaltaqlanmaq , 15 2 yaltaq , 16 2 güzəşt , 17 2 külüng , 18 2 zənci , 19 2 qübbə , 20 2 incir , 21 2 on iki , 22 2 on bir , 23 2 dwadzieścia cztery , 24 2 dwadzieścia trzy , 25 2 hər

mar 2011: 1 3 yastıq , 2 3 şaquli , 3 3 üfüqi , 4 3 erkək , 5 3 maraqlı , 6 3 lava , 7 3 yaba , 8 3 hinduşka , 9 3 ovsunlamaq , 10 3 sześćdziesiąt pięć , 11 3 gəmi , 12 3 dekabr , 13 3 noyabr , 14 3 oktyabr , 15 3 sentyabr , 16 3 avqust , 17 2 pääsuke , 18 2 Fərat , 19 2 Dəclə , 20 2 itkin , 21 2 növbə , 22 2 ünsiyyət , 23 2 sərhədçi , 24 2 sahib , 25 2 yiyə

abr 2011: 1 3 cüyür , 2 3 qaratoyuq , 3 3 buket , 4 3 anlamaq , 5 3 ayçiçeği , 6 2 oiseau , 7 2 riyaziyyat , 8 2 eyvan , 9 2 tükətmək , 10 2 xəsis , 11 2 xəta , 12 2 xasiyyət , 13 2 təhqiqat , 14 2 dərs , 15 2 məşğələ , 16 2 təəccüb , 17 2 marş , 18 2 təxmin , 19 2 təhqiq , 20 2 təhdid , 21 2 təhqir , 22 2 tarif , 23 2 tərif , 24 2 izah , 25 2 təfsir

mai 2011: 1 3 Xorvatiya

jun 2011: 1 2 göbələk , 2 2 tərcümə , 3 1 claymore

jul 2011: 1 2 Serbiya , 2 2 Slovakiya , 3 1 çobanyastığı

ago 2011: 1 3 hədəf , 2 1 patlamak

set 2011: 1 2 γκέισα , 2 2 əqrəb , 3 1 kuyu

out 2011: 1 1 oyar

nov 2011: 1 2 maçã , 2 2 renk , 3 2 elma , 4 2 Pluton , 5 2 merkez , 6 2 manzana , 7 2 ailə , 8 2 alma , 9 1 mouse

dez 2011: 1 2 Misir , 2 2 tartaruga , 3 2 uğur , 4 2 krowa , 5 2 ποδήλατο , 6 2 geyinmək , 7 2 hazırlaşmaq , 8 2 vektor , 9 2 mizrab , 10 2 qarğıdalı , 11 2 mühərrik , 12 2 tumurcuq , 13 2 пчела , 14 2 şahmat , 15 1 marzo

jan 2012: 1 3 kenquru , 2 3 osminoq , 3 3 dinozavr , 4 3 arvad , 5 3 gəlin , 6 3 Lixtenşteyn , 7 3 böyürtkən , 8 2 xloroform , 9 2 platinum , 10 2 chloroform , 11 2 chemistry , 12 2 akustik , 13 2 velosipedçi , 14 2 idmançı , 15 2 təyyarəçi , 16 2 dəmir , 17 2 Qana , 18 2 Bosniya və Hersoqovina , 19 2 oğul , 20 2 növbə , 21 2 koramal , 22 2 bibioğlu , 23 2 bibiqızı , 24 2 kitabxana , 25 2 tüstü

fev 2012: 1 2 Əskişəhər , 2 2 səhabə , 3 2 həvari , 4 2 mezarlık , 5 2 rəqəm , 6 2 nömrə , 7 1 Naxçıvan

mar 2012: 1 2 Azerbaijan , 2 1 choose

abr 2012: 1 2 arx , 2 1 donna

mai 2012: 1 2 ölkə , 2 1 panno

jun 2012: 1 2 aigua , 2 1 Aserbajdsjan

jul 2012: 1 3 body , 2 2 מים , 3 2 para , 4 2 bed , 5 2 ur , 6 2 Allah , 7 1 böcek

ago 2012: 1 2 Afghanistan , 2 2 əl , 3 1 miercuri

set 2012: 1 1 düğün

out 2012: 1 1 yumruq

nov 2012: 1 2 Versicherung , 2 2 owl , 3 2 Apfel , 4 1 Biləsuvar

dez 2012: 1 2 Cibuti , 2 1 çırpı

jan 2013: 1 2 Əlcəzair , 2 2 kəpənək , 3 1 Yugoslavya

fev 2013: 1 2 yardım , 2 1 xaç

mar 2013: 1 3 dırmıq , 2 3 Xocalı , 3 2 masturbasiya , 4 2 bambuq , 5 2 koreyalı , 6 1 մաստուրբացիա

abr 2013: 1 1 Balakən

mai 2013: 1 1 artmaq

jun 2013: 1 2 rojo , 2 2 axtarmaq , 3 1 hacer

jul 2013: 1 2 ti , 2 2 aimer , 3 2 Zaragoza , 4 2 копчёный , 5 2 fem , 6 2 اندک , 7 2 الان , 8 2 اسم , 9 2 biçmək , 10 2 sombra , 11 2 səbət , 12 2 копьё , 13 2 корзина , 14 2 aqua , 15 2 kingdom , 16 2 krallıq , 17 2 кормить , 18 2 лаваш , 19 2 косой , 20 2 косолапый , 21 2 костёр , 22 2 Stadt , 23 2 vedere , 24 2 vendere , 25 2 venire

