Estatísticas da Wikcionário fijiano

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist

Metrics have been collected from a full archive dump, which contains all revisions of every article, meta data and raw content.
See also metrics definitions


 
Monthly counts & Quarterly rankings: maio 2014
 
DataWikcionaristasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
mai 2014    0%   +7%0%0%0%0% 0% 
abr 2014    0%   -42%0%0%0%0% 0% 
mar 2014    0%   -11%0%0%0%0% 0% 
fev 2014    0%   -58%0%0%0%0% 0% 
jan 2014    0%   -50%+1%0%0%+1% 0% 
dez 2013    +1%   +137%+1%+1%0%+2% 0% 
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
mai 20146   25 k24,6423026,2 Mb153 k12 k318 k45218
abr 20146   25 k 4,6422816,1 Mb152 k12 k318 k45218
mar 20146   25 k14,6424826,1 Mb152 k12 k317 k25218
fev 20146   25 k24,6425416,1 Mb152 k12 k316 k15218
jan 20146   25 k24,6421,3 k6,1 Mb152 k12 k315 k15218
dez 20136   25 k64,5422,6 k6,1 Mb152 k12 k312 k15218
nov 20136   25 k 4,5421,1 k6,0 Mb150 k12 k308 k15218
out 20136   25 k 4,4426936,0 Mb150 k12 k306 k15218
set 20136   25 k 4,4422056,0 Mb150 k12 k305 k15218
ago 20136   25 k44,4423,5 k6,0 Mb150 k12 k305 k15218
jul 20136   25 k24,3421,8 k5,9 Mb150 k12 k301 k15218
jun 20136   25 k 4,2421,0 k5,9 Mb149 k12 k299 k15218
mai 20136   25 k 4,2422,3 k5,9 Mb149 k12 k297 k15218
abr 20136   25 k44,1421,5 k5,8 Mb149 k12 k295 k15218
mar 20136   24 k44421,3 k5,8 Mb148 k12 k293 k15218
fev 20136   24 k104421,4 k5,8 Mb148 k12 k291 k15218
jan 20136   24 k74422,6 k5,7 Mb146 k12 k287 k15218
dez 20126   24 k453,9423,1 k5,6 Mb144 k12 k283 k15217
nov 20126   22 k1454425,6 k5,5 Mb135 k12 k271 k15217
out 20126   18 k2294,74229 k5,1 Mb107 k12 k248 k15217
set 20126   11 k 5,1421,1 k2,7 Mb62 k12 k150 k15217
ago 20126   11 k 5429652,7 Mb62 k12 k149 k15217
jul 20126   11 k 4,9421,1 k2,7 Mb62 k12 k148 k15217
jun 20126   11 k 4,8421,0 k2,6 Mb62 k12 k146 k15217
mai 20126   11 k 4,7421,3 k2,6 Mb62 k12 k144 k15217
abr 20126   11 k 4,6421,7 k2,6 Mb62 k12 k141 k15217
mar 20126 1 11 k 4,4421,1 k2,5 Mb62 k12 k139 k15217
fev 20126   11 k 4,3421,5 k2,5 Mb62 k12 k136 k15217
jan 20126   11 k 4,2421,2 k2,4 Mb62 k12 k132 k 5217
dez 20116   11 k 4,1424,2 k2,4 Mb62 k13 k128 k 5216
nov 20116 1111 k1923,74235 k1,9 Mb62 k13 k94 k 5216
out 201161115,1 k1641,1305,4 k356 kb19 k4,1 k6,9 k  13
set 20115   42 7,4361023 kb282151,2 k  12
ago 20115   42 7,236123 kb282151,2 k  12
jul 20115   42 7,236223 kb282151,2 k  12
jun 20115   42 7,136923 kb282151,2 k  12
mai 20115   41 7,137423 kb279151,1 k  12
abr 20115   41 7371422 kb279151,1 k  12
mar 20115   38 7,239322 kb273151,1 k  12
fev 20115   38 7,139 22 kb273151,1 k  12
jan 20115   38 7,1391122 kb273151,1 k  12
dez 2010511 38 6,8393319 kb27315892  12
nov 20104   26 8,734815 kb16911673  12
out 20104 1 22 9,938515 kb15910653  12
set 20104   22 9,638315 kb15910648  12
ago 20104 1 22 9,5381015 kb15910645  12
jul 20104 1 22 9381015 kb15910635  12
jun 20104 1 21 9393614 kb15510565  12
mai 2010411 12 12,845205,9 kb104 168  12
abr 20103   11 12,122556,8 kb37412170 2711
mar 20103 1 11 11,622556,8 kb37412170 2711
fev 20103   11 11,222516,7 kb37412165 2711
jan 20103   11 11,122526,7 kb37412164 2711
dez 20093   11 10,9225 6,7 kb37412162 2711
nov 20093   11 10,9225 6,7 kb37412162 2711
out 20093   11 10,9225 6,7 kb37412162 2711
set 20093   11 10,922546,7 kb37412162 2711
ago 20093   11 10,522546,6 kb37412158 2711
jul 20093   11 10,222526,6 kb37412154 2711
jun 200931  11 1022536,5 kb37412152 2711
mai 20092   11 9,722526,5 kb37412149 2711
abr 20092   11 9,5225 6,5 kb37412147 2711
mar 20092   11 9,522536,5 kb37412147 2711
