Estatísticas da Wikcionário bielorrusso

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist

Metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.
See also metrics definitions


 
Monthly counts & Quarterly rankings: junho 2015
 
DataWikcionaristasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
jun 2015    0%   +543%      +1%
mai 2015    0%   -25%      0%
abr 2015    +1%   +98%      +1%
mar 2015    0%   +155%0%0%0%+1% 0%0%
fev 2015    0%   -20%0%0%0%0% 0%0%
jan 2015    0%   -72%0%0%0%0% 0%0%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
jun 201519   3,4 k 7 1,3 k      178
mai 201519   3,4 k 6,6 201      177
abr 201519 2 3,4 k16,5 267      177
mar 201519 1 3,4 k 6,54141354,7 Mb247 k10 k48 k1545176
fev 201519 1 3,4 k 6,5413534,7 Mb247 k10 k48 k1545176
jan 201519 1 3,4 k 6,5412664,7 Mb246 k10 k47 k1545176
dez 201419 113,4 k46,54122344,7 Mb245 k10 k47 k1545176
nov 201419 1 3,3 k 6,6413284,5 Mb238 k10 k47 k1545175
out 201419 1 3,3 k 6,64131804,5 Mb237 k10 k47 k1545175
set 201419   3,2 k 6,64133854,5 Mb236 k10 k47 k1545174
ago 201419 1 3,2 k 6,54121694,5 Mb235 k10 k45 k1545174
jul 201419   3,2 k 6,4413644,5 Mb235 k10 k44 k1545174
jun 201419 1 3,2 k26,4413964,5 Mb235 k10 k44 k1545174
mai 20141911 3,2 k 6,5414544,4 Mb230 k10 k44 k1545174
abr 201418 1 3,2 k16,5412454,4 Mb229 k9,9 k44 k1545174
mar 201418 1 3,1 k16,6410584,3 Mb226 k9,8 k44 k1544174
fev 201418   3,1 k 6,6410694,3 Mb224 k9,7 k44 k1544174
jan 201418 1 3,1 k 6,6410574,3 Mb224 k9,7 k44 k1544174
dez 201318 1 3,1 k16,64101,8 k4,3 Mb224 k9,7 k43 k1544174
nov 201318   3,1 k 6,1408684,1 Mb220 k9,6 k37 k1544174
out 201318   3,1 k 6,14071014,1 Mb220 k9,6 k37 k1543174
set 201318 1 3,1 k 6407214,1 Mb219 k9,6 k36 k1441174
ago 201318 113,0 k1364066374,1 Mb218 k9,5 k36 k1341174
jul 201318   2,6 k 6,74082103,6 Mb190 k8,6 k34 k1340174
jun 20131811 2,6 k16,74071853,6 Mb190 k8,6 k34 k1338174
mai 201317 1 2,6 k 6,74083423,5 Mb189 k8,6 k34 k1338174
abr 201317 2 2,6 k 6,64071673,5 Mb188 k8,5 k34 k1320172
mar 201317 1 2,6 k16,54041923,5 Mb186 k8,3 k33 k1319172
fev 201317   2,6 k 6,54041813,4 Mb183 k8,2 k33 k1314172
jan 201317   2,6 k 6,54043633,4 Mb184 k8,2 k33 k1314172
dez 201217 1 2,6 k 6,34031993,4 Mb183 k8,2 k32 k1210172
nov 201217   2,6 k 6,34031213,4 Mb182 k8,1 k32 k1210172
out 201217   2,6 k 6,24023993,4 Mb182 k8,1 k32 k1010172
set 201217 1 2,6 k16,14014483,4 Mb182 k8,1 k31 k98172
ago 201217   2,5 k 63963713,3 Mb177 k8,0 k31 k77172
jul 201217 112,5 k35,83963413,3 Mb176 k8,0 k30 k77172
jun 201217 1 2,4 k 5,93992723,2 Mb171 k7,8 k30 k67172
mai 2012171212,4 k45,93984953,2 Mb169 k7,7 k29 k36172
abr 201216 1 2,3 k15,93992183,0 Mb162 k7,5 k29 k36171
mar 201216 1 2,3 k 5,93942083,0 Mb158 k7,4 k28 k36170
fev 20121611 2,2 k15,83922,3 k3,0 Mb157 k7,3 k28 k36170
jan 201215 1 2,2 k24,93772622,9 Mb145 k5,1 k27 k26169
dez 201115   2,2 k 4,93754542,8 Mb140 k4,9 k27 k22169
nov 201115 1 2,1 k14,73752662,8 Mb140 k4,9 k26 k11169
out 201115 1 2,1 k14,63749772,8 Mb139 k4,8 k26 k11169
set 201115   2,1 k 4,23731132,7 Mb137 k4,8 k24 k11169
ago 201115 2 2,1 k24,13732562,7 Mb137 k4,8 k24 k11169
jul 201115   2,0 k 4,1371972,6 Mb132 k4,5 k24 k11161
jun 201115 1 2,0 k14,13693402,6 Mb132 k4,3 k23 k11161
mai 201115 1 2,0 k343692552,6 Mb130 k4,3 k23 k11160
abr 201115   1,9 k 43681702,5 Mb124 k4,2 k22 k11160
mar 201115 1 1,9 k13,93681902,5 Mb124 k4,2 k22 k11160
fev 20111511 1,9 k 3,93691952,4 Mb123 k4,2 k22 k11160
jan 201114 111,9 k93,83666852,4 Mb121 k4,2 k21 k11159
dez 201014 1 1,6 k143722532,1 Mb105 k3,7 k19 k11158
nov 201014 2 1,6 k33,93721792,1 Mb104 k3,7 k19 k11158
out 201014 221,5 k343783912,0 Mb99 k3,6 k19 k11158
set 201014 221,4 k543775191,8 Mb92 k3,3 k17 k11157
ago 201014 211,3 k24,13822951,6 Mb82 k3,2 k16 k11157
jul 201014 321,2 k44,13844371,6 Mb78 k3,1 k15 k11157
