Estatísticas da Wikcionário bielorrusso

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist

Metrics have been collected from a full archive dump, which contains all revisions of every article, meta data and raw content.
See also metrics definitions


 
Monthly counts & Quarterly rankings: fevereiro 2014
 
DataWikcionaristasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
fev 2014    0%   +21%0%0%0%0% 0%0%
jan 2014    0%   -97%0%0%0%+1% 0%0%
dez 2013    +1%   +2544%+4%+2%0%+17% 0%0%
nov 2013    0%   -33%0%0%0%+1% +2%0%
out 2013    0%   +381%0%0%0%+2% +5%0%
set 2013    0%   -97%0%0%+1%0% 0%0%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
fev 201418   3,1 k 6,6410694,3 Mb224 k9,7 k44 k1544176
jan 201418 1 3,1 k 6,6410574,3 Mb224 k9,7 k44 k1544176
dez 201318 1 3,1 k16,64101,8 k4,3 Mb224 k9,7 k43 k1544176
nov 201318   3,1 k 6,1408684,1 Mb220 k9,6 k37 k1544176
out 201318   3,1 k 6,14071014,1 Mb220 k9,6 k37 k1543176
set 201318 1 3,1 k 6407214,1 Mb219 k9,6 k36 k1441176
ago 201318 113,0 k136,14066374,1 Mb218 k9,5 k36 k1341176
jul 201318   2,6 k 6,84082103,6 Mb190 k8,6 k34 k1340176
jun 20131811 2,6 k16,74071853,6 Mb190 k8,6 k34 k1338176
mai 201317 1 2,6 k 6,74083443,5 Mb189 k8,6 k34 k1338176
abr 201317 2 2,6 k 6,64071673,5 Mb188 k8,5 k34 k1320173
mar 201317 1 2,6 k16,54041923,5 Mb186 k8,3 k33 k1319173
fev 201317   2,6 k 6,54041813,4 Mb183 k8,2 k33 k1314173
jan 201317   2,6 k 6,54043633,4 Mb184 k8,2 k33 k1314173
dez 201217 1 2,6 k 6,34031993,4 Mb183 k8,2 k32 k1210173
nov 201217   2,5 k 6,34031213,4 Mb182 k8,1 k32 k1210173
out 201217   2,5 k 6,24023993,4 Mb182 k8,1 k32 k1010173
set 201217 1 2,5 k16,14014483,4 Mb182 k8,1 k31 k98173
ago 201217   2,5 k 63963713,3 Mb177 k8,0 k31 k77173
jul 201217 112,5 k35,83963413,3 Mb176 k8,0 k30 k77173
jun 201217 1 2,4 k 63992723,2 Mb171 k7,8 k30 k67173
mai 2012171212,4 k45,93984953,2 Mb169 k7,7 k29 k36173
abr 201216 1 2,3 k15,93992183,0 Mb162 k7,5 k29 k36172
mar 201216 1 2,2 k 5,93942083,0 Mb158 k7,4 k28 k36171
fev 20121611 2,2 k15,83922,3 k3,0 Mb157 k7,3 k28 k36170
jan 201215 1 2,2 k24,93772622,9 Mb145 k5,1 k27 k26170
dez 201115   2,1 k 4,93754542,8 Mb140 k4,9 k27 k22170
nov 201115 1 2,1 k14,73752662,8 Mb140 k4,9 k26 k11170
out 201115 1 2,1 k14,63749772,8 Mb139 k4,8 k26 k11170
set 201115   2,1 k 4,23731132,7 Mb137 k4,8 k24 k11170
ago 201115 2 2,1 k24,23732562,7 Mb137 k4,8 k24 k11170
jul 201115   2,0 k 4,1371972,6 Mb132 k4,5 k24 k11162
jun 201115 1 2,0 k14,13693402,6 Mb132 k4,3 k23 k11162
mai 201115 1 2,0 k243692552,6 Mb130 k4,3 k23 k11161
abr 201115   1,9 k 43681702,5 Mb124 k4,2 k22 k11161
mar 201115 1 1,9 k13,93681902,5 Mb124 k4,2 k22 k11161
fev 20111511 1,9 k 3,93691952,4 Mb123 k4,2 k22 k11161
jan 201114 111,9 k93,83666852,4 Mb121 k4,2 k21 k11160
dez 201014 1 1,6 k143722532,1 Mb105 k3,7 k19 k11159
nov 201014 2 1,6 k33,93721792,1 Mb104 k3,7 k19 k11159
out 201014 221,5 k343783912,0 Mb99 k3,6 k19 k11159
set 201014 221,4 k54,13775191,8 Mb92 k3,3 k17 k11158
ago 201014 211,3 k24,13822951,6 Mb82 k3,2 k16 k11158
jul 201014 321,2 k44,23844371,6 Mb78 k3,1 k15 k11158
jun 2010141621,1 k64,23825391,4 Mb70 k2,9 k14 k11157
mai 201013 2289464,43755551,2 Mb57 k2,7 k12 k 1154
abr 201013132693184,93661,4 k913 kb43 k2,2 k9,4 k 1154
mar 201012 2 167 1217923119 kb4,3 k3712,3 k11153
fev 20101211 162 12,216225109 kb3,7 k3482,3 k11153