fev 20092   11 9,322546,7 kb37412156 2711
jan 20092   11 8,922526,6 kb37412151 2711
dez 20082   11 8,7225 6,6 kb37412149 2711
nov 20082   11 8,722516,6 kb37412149 2711
out 20082   11 8,622516,6 kb37412148 2711
set 20082   11 8,522566,6 kb37412146 2711
ago 20082   11 8225 6,3 kb37412123 2711
jul 20082   11 822526,3 kb37412123 2711
jun 20082   11 7,822526,2 kb37412117 2711
mai 20082   11 7,622526,2 kb37412117 2710
abr 20082   11 7,5225 6,0 kb3741298 2710
mar 20082   11 7,5225 6,0 kb3741298 2710
fev 20082   11 7,5225 6,0 kb3741298 2710
jan 20082   11 7,5225 6,0 kb3741298 2710
dez 20072   11 7,5225 6,0 kb3741298 2710
nov 20072   11 7,5225 6,0 kb3741298 2710
out 20072   11 7,5225 6,0 kb3741298 2710
set 20072   11 7,5225 6,0 kb3741298 2710
ago 20072   11 7,5225 6,0 kb3741298 2710
jul 20072   11 7,5225 6,0 kb3741298 2710
jun 20072   11 7,522536,0 kb3741298 2710
mai 20072   10 7,923325,8 kb359695 2710
abr 20072   10 7,723315,8 kb359695 2710
mar 20072   10 7,623345,8 kb359694 2710
fev 20072   10 7,223355,7 kb359690 2710
jan 20072   10 6,723345,7 kb359686 2710
dez 20062   10 6,323345,6 kb359684 2710
nov 20062   10 5,923665,6 kb361680 2710
out 20062   10 5,323375,5 kb359675 2710
set 20062   10 4,6233 5,4 kb359662 2710
ago 20062   10 4,6233 5,4 kb359662 2710
jul 20062   10 4,623325,4 kb359662 2710
jun 20062   10 4,4233105,3 kb359662 279
mai 20062   10 3,4233 4,7 kb359612 279
abr 20062   10 3,4233 4,7 kb359612 279
mar 20062   10 3,4233 4,7 kb359612 279
fev 2006211 10 3,4233194,7 kb359612 279
jan 20061   10 1,5233 4,5 kb359612 27 
dez 20051   10 1,5233 4,5 kb359612 27 
nov 20051   10 1,5233 4,5 kb359612 27 
out 20051   10 1,5233 4,5 kb359612 27 
set 20051   10 1,5233 4,5 kb359612 27 
ago 20051   10 1,5233 4,5 kb359612 27 
jul 20051   10 1,5233 4,5 kb359612 27 
jun 20051   10 1,523314,5 kb359612 27 
mai 20051   10 1,4233 4,5 kb35969 27 
abr 20051   10 1,4233 4,5 kb35969 27 
mar 20051   10 1,4233 4,5 kb35969 27 
fev 20051   10 1,423314,5 kb35969 27 
jan 20051   9 1,44811,9 kb72 9   
dez 20041   10 1,2233 4,5 kb35969 27 
nov 20041   10 1,2233 4,5 kb35969 27 
out 20041   10 1,2233 4,5 kb35969 27 
set 20041   10 1,2233 4,5 kb35969 27 
ago 20041   10 1,2233 4,5 kb35969 27 
jul 2004111 10 1,2233124,5 kb35969 27 
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
The following table ranks this project in relation to projects in other languages with 1000+ articles
abr 2014103327647495470103577185804210570110
jan 2014102438449474469100506983784210769110
out 2013102407646466071100456982764210769110
jul 201310140795145497197446780744110768110
abr 201310035775145427497436677734110666110
jan 201310042775445407396436474734110665110
out 201299347649515649576478704210665110
jul 20129944825160645794537686684910564110
abr 20129939755260656095467686684910664110
jan 20129635724959596792527584675010864110
out 20119635704269792913397958289108102110
jul 2011101417748108659090106109110109107107102110
abr 201198327543108598989106109110109107105101110
jan 201197357550108608787106109110108107105100110
out 2010103357680108608686107109110108107104100110
jul 201010342868710864868610710911010810710299110
abr 201010744107801095784841061091081071079863110
jan 201010631106761085880801061091081061069863110
out 200910438103761085679791071091081061059763110
jul 200910439101761085777771051091081061059761110
abr 200910745101751085075751071091071061059760110
jan 20091035977421065674741031071061041019659110
out 2008102367041106597474981061061041019456109
jul 20081012868451055773731011051051021019354109
abr 2008100437447104606969981041041001009251109