jun 2010141621,1 k64,23825391,4 Mb70 k2,9 k14 k11156
mai 201013 2289464,43755551,2 Mb57 k2,7 k12 k 1154
abr 201013132693184,93661,4 k913 kb43 k2,2 k9,4 k 1154
mar 201012 2 166 1217923119 kb4,3 k3712,3 k11154
fev 20101211 162 12,216224109 kb3,7 k3482,3 k11154
jan 201011 1 160 12,215717106 kb3,5 k3342,3 k11154
dez 20091112 160 12,115740106 kb3,5 k3342,2 k11154
nov 200910 1 160 11,81572395 kb3,5 k3332,2 k11141
out 200910 1 160 11,71576195 kb3,5 k3332,2 k11141
set 200910 1 160 11,31586894 kb3,5 k3332,1 k11141
ago 200910 1 157 11,11603693 kb3,5 k3332,0 k11141
jul 200910 1 157 10,91601693 kb3,5 k3332,0 k11141
jun 200910 1 157 10,81604992 kb3,5 k3332,0 k11141
mai 200910 1 157 10,41604392 kb3,5 k3332,0 k11140
abr 20091012 157 10,21606392 kb3,5 k3332,0 k11140
mar 20099 3 156 9,81435184 kb3,0 k3202,0 k11140
fev 20099111152 9,813610379 kb2,7 k2861,9 k11140
jan 20098   152 9,11361175 kb2,7 k2861,6 k11140
dez 20088   151 9,1136475 kb2,7 k2831,6 k11140
nov 20088   151 91361974 kb2,7 k2831,6 k11140
out 20088   151 8,9136274 kb2,7 k2831,6 k11140
set 20088   151 8,9136674 kb2,7 k2821,6 k11140
ago 20088   151 8,91361974 kb2,7 k2821,6 k11140
jul 20088   151 8,7136673 kb2,7 k2821,5 k11140
jun 20088 1 151 8,71362973 kb2,7 k2821,5 k11140
mai 20088 1 147 8,71396372 kb2,7 k2821,5 k11140
abr 20088   147 8,31391369 kb2,7 k2811,3 k11140
mar 2008811 14718,213912267 kb2,7 k2811,1 k11140
fev 20087   105 10,31591258 kb2,1 k2341,1 k1199
jan 20087   105 10,21592258 kb2,1 k2341,1 k1199
dez 20077   105 101593157 kb2,1 k2341,0 k1199
nov 20077   105 9,7159156 kb2,1 k2329891199
out 20077   105 9,71591056 kb2,1 k2329881199
set 20077   105 9,6158256 kb2,1 k2319751199
ago 20077   105 9,6158356 kb2,1 k2319731199
jul 20077   105 9,61583356 kb2,1 k2319661199
jun 20077   105 9,2166558 kb2,3 k2639301199
mai 20077   105 9,21664358 kb2,3 k2639241199
abr 2007723 105 8,816612857 kb2,3 k2638711199
mar 2007511 99 81263745 kb1,7 k48921 197
fev 20074   98 7,71255045 kb1,7 k48897 197
jan 20074   95 7,51285443 kb1,6 k48835 197
dez 20064   95 6,91271542 kb1,6 k48793 197
nov 20064   95 6,71271542 kb1,6 k48781 197
out 20064   95 6,61267241 kb1,6 k48766 197
set 20064   94 5,91165339 kb1,5 k40736 197
ago 20064   94 5,3116238 kb1,5 k40629 197
jul 20064   92 5,4116337 kb1,4 k40618 197
jun 20064   91 5,41178137 kb1,4 k40616 197
mai 2006411 91 4,51506829 kb1,4 k4097 197
abr 20063   91 3,8384326 kb8284093 197
mar 20063   90 3,8416 25 kb7663990 197
fev 200632219033,841631625 kb7663990 197
jan 20061   1 26726 5,3 kb2811164  1
dez 20051   1 2672655,3 kb2811164  1
nov 20051   1 21694 3,8 kb275135  1
out 20051   1 21694 3,8 kb275135  1
set 20051   1 21694183,8 kb275135  1
ago 200511  1 3983193 12 6   
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
The following table ranks this project in relation to projects in other languages with 1000+ articles
abr 201582 60 966438 86      140
jan 2015813570439659362297807987859582140
out 2014793867469562372477797886829581140
jul 2014783383489558372596797886839581140
abr 2014783266489457362589787885829581140
jan 2014774373499259372697747483819480140
out 2013774380469262402577757382839580140
jul 2013764182519164342580767682839679140
abr 2013763656519164362579767481829686140
jan 2013764583549167372382757380829491140
out 2012743682498964432277737279799895140
jul 20127449764987514722767171797810399140
abr 201275396952876045237872728176114101140
jan 201275356850855454257770738675113100140
out 201175407748856257246170708372118117140
jul 201174448349846964258169708271117115140
abr 201173348245856167257871708271116113140
jan 201173356846843666255369708071117112140
out 201072356746844563236871708172114112140
jul 201070465447874362237273738274113111140
abr 201071425643932689894781868682117111140