jan 201011 1 160 12,215717106 kb3,5 k3342,3 k11153
dez 20091112 160 12,115740106 kb3,5 k3342,2 k11153
nov 200910 1 160 11,91572395 kb3,5 k3332,2 k11141
out 200910 1 160 11,71576495 kb3,5 k3332,2 k11141
set 200910 1 159 11,41586894 kb3,5 k3332,1 k11141
ago 200910 1 157 11,11603693 kb3,5 k3332,0 k11141
jul 200910 1 157 10,91601693 kb3,5 k3332,0 k11141
jun 200910 1 157 10,81604992 kb3,5 k3332,0 k11141
mai 200910 1 157 10,51604392 kb3,5 k3332,0 k11140
abr 20091012 157 10,21606492 kb3,5 k3332,0 k11140
mar 20099 3 156 9,91435184 kb3,0 k3202,0 k11140
fev 20099111152 9,813610379 kb2,7 k2861,9 k11140
jan 20098   152 9,11361175 kb2,7 k2861,6 k11140
dez 20088   151 9,1136475 kb2,7 k2831,6 k11140
nov 20088   151 9,11361974 kb2,7 k2831,6 k11140
out 20088   151 8,9136274 kb2,7 k2831,6 k11140
set 20088   151 8,9136674 kb2,7 k2821,6 k11140
ago 20088   151 8,91361974 kb2,7 k2821,6 k11140
jul 20088   151 8,8136673 kb2,7 k2821,5 k11140
jun 20088 1 151 8,71362973 kb2,7 k2821,5 k11140
mai 20088 1 147 8,81396372 kb2,7 k2821,5 k11140
abr 20088   147 8,31391369 kb2,7 k2811,3 k11140
mar 2008811 14718,213912267 kb2,7 k2811,1 k11140
fev 20087   105 10,41591258 kb2,1 k2341,1 k1199
jan 20087   105 10,31592258 kb2,1 k2341,1 k1199
dez 20077   105 101593157 kb2,1 k2341,0 k1199
nov 20077   105 9,8159156 kb2,1 k2329891199
out 20077   105 9,71591056 kb2,1 k2329881199
set 20077   105 9,6158256 kb2,1 k2319751199
ago 20077   105 9,6158356 kb2,1 k2319731199
jul 20077   105 9,61583356 kb2,1 k2319661199
jun 20077   106 9,2166558 kb2,3 k2639301198
mai 20077   106 9,21664358 kb2,3 k2639241198
abr 2007723 106 8,716612957 kb2,3 k2638711198
mar 2007511 99 8,11263745 kb1,7 k48921 197
fev 20074   98 7,81255045 kb1,7 k48897 197
jan 20074   95 7,51285443 kb1,6 k48835 197
dez 20064   96 6,81271542 kb1,6 k48793 197
nov 20064   96 6,71271542 kb1,6 k48781 197
out 20064   96 6,51267241 kb1,6 k48766 197
set 20064   95 5,81165339 kb1,5 k40736 197
ago 20064   95 5,3116238 kb1,5 k40629 197
jul 20064   93 5,4116337 kb1,4 k40618 197
jun 20064   9215,41178237 kb1,4 k40616 197
mai 2006411 6826,11506829 kb1,4 k4097 197
abr 20063   14 24,8384326 kb8284093 197
mar 20063   12 28,7416 25 kb7663990 197
fev 2006322112 28,741631825 kb7663990 197
jan 20061   2 13726 5,3 kb2811164   
dez 20051   2 1372655,3 kb2811164   
nov 20051   2 10,5694 3,8 kb275135   
out 20051   2 10,5694 3,8 kb275135   
set 20051   2 10,5694183,8 kb275135   
ago 200511  1 3983193 12 6   
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
The following table ranks this project in relation to projects in other languages with 1000+ articles
jan 2014754373499158442597737383819674118
out 2013754277469160492377747282839774118
jul 2013744080519064412480757582839873118
abr 2013743556519065422379757381829879118
jan 2013744482549067432282757380829783118
out 2012723580488859482276737279799786118
jul 20127246754786504922757171807810090118
abr 20127340715286624723787272817610791118
jan 20127335674984515524777073857510790118
out 201173417548826657236170708272108105118
jul 201172438048816664248069708171108104118
abr 201172347845806267237871708171106102118
jan 201171356747793565245369707871107101118
out 201070356746804564236871707972106101118
jul 201068445648844362237273738074104100118
abr 201069415644872685854677838381104100118
jan 2010703087761005981811049910310296100100118