jan 2008974171501025866669710210299999050109
out 2007953771491016163639610110097978944109
jul 2007954067439955636310410110097978747109
abr 2007933869449859606094999898968243109
jan 2007894476439561535391979896947744109
out 2006883762428951494987939494937143109
jul 2006873964368849454588939393886638109
abr 2006853752358346414183938988885837109
jan 2006874256347341363692857982865039104
out 200581334926703530307478758074473498
jul 200576314125643426266872707366382993
abr 200571244021593020206769656762342984
jan 200564223519532415155467686656265976
out 200451232716362010105044415140192566
jul 2004431524103016442936334131162452
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100ediçõesbytes
 WikcionaristasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikcionaristas (usuários registrados)
A = Wikcionaristas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikcionaristas que editaram pelo menos dez vezes desde que chegaram
C = Wikcionaristas que contribuíram cinco vezes ou mais este mês
D = Wikcionaristas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  2500  10000  5  10  100  1000  10000  1  3  5  10  1  3  5  10  25  5  10 
Monthly counts for recent history of wiki
mai 201411      221       1      
abr 20142       221       9      
mar 20146       221  1    3      
fev 20142       222  1    51     
jan 20141       3321 1    6211 11
dez 2013        3321 2    61     
nov 2013        1111 1    8      
out 20131       111  1    511    
set 2013        221  21   42111  
ago 20132       5521      4      
jul 20131       2211      51   1 
jun 20132       221  1    21     
mai 20131       3311      3      
abr 20133       6621      41   11
mar 2013        553  1    211  11
fev 20132       554  1    611    
jan 20131       7731      3      
dez 20122       8852 1    42     
nov 201221      9832      3    1 
out 201231      664313    531  11
set 2012        661       211  11
ago 20123       663  3    311  11
jul 20122       762  1    61     
jun 2012        662  1    421  11
mai 20121       654  2    51     
abr 20122       6621 11   2111 1 
mar 2012111      444  2    41     
fev 20123       3331 5    6211   
jan 20123       553       31   21
Quarterly counts for entire history of wiki
abr 20142       221       9      
jan 20141       3321 1    6211 11
out 20131       111  1    511    
jul 20131       2211      51   1 
abr 20133       6621      41   11
jan 20131       7731      3      
out 201231      664313    531  11
jul 20122       762  1    61     
abr 20122       6621 11   2111 1 
jan 20123       553       31   21
out 2011111111111 22   1    52111  
jul 2011             1    311    
abr 201111      1         2111   
jan 2011        1         31     
out 2010111                2      
jul 2010111                       
abr 20102                 621    
jan 20101            1    1111   
out 2009                  2      
jul 20091                 3      
abr 2009                  211    
jan 2009                  211    
out 2008             1    422    
jul 2008                  1      
abr 2008                         
jan 2008             1    2      
out 2007             3    41     
jul 2007                         
abr 2007                         
jan 2007             1    1      
out 2006        1         1      
jul 20061                 1      
abr 2006                         
jan 2006             1    5      
out 2005                         
jul 2005                         
abr 2005                         
jan 20051                        
out 2004                         
jul 2004111                       

