Estatísticas da Wikcionário fijiano

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist

Metrics have been collected from a full archive dump, which contains all revisions of every article, meta data and raw content.
See also metrics definitions


 
Monthly counts & Quarterly rankings: fevereiro 2015
 
DataWikcionaristasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
fev 2015    0%   -40%0%0%0%0% 0% 
jan 2015    0%   +2%0%0%0%0% 0% 
dez 2014    0%   +1120%0%0%0%0% 0% 
nov 2014    0%   -95%0%0%0%0% 0% 
out 2014    0%   -67%0%0%0%0% 0% 
set 2014    0%   +32%+1%0%0%+1% 0% 
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
fev 20156   25 k 4,9423436,4 Mb154 k12 k333 k55219
jan 20156   25 k14,9425736,4 Mb154 k12 k333 k55219
dez 20146   25 k14,9425616,3 Mb154 k12 k331 k55219
nov 20146   25 k 4,942466,3 Mb153 k12 k330 k55219
out 20146   25 k14,9429356,3 Mb153 k12 k330 k55218
set 20146   25 k 4,8422,8 k6,3 Mb153 k12 k329 k45218
ago 20146   25 k14,7422,2 k6,2 Mb153 k12 k324 k45218
jul 20146   25 k14,7425976,2 Mb153 k12 k320 k45218
jun 20146   25 k 4,6422936,2 Mb153 k12 k319 k45218
mai 20146   25 k24,6423026,2 Mb153 k12 k318 k45218
abr 20146   25 k 4,6422816,1 Mb152 k12 k318 k45218
mar 20146   25 k14,6424826,1 Mb152 k12 k317 k25218
fev 20146   25 k24,6425416,1 Mb152 k12 k316 k15218
jan 20146   25 k24,6421,3 k6,1 Mb152 k12 k315 k15218
dez 20136   25 k64,5422,6 k6,1 Mb152 k12 k312 k15218
nov 20136   25 k 4,5421,1 k6,0 Mb150 k12 k308 k15218
out 20136   25 k 4,4426936,0 Mb150 k12 k306 k15218
set 20136   25 k 4,4422056,0 Mb150 k12 k305 k15218
ago 20136   25 k44,4423,5 k6,0 Mb150 k12 k305 k15218
jul 20136   25 k24,3421,8 k5,9 Mb150 k12 k301 k15218
jun 20136   25 k 4,2421,0 k5,9 Mb149 k12 k299 k15218
mai 20136   25 k 4,2422,3 k5,9 Mb149 k12 k297 k15218
abr 20136   25 k44,1421,5 k5,8 Mb149 k12 k295 k15218
mar 20136   24 k44421,3 k5,8 Mb148 k12 k293 k15218
fev 20136   24 k104421,4 k5,8 Mb148 k12 k291 k15218
jan 20136   24 k74422,6 k5,7 Mb146 k12 k287 k15218
dez 20126   24 k453,9423,1 k5,6 Mb144 k12 k283 k15217
nov 20126   22 k1454425,6 k5,5 Mb135 k12 k271 k15217
out 20126   18 k2294,74229 k5,1 Mb107 k12 k248 k15217
set 20126   11 k 5,1421,1 k2,7 Mb62 k12 k150 k15217
ago 20126   11 k 5429652,7 Mb62 k12 k149 k15217
jul 20126   11 k 4,9421,1 k2,7 Mb62 k12 k148 k15217
jun 20126   11 k 4,8421,0 k2,6 Mb62 k12 k146 k15217
mai 20126   11 k 4,7421,3 k2,6 Mb62 k12 k144 k15217
abr 20126   11 k 4,6421,7 k2,6 Mb62 k12 k141 k15217
mar 20126 1 11 k 4,4421,1 k2,5 Mb62 k12 k139 k15217
fev 20126   11 k 4,3421,5 k2,5 Mb62 k12 k136 k15217
jan 20126   11 k 4,2421,2 k2,4 Mb62 k12 k132 k 5217
dez 20116   11 k 4,1424,2 k2,4 Mb62 k13 k128 k 5216
nov 20116 1111 k1923,74235 k1,9 Mb62 k13 k94 k 5216
out 201161115,1 k1641,1305,4 k356 kb19 k4,1 k6,9 k  13
set 20115   42 7,4361023 kb282151,2 k  12
ago 20115   42 7,236123 kb282151,2 k  12
jul 20115   42 7,236223 kb282151,2 k  12
jun 20115   42 7,136923 kb282151,2 k  12
mai 20115   41 7,137423 kb279151,1 k  12
abr 20115   41 7371422 kb279151,1 k  12
mar 20115   38 7,239322 kb273151,1 k  12
fev 20115   38 7,139 22 kb273151,1 k  12
jan 20115   38 7,1391122 kb273151,1 k  12
dez 2010511 38 6,8393319 kb27315892  12
nov 20104   26 8,734815 kb16911673  12
out 20104 1 22 9,938515 kb15910653  12
set 20104   22 9,638315 kb15910648  12
ago 20104 1 22 9,5381015 kb15910645  12
jul 20104 1 22 9381015 kb15910635  12
jun 20104 1 21 9393614 kb15510565  12
mai 2010411 12 12,845205,9 kb104 168  12
abr 20103   11 12,122556,8 kb37412170 2711
mar 20103 1 11 11,622556,8 kb37412170 2711
fev 20103   11 11,222516,7 kb37412165 2711
jan 20103   11 11,122526,7 kb37412164 2711
dez 20093   11 10,9225 6,7 kb37412162 2711
nov 20093   11 10,9225 6,7 kb37412162 2711
out 20093   11 10,9225 6,7 kb37412162 2711
set 20093   11 10,922546,7 kb37412162 2711