out 200974398377975681818898101100949999118
jul 200972408779966079791029710199949898118
abr 20096943677796527676879710197929796118
jan 2009735979429656757593969997909697118
out 20087236734294607575100969996859497117
jul 20086931724591587474100959895829295117
abr 2008684276498962707087929693819293117
jan 2008704174508959666683909491809192117
out 2007664074508762636389899390799093117
jul 2007634068438455636379859187788789116
abr 2007592236458259606068848985788188116
jan 2007764679448064535383848890697984116
out 2006703865437353494967758386637280116
jul 2006673865376650454586737885586580116
abr 2006703753358347414172697782845678116
jan 2006944458349041363698858590555080110
out 2005893249268735303074828187634674102
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100ediçõesbytes
 WikcionaristasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikcionaristas (usuários registrados)
A = Wikcionaristas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikcionaristas que editaram pelo menos dez vezes desde que chegaram
C = Wikcionaristas que contribuíram cinco vezes ou mais este mês
D = Wikcionaristas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  5  10  100  1000  1  3  5  10  5  10  1  3  5  10  25  100  250  5  10  100 
fev 2014     22  1     71        
jan 20141111  22  1     6211   11 
dez 201321111 21112     621       
nov 2013     11  1     101        
out 20131    11  1     411       
set 20133111      21    63211     
ago 20131111111221 1     62111  11 
jul 20132    221       52111  11 
jun 201311111 111 1     3         
mai 2013721   111       5         
abr 2013222   111 1     511    111
mar 201311111 221 1   1 411    221
fev 2013     44  1     711       
jan 20131    621       2      11 
dez 2012211   541 1   1163     1  
nov 2012     33        2      11 
out 2012     321 1     51     111
set 201211111 531     1 311    11 
ago 201211   331 3     722    11 
jul 2012111111 421       621    11 
jun 20123111  541       311    11 
mai 2012322211 551 3     75        
abr 201211111 54  11    63221  11 
mar 20124211  44  2     621       
fev 201231111 44215     9432   1  
jan 201211111 631       4211   211
jan 20141111  22  1     6211   11 
out 20131    11  1     411       
jul 20132    221       52111  11 
abr 2013222   111 1     511    111
jan 20131    621       2      11 
out 2012     321 1     51     111
jul 2012111111 421       621    11 
abr 201211111 54  11    63221  11 
jan 201211111 631       4211   211
out 20113111  441 3     51     11 
jul 201111   33  1     411    11 
abr 20112    321       3211   11 
jan 20112111111431       52111  11 
out 20104322221          62221  11 
jul 20104332221          21111     
abr 20103333222    3322  65321111  
jan 20101111      1     2111      
out 200921111           3         
jul 20091111      2     3         
abr 200932222     2     4332211   
jan 2009     1         211    11 
out 20081        1     522       
jul 2008               1         
abr 2008     11        1         
jan 2008     11  2     3         
out 2007     1   3     4         
jul 20071    11        1      1  
abr 200763322 11  222   42222     
jan 2007     11                  
out 2006     11        21        
jul 20061              1         
abr 200611       1               
jan 2006         3     6211      
out 2005                         