jan 201073338977112618585117108114115103110111140
out 2009744085791095684849110611111399108111140
jul 200973409080108598282112105111112100107110140
abr 2009714465781085379798810511111098106109140
jan 2009745982421075977779910610910996104110140
out 20087236744310463777711010510910790102110139
jul 20087032724510259757511110410810587101108139
abr 2008674278491006471719310110610387102106139
jan 200871437751101596868901001041018698105139
out 2007663975509863646497981031008593105139
jul 200763447544955864648594101978391101138
abr 2007582236478961616170929893838599138
jan 20078148844486665555889096101738294138
out 2006743967437953505070819197667490138
jul 2006704068387553464694798696616390138
abr 2006743854356449424277748392985489138
jan 20061034459341084137371099494101584590131
out 20059633502610136323279888796684182118
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100ediçõesbytes
 WikcionaristasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikcionaristas (usuários registrados)
A = Wikcionaristas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikcionaristas que editaram pelo menos dez vezes desde que chegaram
C = Wikcionaristas que contribuíram cinco vezes ou mais este mês
D = Wikcionaristas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  5  10  100  1000  1  3  5  10  5  10  1  3  5  10  25  100  250  5  10  100 
jun 201542   3211      2      11 
mai 20152    331 1     2      11 
abr 201532211 331 1   2252221  111
mar 2015111   32  2   111      11 
fev 2015111   22  42    52     111
jan 2015111   33  11    211    111
dez 2014211111 33  1     2111   111
nov 20141111  11  21    21     11 
out 2014321   111 1     311    1  
set 20141    111 3     41     11 
ago 2014211   221       31     11 
jul 201411   22        211       
jun 201411111 11        4111      
mai 20143211  11        1         
abr 20142111  21        4         
mar 201411111 21  1     4211      
fev 2014     22  1     5         
jan 20141111  22  1     511    11 
dez 201321111 21112     211       
nov 2013     11  1     91        
out 20131    11  1     311       
set 20133111      21    5321      
ago 20131111111221 1     62111  11 
jul 20132    221       52111  11 
jun 201311111 111 1     3         
mai 2013721   111       5         
abr 2013222   111 1     511    111
mar 201311111 221 1   1 411    221
fev 2013     44  1     51        
jan 20131    621              11 
abr 201532211 331 1   2252221  111
jan 2015111   33  11    211    111
out 2014321   111 1     311    1  
jul 201411   22        211       
abr 20142111  21        4         
jan 20141111  22  1     511    11 
out 20131    11  1     311       
jul 20132    221       52111  11 
abr 2013222   111 1     511    111
jan 20131    621              11 
out 2012     321 1     51     111
jul 2012111111 421       521    11 
abr 201211111 54  11    53211  11 
jan 201211111 631       4111   211
out 20113111  441 3     5      11 
jul 201111   33  1     31     11 
abr 20112    321       321    11 
jan 20112111111431       52111  11 
out 20104322221          62221  11 
jul 20104332221          21111     
abr 20103333222    3322  54221111  
jan 20101111      1     2111      
out 200911111           3         
jul 20091111      2     3         
abr 200932222     2     4332211   
jan 2009     1         111    11 
out 20081        1     522       
jul 2008               1         
abr 2008     11        1         
jan 2008     11  2     3         
out 2007     1   3     3         
jul 20071    11        1      1  
abr 200763322 11  222   42222     
jan 2007     11                  
out 2006     11        21        
jul 20061              1         
abr 200611       1               
jan 2006         3     6211      
out 2005                         