ago 20093   11 10,522546,6 kb37412158 2711
jul 20093   11 10,222526,6 kb37412154 2711
jun 200931  11 1022536,5 kb37412152 2711
mai 20092   11 9,722526,5 kb37412149 2711
abr 20092   11 9,5225 6,5 kb37412147 2711
mar 20092   11 9,522536,5 kb37412147 2711
fev 20092   11 9,322546,7 kb37412156 2711
jan 20092   11 8,922526,6 kb37412151 2711
dez 20082   11 8,7225 6,6 kb37412149 2711
nov 20082   11 8,722516,6 kb37412149 2711
out 20082   11 8,622516,6 kb37412148 2711
set 20082   11 8,522566,6 kb37412146 2711
ago 20082   11 8225 6,3 kb37412123 2711
jul 20082   11 822526,3 kb37412123 2711
jun 20082   11 7,822526,2 kb37412117 2711
mai 20082   11 7,622526,2 kb37412117 2710
abr 20082   11 7,5225 6,0 kb3741298 2710
mar 20082   11 7,5225 6,0 kb3741298 2710
fev 20082   11 7,5225 6,0 kb3741298 2710
jan 20082   11 7,5225 6,0 kb3741298 2710
dez 20072   11 7,5225 6,0 kb3741298 2710
nov 20072   11 7,5225 6,0 kb3741298 2710
out 20072   11 7,5225 6,0 kb3741298 2710
set 20072   11 7,5225 6,0 kb3741298 2710
ago 20072   11 7,5225 6,0 kb3741298 2710
jul 20072   11 7,5225 6,0 kb3741298 2710
jun 20072   11 7,522536,0 kb3741298 2710
mai 20072   10 7,923325,8 kb359695 2710
abr 20072   10 7,723315,8 kb359695 2710
mar 20072   10 7,623345,8 kb359694 2710
fev 20072   10 7,223355,7 kb359690 2710
jan 20072   10 6,723345,7 kb359686 2710
dez 20062   10 6,323345,6 kb359684 2710
nov 20062   10 5,923665,6 kb361680 2710
out 20062   10 5,323375,5 kb359675 2710
set 20062   10 4,6233 5,4 kb359662 2710
ago 20062   10 4,6233 5,4 kb359662 2710
jul 20062   10 4,623325,4 kb359662 2710
jun 20062   10 4,4233105,3 kb359662 279
mai 20062   10 3,4233 4,7 kb359612 279
abr 20062   10 3,4233 4,7 kb359612 279
mar 20062   10 3,4233 4,7 kb359612 279
fev 2006211 10 3,4233194,7 kb359612 279
jan 20061   10 1,5233 4,5 kb359612 27 
dez 20051   10 1,5233 4,5 kb359612 27 
nov 20051   10 1,5233 4,5 kb359612 27 
out 20051   10 1,5233 4,5 kb359612 27 
set 20051   10 1,5233 4,5 kb359612 27 
ago 20051   10 1,5233 4,5 kb359612 27 
jul 20051   10 1,5233 4,5 kb359612 27 
jun 20051   10 1,523314,5 kb359612 27 
mai 20051   10 1,4233 4,5 kb35969 27 
abr 20051   10 1,4233 4,5 kb35969 27 
mar 20051   10 1,4233 4,5 kb35969 27 
fev 20051   10 1,423314,5 kb35969 27 
jan 20051   9 1,44811,9 kb72 9   
dez 20041   10 1,2233 4,5 kb35969 27 
nov 20041   10 1,2233 4,5 kb35969 27 
out 20041   10 1,2233 4,5 kb35969 27 
set 20041   10 1,2233 4,5 kb35969 27 
ago 20041   10 1,2233 4,5 kb35969 27 
jul 2004111 10 1,2233124,5 kb35969 27 
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
The following table ranks this project in relation to projects in other languages with 1000+ articles
jan 2015116387643556270104627586824510571126
out 2014116377747535968104527486824310570126
jul 2014116308047516068104597186824210670126
abr 2014116337748505669103587186814210570126
jan 201411541844948446899506883784211569126
out 201311539764647617099456882764211569126
jul 201311440805146507196446680744111568126
abr 201311337785046447496436577734111467126
jan 201311143805446407395436475734111465126
out 2012109347549525639476479704211465126
jul 201210949875360675493537687684911463126
abr 201210940785260665894467687684911563126
jan 201210835764959606592527585675011664126
out 201110836764469793923397968192116112126
jul 2011112427948120669191116122126124115113111126
abr 2011109348045118629090112121126123115113110126
jan 2011108357650118608888111121124122115112109126
out 2010115369380120608787118122125122116110109126
jul 2010115439789120638787115122125122116109108126
abr 2010119461198012357858511512212111912010763126
jan 2010118301157512259818111812212111811810663126
out 2009117391167812257818112012212011811810563126
jul 2009115391107912160797911512112011711710561126
abr 2009120481097812152767612112111911711710460126
jan 200911659804211856747410911911811411210259126