 

Distribuição de edições de artigos por wikcionaristas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikcionaristasEdições total
165100.0%7,248100.0%
32843.1%7,18699.1%
101929.2%7,13598.4%
321116.9%7,00996.7%
10069.2%6,68892.3%
31623.1%6,16285.0%
100023.1%6,16285.0%

 

20 wikcionaristas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
Al SilonovUC13,159mar 28, 20091797jan 14, 201444
InterwicketUC23,003fev 01, 20091852nov 08, 20101207
BooxterUC3128fev 01, 20062948fev 03, 20062946
ХомелкаUC4111fev 24, 2012734mai 11, 2013292
VesailokUC5100mar 28, 20091797mai 09, 2013294
PradslavaUC695mar 15, 20082175mar 21, 20082169
Ellis NovakUC780mai 24, 2013279jun 21, 2013251
KubaroUC864mai 04, 20062856mai 16, 20062844
MaximLitvinUC945abr 22, 20072503jul 30, 20072404
MienskiUC1037abr 23, 20072502abr 24, 20072501
CarsracUC1124dez 04, 20091546dez 04, 20091546
YellowUC1220jun 20, 20101348jun 21, 20101347
ZuiarraUC1320ago 28, 2011914jul 11, 2013231
DryhvaUC1415mar 28, 20072528mar 30, 20072526
MalafayaUC1514out 07, 20081969jun 10, 20101358
IlyankouUC1612fev 21, 20111102fev 21, 20111102
Serge GorlawUC1711ago 16, 2011926ago 16, 2011926
AdashUC1810dez 21, 20091529ago 31, 20101276
InnvUC199mai 03, 20082126mai 08, 20082121
AstapUC207abr 23, 20072502abr 24, 20072501

 

usuários anônimos, ordenados por número de contribuições
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
203.90.16.9512
80.185.244.15210

No total 137 edições foram feitas por usuários anônimos, de um total de 20559 edições ( 0e %)
  