 

Distribuição de edições de artigos por wikcionaristas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikcionaristasEdições total
173100.0%7,623100.0%
33243.8%7,55899.1%
102027.4%7,49298.3%
321115.1%7,34296.3%
10068.2%7,02292.1%
31622.7%6,49285.2%
100022.7%6,49285.2%
316211.4%3,49245.8%

 

4 wikcionaristas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions
agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
Al SilonovUC1 03,49232,001-mar 28, 200922843,11411,578-
Stephen G. BrownUC31...44--jun 30, 2015 ----
1994thegoodolddaysUC71...11--jun 16, 201513----
HydrizUC72...111-jun 22, 20157----

 

20 wikcionaristas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
InterwicketUC23,000fev 01, 20092339nov 08, 20101694
BooxterUC3127fev 01, 20063435fev 03, 20063433
ХомелкаUC4111fev 24, 20121221mai 11, 2013779
VesailokUC5106mar 28, 20092284out 30, 2014242
PradslavaUC695mar 15, 20082662mar 21, 20082656
Ellis NovakUC780mai 24, 2013766jun 21, 2013738
KubaroUC864mai 04, 20063343mai 16, 20063331
MaximLitvinUC944abr 22, 20072990jul 30, 20072891
MienskiUC1037abr 23, 20072989abr 24, 20072988
CarsracUC1124dez 04, 20092033dez 04, 20092033
Vedac13UC1224mai 11, 2014414mai 11, 2014414
Yellow~bewiktionaryUC1320jun 20, 20101835jun 21, 20101834
ZuiarraUC1420ago 28, 20111401jul 11, 2013718
DryhvaUC1515mar 28, 20073015mar 30, 20073013
MalafayaUC1614out 07, 20082456jun 10, 20101845
IlyankouUC1712fev 21, 20111589fev 21, 20111589
Serge GorlawUC1811ago 16, 20111413ago 16, 20111413
AdashUC1910ago 22, 20101772ago 31, 20101763
InnvUC209mai 03, 20082613mai 08, 20082608
EinimiUC218abr 19, 201571abr 19, 201571