out 200811536704111859747410711811811411210156125
jul 200811431694511757737311111711711211310054125
abr 200811242744711560696910511611511011210051125
jan 20081104372511145966661061151141101119950125
out 20071093871491136163631061141121081099744125
jul 20071074270431105763631151131111081099447125
abr 20071043973461086060601061091071081098943125
jan 2007994479421036353531011051051041047944125
out 200696386542955249499499991011037043125
jul 2006953863379249454592979698976039125
abr 2006933652348846414188999395975140125
jan 20069744563478413636102898187974241119
out 2005913350267235303076817584793935107
jul 2005873242256534262672747077702830102
abr 200579254221592920207271657065213093
jan 200571233619532415155671746759166482
out 20046027311637201010554542524292670
jul 200448172510301644293634413172454
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100ediçõesbytes
 WikcionaristasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikcionaristas (usuários registrados)
A = Wikcionaristas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikcionaristas que editaram pelo menos dez vezes desde que chegaram
C = Wikcionaristas que contribuíram cinco vezes ou mais este mês
D = Wikcionaristas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  2500  10000  5  10  100  1000  10000  1  3  5  10  1  3  5  10  25  5  10  100 
Monthly counts for recent history of wiki
fev 20152       222  31   51   11 
jan 2015        332  11   221  111
dez 20141       332  1    2    111
nov 20141       11   21   21   11 
out 20142       111  1    21      
set 2014        1111 3    411  1  
ago 20142       2221      31   11 
jul 2014        222               
jun 20141       221               
mai 201411      221       1       
abr 20142       221       7       
mar 20146       221  1    2       
fev 20142       222  1    3       
jan 20141       3321 1    521  11 
dez 2013        3321 2    3       
nov 2013        1111 1    7       
out 20131       111  1    411     
set 2013        221  21   3211    
ago 20132       5521      4       
jul 20131       2211      41   1  
jun 20132       221  1    21      
mai 20131       3311      3       
abr 20133       6621      41   11 
mar 2013        553  1    211  11 
fev 20132       554  1    51      
jan 20131       7731      1       
Quarterly counts for entire history of wiki
jan 2015        332  11   221  111
out 20142       111  1    21      
jul 2014        222               
abr 20142       221       7       
jan 20141       3321 1    521  11 
out 20131       111  1    411     
jul 20131       2211      41   1  
abr 20133       6621      41   11 
jan 20131       7731      1       
out 201231      664313    531  11 
jul 20122       762  1    41      
abr 20122       6621 11   111  1  
jan 20123       553       3    21 
out 2011111111111 22   1    51111   
jul 2011             1    211     
abr 201111      1         211     
jan 2011        1         31      
out 2010111                1       
jul 2010111                        
abr 20102                 51      
jan 20101            1    1111    
out 2009                  2       
jul 20091                 3       
abr 2009                  211     
jan 2009                  211     
out 2008             1    422     
jul 2008                  1       
abr 2008                          
jan 2008             1    2       
out 2007             3    31      
jul 2007                          
abr 2007                          
jan 2007             1    1       
out 2006        1         1       
jul 20061                 1       
abr 2006                          
jan 2006             1    5       
out 2005                          
jul 2005                          
abr 2005                          
jan 20051                         
out 2004                          
jul 2004111                        