18 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
Luckas-botUC13,340set 04, 20101272jan 27, 201431--
HydrizBotUC23,103abr 24, 2012674ago 22, 2013189--
ХомоБотUC31,970fev 24, 2012734fev 27, 2012731--
KamikazeBotUC41,408out 18, 2011863mar 07, 2013357--
JAnDbotUC5973mai 18, 20111016fev 28, 2014---
ArthurBotUC6548jan 04, 20111150nov 12, 2011838--
RobotGMwiktUC7505jun 23, 20062806mai 30, 20082099--
VolkovBotUC8297jul 13, 20072421mar 23, 2013341--
WikitanvirBotUC9257abr 16, 20111048jan 19, 2012770--
AvocatoBotUC10220nov 01, 2011849ago 27, 2013184--
RoggBotUC11147jun 16, 20091717fev 26, 20111097--
WarddrBOTUC12126jul 25, 2012582ago 17, 2013194--
YS-BotUC13102set 07, 2012538fev 25, 20142--
SpaceBirdyBotUC1455jun 27, 20082071dez 01, 20081914--
MjbmrbotUC1553jan 23, 20111131mar 28, 20111067--
EdwardsBotUC1634jul 03, 2011970nov 18, 2013101--
CarsracBotUC1724mar 17, 20111078mai 19, 2013284--
Makecat-botUC184nov 10, 2012474abr 05, 2013328--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110
fev 20143,3 k52339 111,0 k11,1 k       
jan 20143,3 k51539 111,0 k11,1 k      11
dez 20133,3 k50539 111,0 k11,1 k      45
nov 20133,2 k50139 1199811,0 k       
out 20133,2 k49139 1199811,0 k      2
set 20133,2 k48439 1199811,0 k      15
ago 20133,2 k45839 1199611,0 k      418
jul 20132,8 k45439 1196411,0 k      2
jun 20132,8 k44839 119641995      73
mai 20132,8 k44739 119641993      21
abr 20132,8 k44539 119641992      10
mar 20132,8 k44039 119591992      45
fev 20132,7 k43139 119591992       
jan 20132,7 k42039 119591992      1
dez 20122,7 k41639 119591992      7
nov 20122,7 k40939 119591992       
out 20122,7 k40839 119591992       
set 20122,7 k40539 119591992      46
ago 20122,7 k39939 119581992      4
jul 20122,7 k38839 119581992      104
jun 20122,6 k38339 119561986      15
mai 20122,6 k36939 119561986      125
abr 20122,5 k35939 119541984      27
mar 20122,4 k34839 119521940      19
fev 20122,4 k34239 119511940      102
jan 20122,4 k32439 119491940      71
dez 20112,3 k31939 119461937      4
nov 20112,3 k31539 119431937      20
out 20112,3 k30139 119421937      26
set 20112,3 k29339 119421937      6
ago 20112,3 k28839 119421934      98
jul 20112,2 k27839 119381928      3
jun 20112,2 k26439 119381928      43
mai 20112,2 k26039 119361922      85
abr 20112,1 k25039 119301913      3
mar 20112,1 k23839 119301913      26
fev 20112,1 k23839 119261901      19
jan 20112,1 k22839 119251901      279
dez 20101,8 k22039 119161867      17
nov 20101,8 k21839 119131861      170
out 20101,7 k21139 108981820      388
set 20101,6 k20839 108851782      510
ago 20101,4 k20139 108581727      294
jul 20101,3 k18439 108461699      435
jun 20101,2 k18339 108271648      536
mai 20101,1 k15739 107621562      541
abr 201084915439 106711480      1374
mar 201032214135 1462182      22
fev 201031813735 1455177      25
jan 201031613435 1451177      17
dez 200931612035 1451177      40
nov 200930311734 1451177      21
out 200930311534 1451177      63
set 200930211134 1451177      63
ago 200929910534 1451177      36
jul 200929910434 1451177      16
jun 200929910334 1451177      35
mai 20092989834 1450177      43
abr 20092989634 1450177      64
mar 20092978734 1212170      49
fev 20092938033 1105169      103
jan 20092937433 1105169       
dez 20082927433 1105169       
nov 20082927433 1105169       
out 20082925633 1105 69      1
set 20082924533 1105 69       
ago 20082924533 1105 69       
jul 20082924433 1105 69       
jun 20082924433 1105 69      7
mai 20082883832 1105 69      7
abr 20082883532  104 69       
mar 20082883432  104 69      95
fev 20082053232  97 23       
jan 20082053232  97 23       
dez 20072053032  97 23       
nov 20072052832  97 23       
out 20072052832  95 23       
set 20072052431  94 23       
ago 20072052430  93 23       
jul 20072052330  93 23      3
jun 20072052230  92 23       
mai 20072052130  92 23       
abr 20072052130  92 23      90
mar 20071971830  62 1      20
fev 20071961830  57 1       
jan 20071931730  57 1       
dez 20061931730  57 1       
nov 20061931730  57 1      2
out 20061931730  57 1       
set 20061921530  54 1       
ago 20061921430  54 1       
jul 20061901330  54 1      2
jun 20061891230  54 1       
mai 20061891130  54 1      64
abr 20061891130  40         
mar 20061881130  40         
fev 20061881130  40         
jan 20062103  19         
dez 2005241  4         
nov 2005211  3         
out 2005211  3         
set 2005211  3         
ago 2005111            