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 160 edições foram feitas por usuários anônimos, de um total de 23876 edições ( 0e %)
  


18 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
HydrizBotUC14,538abr 24, 20121161jun 30, 2015---
Luckas-botUC23,340set 04, 20101759jan 27, 2014518--
JAnDbotUC32,088mai 18, 20111503jun 25, 20154--
ХомоБотUC41,970fev 24, 20121221fev 27, 20121218--
KamikazeBotUC51,408out 18, 20111350mar 07, 2013844--
ArthurBotUC6548jan 04, 20111637nov 12, 20111325--
RobotGMwiktUC7504jun 23, 20063293mai 30, 20082586--
YS-BotUC8467set 07, 20121025jun 30, 2015---
VolkovBotUC9297jul 13, 20072908mar 23, 2013828--
WikitanvirBotUC10257abr 16, 20111535jan 19, 20121257--
AvocatoBotUC11220nov 01, 20111336ago 27, 2013671--
RoggBotUC12147jun 16, 20092204fev 26, 20111584--
WarddrBOTUC13126jul 25, 20121069ago 17, 2013681--
SpaceBirdyBotUC1455jun 27, 20082558dez 01, 20082401--
MjbmrbotUC1553jan 23, 20111618mar 28, 20111554--
EdwardsBotUC1634jul 03, 20111457nov 18, 2013588--
CarsracBotUC1724mar 17, 20111565mai 19, 2013771--
Makecat-botUC184nov 10, 2012961abr 05, 2013815--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110
jun 20153,6 k43039 111,0 k11,1 k       
mai 20153,6 k42939 111,0 k11,1 k       
abr 20153,6 k42839 111,0 k11,1 k       
mar 20153,6 k42639 111,0 k11,1 k      7
fev 20153,6 k42639 111,0 k11,1 k      7
jan 20153,6 k42039 111,0 k11,1 k      9
dez 20143,6 k41839 111,0 k11,1 k      123
nov 20143,4 k41739 111,0 k11,1 k      15
out 20143,4 k41439 111,0 k11,1 k      15
set 20143,4 k41339 111,0 k11,1 k      1
ago 20143,4 k40839 111,0 k11,1 k      7
jul 20143,4 k40439 111,0 k11,1 k      3
jun 20143,4 k40439 111,0 k11,1 k      71
mai 20143,3 k40239 111,0 k11,1 k      29
abr 20143,3 k40239 111,0 k11,1 k      25
mar 20143,3 k39939 111,0 k11,1 k      29
fev 20143,3 k39639 111,0 k11,1 k       
jan 20143,3 k39139 111,0 k11,1 k      11
dez 20133,3 k38639 111,0 k11,1 k      45
nov 20133,2 k38639 1199811,0 k       
out 20133,2 k38139 1199811,0 k      2
set 20133,2 k37739 1199811,0 k      15
ago 20133,2 k36139 1199611,0 k      418
jul 20132,8 k35739 1196411,0 k      2
jun 20132,8 k35139 119641995      73
mai 20132,8 k35039 119641993      19
abr 20132,8 k34839 119641992      10
mar 20132,8 k34339 119591992      45
fev 20132,7 k33539 119591992       
jan 20132,7 k32739 119591992      1
dez 20122,7 k32639 119591992      7
nov 20122,7 k32039 119591992       
out 20122,7 k31939 119591992       
set 20122,7 k31639 119591992      46
ago 20122,7 k31139 119581992      4
jul 20122,7 k30539 119581992      104
jun 20122,6 k30239 119561986      15
mai 20122,6 k29039 119561986      125
abr 20122,4 k28239 119541984      27
mar 20122,4 k27639 119521940      19
fev 20122,4 k27239 119511940      102
jan 20122,4 k26139 119491940      71
dez 20112,3 k25739 119461937      4
nov 20112,3 k25339 119431937      20
out 20112,3 k24039 119421937      26
set 20112,3 k23539 119421937      6
ago 20112,3 k23139 119421934      98
jul 20112,2 k22439 119381928      3
jun 20112,2 k21539 119381928      43
mai 20112,2 k21239 119361922      85
abr 20112,1 k20639 119301913      3
mar 20112,1 k19639 119301913      26
fev 20112,1 k19639 119261901      19
jan 20112,1 k19039 119251901      279
dez 20101,8 k18339 119161867      17
nov 20101,8 k18139 119131861      170
out 20101,7 k17639 108981820      388
set 20101,6 k17339 108851782      510
ago 20101,4 k16639 108581727      294
jul 20101,3 k15139 108461699      435
jun 20101,2 k15039 108271648      536
mai 20101,0 k13439 107621562      541
abr 201084713239 106711480      1374
mar 201032012335 1462182      22
fev 201031611935 1455177      24
jan 201031411635 1451177      17
dez 200931410435 1451177      40
nov 200930110234 1451177      21
out 200930110034 1451177      61
set 20093019734 1451177      63
ago 20092989334 1451177      36
jul 20092989234 1451177      16
jun 20092989134 1451177      35
mai 20092978734 1450177      43
abr 20092978534 1450177      63
mar 20092967734 1212170      49
fev 20092927333 1105169      103
jan 20092926733 1105169       
dez 20082916733 1105169       
nov 20082916733 1105169       
out 20082915433 1105 69      1
set 20082914333 1105 69       
ago 20082914333 1105 69       
jul 20082914233 1105 69       
jun 20082914233 1105 69      7
mai 20082873632 1105 69      7
abr 20082873332  104 69       
mar 20082873232  104 69      95
fev 20082043132  97 23       
jan 20082043132  97 23       
dez 20072042932  97 23       
nov 20072042732  97 23       
out 20072042732  95 23       
set 20072042431  94 23       
ago 20072042430  93 23       
jul 20072042330  93 23      3
jun 20072042230  92 23       
mai 20072042130  92 23       
abr 20072042130  92 23      89
mar 20071961830  62 1      20
fev 20071951830  57 1       
jan 20071921730  57 1       
dez 20061921730  57 1       
nov 20061921730  57 1      2
out 20061921730  57 1       
set 20061911530  54 1       
ago 20061911430  54 1       
jul 20061891330  54 1      2
jun 20061881230  54 1       
mai 20061881130  54 1      64
abr 20061881130  40         
mar 20061871130  40         
fev 20061871130  40         
jan 20062103  19         
dez 2005241  4         
nov 2005211  3         
out 2005211  3         
set 2005211  3         
ago 2005111            