ago 2013: 1 2 helado , 2 2 batir , 3 2 mezclar , 4 2 reír , 5 2 moreno , 6 2 кличка , 7 2 suivre , 8 2 başsağlığı , 9 2 qamçı , 10 2 careful , 11 2 birləşmək , 12 2 gün , 13 2 şam , 14 2 candle , 15 2 but , 16 2 Apia , 17 2 Samoa , 18 2 козёл , 19 2 enmək , 20 2 peigne , 21 2 öö , 22 2 yığmaq , 23 2 oğul , 24 2 Braziliya , 25 2 ya

set 2013: 1 3 yırtmaq , 2 3 yanmaq , 3 3 qısa , 4 3 qırıcı , 5 3 acı , 6 3 pəncərə , 7 3 göz , 8 3 qız , 9 3 qara , 10 2 yorğun , 11 2 Dunay , 12 2 qul , 13 2 parıltı , 14 2 balqabaq , 15 2 olmaq , 16 2 dağ , 17 2 bilet , 18 2 vicdansız , 19 2 daha , 20 2 hamilə , 21 2 yordam , 22 2 qiymət , 23 2 window , 24 2 исступлённый , 25 2 истерзать

out 2013: 1 3 ღვინო , 2 3 aldatmaq , 3 2 basdırmaq , 4 2 Maldiv adaları , 5 2 جزر المالديف , 6 2 Qərbi Sahara , 7 2 Batı Sahra , 8 2 Sahara Occidental , 9 2 Алабама , 10 2 planet , 11 2 Nasáu , 12 2 Nassau , 13 2 Нассау , 14 2 махуэ , 15 2 гъэ , 16 2 адэ , 17 2 бзэ , 18 2 пхъэгулъ , 19 2 bura , 20 2 suçlu , 21 2 изменить , 22 2 измениться , 23 2 изменник , 24 2 tutmak , 25 2 rüşvet

nov 2013: 1 2 zəhər , 2 2 yükləmək , 3 2 È un libro , 4 2 звать , 5 2 Dili , 6 2 Doha , 7 2 çağırmaq , 8 2 móðir , 9 2 mor , 10 2 sındırmaq , 11 2 söymək , 12 2 derramar , 13 2 o'ttiz , 14 2 sakkiz , 15 2 yetti , 16 2 besh , 17 2 uch , 18 2 ikki , 19 2 Solomon adaları , 20 2 Solomon Islands , 21 2 məqsəd , 22 2 Valletta , 23 2 qapıçı , 24 2 meyvə , 25 2 düzənlik

dez 2013: 1 2 Məhəmməd , 2 2 Yeni iliniz mübarək! , 3 2 qayə , 4 2 занимательный , 5 2 заниматься , 6 2 заноза , 7 2 заносчивый , 8 2 занятие , 9 2 заочный , 10 2 zabit , 11 2 yük , 12 2 yalan , 13 2 заунывный , 14 2 işğal etmək , 15 2 миндаль , 16 2 şəkər , 17 2 zarafat , 18 2 əməl , 19 2 boran , 20 2 cərimə , 21 2 müdafiəçi , 22 2 ərizə , 23 2 lemon , 24 2 bite , 25 2 Qambiya

jan 2014: 1 3 məna , 2 2 Ərəbistan dənizi , 3 2 bükmək , 4 2 təbiət , 5 2 peyk , 6 2 süni , 7 2 qanacaq , 8 2 hərf , 9 2 əski , 10 2 old , 11 2 əhəmiyyətli , 12 2 əhəmiyyətsiz , 13 2 hürriyyət , 14 2 önemsiz , 15 2 azadlıq , 16 2 etkisiz , 17 2 etkili , 18 2 güncel , 19 2 özgürlük , 20 2 səhv , 21 2 buğ , 22 2 buxar , 23 2 örtülü , 24 2 tədarük , 25 2 tədarük etmək

fev 2014: 1 3 udmaq , 2 2 Кишинёв , 3 2 Chișinău , 4 2 cüt , 5 2 Birləşmiş Ərəb Əmirlikləri , 6 2 cavab , 7 2 cavab vermək , 8 2 parlaq , 9 2 cəllad , 10 2 vergi , 11 2 rapu , 12 2 testa , 13 2 giornale , 14 2 frutto , 15 2 egli , 16 2 dente , 17 2 bambina , 18 2 bambino , 19 2 cambra , 20 2 бал , 21 2 siekiera , 22 2 нтӏэ , 23 1 Irlande

Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Domingo, 30 de março 2014 19:30

Dump file azwiktionary-20140305-pages-meta-history.xml.7z (full dump), size 7.5 Mb as 7z -> 241 Mb
Dump processed till Feb 28, 2014, on server stat1002, ready at Fri-14/03/2014-14:36 after 1 min, 24 sec.

Versão do script:2.6
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.