 

Distribuição de edições de artigos por wikcionaristas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikcionaristasEdições total
153100.0%35,421100.0%
31426.4%35,36499.8%
1059.4%35,30999.7%
3223.8%35,25599.5%
10011.9%35,17999.3%
31611.9%35,17999.3%
100011.9%35,17999.3%
316211.9%35,17999.3%
1000011.9%35,17999.3%
3162311.9%35,17999.3%

 

2 wikcionaristas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions
agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
Al SilonovUC8 071--fev 05, 2013752----
K9re11UC52...11--fev 20, 20157----

 

20 wikcionaristas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
JagwarUC135,179out 31, 20111215out 17, 2012863
InterwicketUC276fev 12, 20092206out 29, 20101582
ŢħėőďŏŗǽUC319abr 24, 20101770mai 28, 20101736
UbuinUC416dez 22, 20101528dez 28, 20101522
CraikabulaUC59jul 12, 20043882jul 12, 20043882
TAKASUGI ShinjiUC69nov 15, 20111200jan 18, 2013770
OoswesthoesbesUC79mar 06, 20121088out 23, 2012857
KusurijaUC95jul 28, 2012944ago 02, 2013574
YoodhaaUC104abr 06, 20111423jun 02, 20111366
PiRSquared17UC114mai 08, 20121025abr 25, 2013673
PolyglottosUC124nov 11, 2012838nov 11, 2012838
MalaysiaboyUC134fev 20, 2014372ago 16, 2014195
Le diableUC143nov 16, 20101564nov 16, 20101564
Thamizhpparithi MaariUC153jan 27, 20121127fev 08, 20121115
KoreanQuoterUC163fev 21, 2013736abr 19, 2014314
PopolonUC173jan 30, 2014393fev 13, 2014379
Bond127UC183mai 27, 2014276mai 28, 2014275
KoavfUC192jul 29, 20063135jul 29, 20063135
SpacebirdyUC202jun 25, 20082438jun 25, 20082438
IzurawiUC212nov 23, 20101557nov 23, 20101557

 

usuários anônimos, ordenados por número de contribuições
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
87.217.184.204261
87.217.184.209128
87.217.185.18758
87.217.184.12749
87.217.184.22648
87.217.185.11646
87.217.184.341
177.17.185.22130
87.217.184.7022
179.179.46.21820

No total 877 edições foram feitas por usuários anônimos, de um total de 124385 edições ( 0e %)
  