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

dez 2005: 1 1 галоўная старонка

fev 2006: 1 2 acoustic , 2 1 Мова

abr 2006: 1 1 радзіма

mai 2006: 1 1 радзіма

jul 2006: 1 1 raven

nov 2006: 1 1 index л

mar 2007: 1 1 карова

abr 2007: 1 3 верасень , 2 3 радзіма , 3 2 малако , 4 2 год , 5 2 жнівень , 6 2 абсент , 7 1 index:й

jul 2007: 1 1 Першая старонка

mar 2008: 1 1 らじお

mai 2008: 1 1 Першая старонка

jun 2008: 1 1 Їжа

out 2008: 1 1 мова

fev 2009: 1 1 football

mar 2009: 1 3 абажур , 2 2 курыца , 3 1 венгерская

abr 2009: 1 2 год , 2 2 мова , 3 1 эсперанта

mai 2009: 1 2 год , 2 1 football

jun 2009: 1 1 Main page

jul 2009: 1 1 венгерская

ago 2009: 1 1 林檎

set 2009: 1 1 duck

out 2009: 1 1 duck

nov 2009: 1 1 football

dez 2009: 1 1 Маскаль

jan 2010: 1 1 duck

fev 2010: 1 2 езуіт , 2 2 accounting

mar 2010: 1 2 папка , 2 2 омметр , 3 1 белый

abr 2010: 1 3 mudel , 2 3 панядзелак , 3 3 красавік , 4 3 вайна , 5 3 воўк , 6 2 پنیر , 7 2 keuz , 8 2 Käse , 9 2 ġobon , 10 2 pendir , 11 2 брынзэ , 12 2 brânză , 13 2 পনির , 14 2 पनीर , 15 2 sýr , 16 2 juust , 17 2 caseus , 18 2 siers , 19 2 sūris , 20 2 сирење , 21 2 チーズ