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

dez 2005: 1 1 галоўная старонка

fev 2006: 1 2 acoustic , 2 1 Мова

abr 2006: 1 1 радзіма

mai 2006: 1 1 радзіма

jul 2006: 1 1 raven

nov 2006: 1 1 index л

mar 2007: 1 1 карова

abr 2007: 1 3 верасень , 2 3 радзіма , 3 2 малако , 4 2 год , 5 2 жнівень , 6 2 абсент , 7 1 index:й

jul 2007: 1 1 Першая старонка

mar 2008: 1 1 らじお

mai 2008: 1 1 Першая старонка

jun 2008: 1 1 Їжа

out 2008: 1 1 мова

fev 2009: 1 1 football

mar 2009: 1 3 абажур , 2 2 курыца , 3 1 венгерская

abr 2009: 1 2 год , 2 2 мова , 3 1 эсперанта

mai 2009: 1 2 год , 2 1 football

jun 2009: 1 1 Main page

jul 2009: 1 1 венгерская

ago 2009: 1 1 林檎

set 2009: 1 1 duck

out 2009: 1 2 ona

nov 2009: 1 1 football

dez 2009: 1 1 Маскаль

jan 2010: 1 1 duck

fev 2010: 1 2 езуіт , 2 2 accounting

mar 2010: 1 2 папка , 2 2 омметр , 3 1 белый

abr 2010: 1 3 mudel , 2 3 панядзелак , 3 3 красавік , 4 3 вайна , 5 3 воўк , 6 2 پنیر , 7 2 keuz , 8 2 Käse , 9 2 ġobon , 10 2 pendir , 11 2 брынзэ , 12 2 brânză , 13 2 পনির , 14 2 पनीर , 15 2 sýr , 16 2 juust , 17 2 caseus , 18 2 siers , 19 2 sūris , 20 2 сирење , 21 2 チーズ

mai 2010: 1 2 об , 2 2 vatn , 3 2 wetter , 4 2 su , 5 2 पाणी , 6 2 лъим , 7 2 woda , 8 2 água , 9 2 һыу

jun 2010: 1 4 смоўж , 2 4 бусел , 3 3 ялавічына , 4 3 бурштын , 5 3 рэпілент , 6 3 валапюк , 7 2 spegel , 8 2 , 9 2 күзгү , 10 2 거울

jul 2010: 1 3 ідыш , 2 3 Маскаль , 3 2 saqaf , 4 2 леведыш , 5 2 やね

ago 2010: 1 2 serigala , 2 2 борз , 3 2 úlvur

set 2010: 1 2 túbig , 2 2 , 3 2 шыв , 4 2 dowr

out 2010: 1 3 laberint , 2 2 qar , 3 2 sněh

nov 2010: 1 1 fromazy

dez 2010: 1 1 hukarere

jan 2011: 1 1 мед

fev 2011: 1 2 абавязак , 2 2 аазіс , 3 1 ладдзя

mar 2011: 1 1 மணல்

abr 2011: 1 1 история

mai 2011: 1 2 архитектура , 2 1

jun 2011: 1 1 ком

jul 2011: 1 1 месяц

ago 2011: 1 3 альфа , 2 2 кулак , 3 2 Віта , 4 1 у

set 2011: 1 1 اسم

out 2011: 1 1 alatsinainy

nov 2011: 1 1 кніга

dez 2011: 1 2 збройні сили

jan 2012: 1 1 прагрэс

fev 2012: 1 1 некалькі

mar 2012: 1 2 сколько , 2 2 колькі , 3 1 абрус

abr 2012: 1 1 кавалак

mai 2012: 1 2 urtxintxa , 2 1 hartz

jun 2012: 1 1 baraf

jul 2012: 1 1 гургум

ago 2012: 1 1 вуха

set 2012: 1 1 зародак

dez 2012: 1 1 каханне

jan 2013: 1 1 слова

mar 2013: 1 1 굶주림

abr 2013: 1 1 мець

mai 2013: 1 2 omăt , 2 1 кароткі

jun 2013: 1 1 Пер-

jul 2013: 1 1 навука

ago 2013: 1 1 πετεηνόν

set 2013: 1 2 ёж , 2 1 радасны

out 2013: 1 1 слова

dez 2013: 1 1 livro

jan 2014: 1 1 ўласцівасць

Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Domingo, 30 de março 2014 19:30

Dump file bewiktionary-20140305-pages-meta-history.xml.7z (full dump), size 2.0 Mb as 7z -> 50 Mb
Dump processed till Feb 28, 2014, on server stat1002, ready at Fri-14/03/2014-14:15 after 30 sec.

Versão do script:2.6
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.