17 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
HydrizBotUC125,434abr 23, 20121040jan 24, 201534--
Bot-JagwarUC221,495dez 30, 20111155dez 12, 201280720,307-
JAnDbotUC317,616jun 03, 20111365fev 28, 2015---
Luckas-botUC48,247dez 17, 20101533jan 27, 2014396--
KamikazeBotUC56,237out 18, 20111228mar 07, 2013722--
YS-BotUC63,803set 07, 2012903fev 26, 20151--
WikitanvirBotUC71,507abr 18, 20111411jan 19, 20121135--
AvocatoBotUC81,457nov 01, 20111214ago 28, 2013548--
VolkovBotUC9920set 12, 20082359abr 18, 2013680--
WarddrBOTUC10888jul 24, 2012948ago 22, 2013554--
CarsracBotUC11233nov 19, 2012830mai 30, 2013638--
Makecat-botUC12176nov 10, 2012839abr 05, 2013693--
RobotGMwiktUC1342jun 30, 20063164mai 27, 20082467--
GhalyBotUC1419dez 29, 2012790jan 18, 2013770--
SpaceBirdyBotUC155jul 15, 20082418fev 02, 20092216--
RoggBotUC163dez 14, 20101536jan 18, 20111501--
JackBotUC172ago 23, 2014188ago 23, 2014188--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110
fev 201531 k4066 1134 53      2
jan 201531 k4016 1134 53       
dez 201431 k3996 1134 49      1
nov 201431 k3986 1133 45      2
out 201431 k3956 1133 45      2
set 201431 k3946 1132 45       
ago 201431 k3906 1132 45      3
jul 201431 k3866 1132 45       
jun 201431 k3866 1132 45      1
mai 201431 k3866 1132 45      3
abr 201431 k3866 1132 45      2
mar 201431 k3816 1124 44      6
fev 201431 k3796 1124 44      3
jan 201431 k3756 1124 44      1
dez 201331 k3676 1124 44       
nov 201331 k3666 1124 40       
out 201331 k3636 1124 40      1
set 201331 k3596 1124 40       
ago 201331 k3426 1124 40      2
jul 201331 k3386 1124 40      1
jun 201331 k3336 1124 40      2
mai 201331 k3316 1124 40      1
abr 201331 k3296 1124 40      4
mar 201331 k3256 1124 40       
fev 201331 k3176 1124 40      3
jan 201331 k3116 1124 40      2
dez 201231 k3106 1123 40      2
nov 201231 k3056 1123 40      5
out 201231 k3036 1123 40      6
set 201211 k2976 1120 40       
ago 201211 k2916 1120 40      4
jul 201211 k2866 1120 40      2
jun 201211 k2826 1120 40       
mai 201211 k2706 1120 40      1
abr 201211 k2636 1120 40      2
mar 201211 k2556 1120 40      5
fev 201211 k2516 1120 40      4
jan 201211 k2416 1120 40      4
dez 201111 k2366 1120 40       
nov 201111 k2316 1120 40      18143
out 20115,1 k2166 1101 18      5369
set 2011552106 183 4       
ago 2011552066 183 4       
jul 2011552016 183 4       
jun 2011551926 183 4      1
mai 2011541896 183 4       
abr 2011541846 183 4      3
mar 2011511746 183 4       
fev 2011511746 183 4       
jan 2011511665 183 4       
dez 2010511615 183 4      17
nov 2010391595 183 4      8
out 2010351555  83 4      5
set 2010351545  83 4      3
ago 2010351495  83 4      10
jul 2010351345  83 4      9
jun 2010341345  83 4      16
mai 2010251185  81 2      20
abr 2010221153  80         
mar 2010221083  80         
fev 2010221063  80         
jan 2010221043  80         
dez 200922913  80         
nov 200922893  80         
out 200922883  80         
set 200922863  80         
ago 200922813  80         
jul 200922813  80         
jun 200922793  80         
mai 200922773  79         
abr 200922763  79         
mar 200922683  79         
fev 200922643  79         
jan 200922583  79         
dez 200822583  79         
nov 200822583  79         
out 200822433  79         
set 200822323  79         
ago 200822313  79         
jul 200822303  79         
jun 200822303  79         
mai 200821262  79         
abr 200821242  79         
mar 200821242  79         
fev 200821232  79         
jan 200821232  79         
dez 200721222  79         
nov 200721202  79         
out 200721202  79         
set 200721182  79         
ago 20072116   79         
jul 20072114   79         
jun 20072114   79         
mai 20072014   79         
abr 20072014   79         
mar 20072014   79         
fev 20072014   79         
jan 20072014   79         
dez 20062013   78         
nov 20062013   78         
out 20062013   78         
set 20062011   78         
ago 20062010   78         
jul 20062010   78         
jun 2006199   78         
mai 2006198   78         
abr 2006198   78         
mar 2006198   78         
fev 2006198   78         
jan 2006108   78         
dez 2005105   78         
nov 2005101   78         
out 2005101   78         
set 2005101   78         
ago 2005101   78         
jul 2005101   78         
jun 2005101   78         
mai 2005101   78         
abr 2005101   78         
mar 200510    78         
fev 200510    78         
jan 200510    78         
dez 200410    78         
nov 200410    78         
out 200410    78         
set 200410    78         
ago 200410    78         
jul 200410    78         