mai 2010: 1 2 об , 2 2 vatn , 3 2 wetter , 4 2 su , 5 2 पाणी , 6 2 лъим , 7 2 woda , 8 2 água , 9 2 һыу

jun 2010: 1 4 смоўж , 2 4 бусел , 3 3 ялавічына , 4 3 бурштын , 5 3 рэпілент , 6 3 валапюк , 7 2 spegel , 8 2 , 9 2 күзгү , 10 2 거울

jul 2010: 1 3 ідыш , 2 3 Маскаль , 3 2 saqaf , 4 2 леведыш , 5 2 やね

ago 2010: 1 2 serigala , 2 2 борз , 3 2 úlvur

set 2010: 1 2 túbig , 2 2 , 3 2 шыв , 4 2 dowr

out 2010: 1 3 laberint , 2 2 qar , 3 2 sněh

nov 2010: 1 1 fromazy

dez 2010: 1 1 hukarere

jan 2011: 1 1 мед

fev 2011: 1 2 абавязак , 2 2 аазіс , 3 1 ладдзя

mar 2011: 1 1 மணல்

abr 2011: 1 1 история

mai 2011: 1 2 архитектура , 2 1

jun 2011: 1 1 ком

jul 2011: 1 1 месяц

ago 2011: 1 3 альфа , 2 2 кулак , 3 2 Віта , 4 1 у

set 2011: 1 1 اسم

out 2011: 1 1 alatsinainy

nov 2011: 1 1 кніга

dez 2011: 1 2 збройні сили

jan 2012: 1 1 прагрэс

fev 2012: 1 1 некалькі

mar 2012: 1 2 сколько , 2 2 колькі , 3 1 абрус

abr 2012: 1 1 кавалак

mai 2012: 1 2 urtxintxa , 2 1 hartz

jun 2012: 1 1 baraf

jul 2012: 1 1 гургум

ago 2012: 1 1 вуха

set 2012: 1 1 зародак

dez 2012: 1 1 каханне

jan 2013: 1 1 слова

mar 2013: 1 1 굶주림

abr 2013: 1 1 мець

mai 2013: 1 2 omăt , 2 1 кароткі

jun 2013: 1 1 Пер-

jul 2013: 1 1 навука

ago 2013: 1 1 πετεηνόν

set 2013: 1 2 ёж , 2 1 радасны

out 2013: 1 1 слова

dez 2013: 1 1 livro

jan 2014: 1 1 уласцівасць

mar 2014: 1 1 платинӕ

abr 2014: 1 1 sinónimo

mai 2014: 1 2 карова , 2 1 дзень

jun 2014: 1 1 päivä

jul 2014: 1 1

ago 2014: 1 1 deň

set 2014: 1 1 дом

out 2014: 1 1 англійская мова

nov 2014: 1 1 andro

dez 2014: 1 2 забойства , 2 2 Прадромус , 3 1 сонцаварот

jan 2015: 1 1 гук

fev 2015: 1 1 жыхар

mar 2015: 1 1 вывад

abr 2015: 1 1 ўласцівасць

mai 2015: 1 1 цяля

jun 2015: 1 1 ашәахь

No data on this page have been normalized to 30 day months (as WMF does on certain traffic reports).
Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Quinta-feira, 30 de julho 2015 22:11

Dump file bewiktionary-20150702-stub-meta-history.xml.gz (edits only), size 2.1 Mb as gz -> 16 Mb
Dump processed till Jun 30, 2015, on server stat1002, ready at Sat-04/07/2015-21:24 after 15 sec.

Versão do script:2.6
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.