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

jul 2004: 1 1 viti

jan 2005: 1 1 Tabana levu

fev 2005: 1 1 Tabana levu

fev 2006: 1 1 Viti

jul 2006: 1 1 main Page

dez 2006: 1 1 Tabana levu

jun 2008: 1 1 Main Page

fev 2009: 1 1 viti

mar 2009: 1 1 viti

mai 2009: 1 1 gone

jun 2009: 1 1 manu

jul 2009: 1 1 viti

ago 2009: 1 1 manu

set 2009: 1 1 tolu

jan 2010: 1 1 manu

fev 2010: 1 1 turaga

mar 2010: 1 1 dua

abr 2010: 1 1 manu

mai 2010: 1 2 yapolo , 2 1 Vosa Vaka-viti

jun 2010: 1 1 bière

jul 2010: 1 1 man

ago 2010: 1 1 man

set 2010: 1 1 papillon

out 2010: 1 1 butterfly

nov 2010: 1 2 yapolo , 2 1 பெண்

dez 2010: 1 1 bebe

abr 2011: 1 1 விலங்கு

jun 2011: 1 1 தேங்காய்

out 2011: 1 1 modig

nov 2011: 1 2 ผู้ชาย , 2 2 писати , 3 2 aujourd'hui , 4 2 don't , 5 2 boil (n) , 6 2 Tabana levu , 7 1 don’t

jan 2012: 1 1 l’

fev 2012: 1 1 আদমি

mar 2012: 1 1 آدمی

abr 2012: 1 2 basikete

mai 2012: 1 1 Tabana levu

jul 2012: 1 1

ago 2012: 1 1

out 2012: 1 1 šiandien

nov 2012: 1 2 owl , 2 1 inkosi

dez 2012: 1 1

jan 2013: 1 1 아니오

fev 2013: 1 1 gnjevan

abr 2013: 1 2 Tabana levu , 2 1 bankovka

mai 2013: 1 1 kort

jun 2013: 1 1 johr

jul 2013: 1 1 אופניים

ago 2013: 1 1 bačva

out 2013: 1 1 plorar

jan 2014: 1 1 簡單

fev 2014: 1 1 中間

mar 2014: 1 1 øje

abr 2014: 1 1 дам

mai 2014: 1 1 سافر

jun 2014: 1 1 извинение

ago 2014: 1 1 Ogos

out 2014: 1 1 pizza

nov 2014: 1 1 ವುತ್ತು

dez 2014: 1 1 tiggare

fev 2015: 1 1 សរសេរ

No data on this page have been normalized to 30 day months (as WMF does on certain traffic reports).
Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Sexta-feira, 27 de março 2015 00:00

Dump file fjwiktionary-20150309-pages-meta-history.xml.7z (full dump), size 7.3 Mb as 7z -> 90 Mb
Dump processed till Feb 28, 2015, on server stat1002, ready at Thu-12/03/2015-02:31 after 1 min, 10 sec.

Versão do script:2.6
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.