 

Distribuição de edições de artigos por wikcionaristas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikcionaristasEdições total
147100.0%35,411100.0%
31327.7%35,35999.9%
10510.6%35,30999.7%
3224.3%35,25599.6%
10012.1%35,17999.3%
31612.1%35,17999.3%
100012.1%35,17999.3%
316212.1%35,17999.3%
1000012.1%35,17999.3%
3162312.1%35,17999.3%

 

1 wikcionaristas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions
agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
Bond127UC17...33--mai 27, 20143----

 

20 wikcionaristas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
JagwarUC135,179out 31, 2011942out 17, 2012590
InterwicketUC276fev 12, 20091933out 29, 20101309
ŢħėőďŏŗǽUC319abr 24, 20101497mai 28, 20101463
UbuinUC416dez 22, 20101255dez 28, 20101249
CraikabulaUC59jul 12, 20043609jul 12, 20043609
TAKASUGI ShinjiUC69nov 15, 2011927jan 18, 2013497
OoswesthoesbesUC79mar 06, 2012815out 23, 2012584
Al SilonovUC86fev 05, 2013479out 25, 2013217
KusurijaUC95jul 28, 2012671ago 02, 2013301
YoodhaaUC104abr 06, 20111150jun 02, 20111093
PiRSquared17UC114mai 08, 2012752abr 25, 2013400
PolyglottosUC124nov 11, 2012565nov 11, 2012565
Le diableUC133nov 16, 20101291nov 16, 20101291
Thamizhpparithi MaariUC143jan 27, 2012854fev 08, 2012842
KoreanQuoterUC153fev 21, 2013463abr 19, 201441
PopolonUC163jan 30, 2014120fev 13, 2014106
KoavfUC182jul 29, 20062862jul 29, 20062862
SpacebirdyUC192jun 25, 20082165jun 25, 20082165
IzurawiUC202nov 23, 20101284nov 23, 20101284
MercyUC212nov 24, 20101283nov 24, 20101283

 

usuários anônimos, ordenados por número de contribuições
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
87.217.184.204261
87.217.184.209128
87.217.185.18758
87.217.184.12749
87.217.184.22648
87.217.185.11646
87.217.184.341
177.17.185.22130
87.217.184.7022
87.217.185.11716

No total 857 edições foram feitas por usuários anônimos, de um total de 116054 edições ( 0e %)
  


16 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
HydrizBotUC124,986abr 23, 2012767ago 23, 2013280--
Bot-JagwarUC221,495dez 30, 2011882dez 12, 201253420,308-
JAnDbotUC311,418jun 03, 20111092mai 28, 20142--
Luckas-botUC48,247dez 17, 20101260jan 27, 2014123--
KamikazeBotUC56,237out 18, 2011955mar 07, 2013449--
YS-BotUC62,151set 07, 2012630mai 28, 20142--
WikitanvirBotUC71,507abr 18, 20111138jan 19, 2012862--
AvocatoBotUC81,457nov 01, 2011941ago 28, 2013275--
VolkovBotUC9920set 12, 20082086abr 18, 2013407--
WarddrBOTUC10888jul 24, 2012675ago 22, 2013281--
CarsracBotUC11233nov 19, 2012557mai 30, 2013365--
Makecat-botUC12176nov 10, 2012566abr 05, 2013420--
RobotGMwiktUC1342jun 30, 20062891mai 27, 20082194--
GhalyBotUC1419dez 29, 2012517jan 18, 2013497--
SpaceBirdyBotUC155jul 15, 20082145fev 02, 20091943--
RoggBotUC163dez 14, 20101263jan 18, 20111228--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110
mai 201431 k4906 1132 45      3
abr 201431 k4906 1132 45      2
mar 201431 k4836 1124 44      6
fev 201431 k4806 1124 44      3
jan 201431 k4746 1124 44      1
dez 201331 k4636 1124 44       
nov 201331 k4606 1124 40       
out 201331 k4536 1124 40      1
set 201331 k4466 1124 40       
ago 201331 k4206 1124 40      2
jul 201331 k4166 1124 40      1
jun 201331 k4096 1124 40      2
mai 201331 k4066 1124 40      1
abr 201331 k4046 1124 40      4
mar 201331 k4006 1124 40       
fev 201331 k3916 1124 40      3
jan 201331 k3826 1124 40      2
dez 201231 k3786 1123 40      2
nov 201231 k3726 1123 40      5
out 201231 k3706 1123 40      6
set 201211 k3646 1120 40       
ago 201211 k3576 1120 40      4
jul 201211 k3486 1120 40      2
jun 201211 k3436 1120 40       
mai 201211 k3286 1120 40      1
abr 201211 k3216 1120 40      2
mar 201211 k3116 1120 40      5
fev 201211 k3066 1120 40      4
jan 201211 k2886 1120 40      4
dez 201111 k2826 1120 40       
nov 201111 k2776 1120 40      18143
out 20115,1 k2616 1101 18      5369
set 2011552526 183 4       
ago 2011552476 183 4       
jul 2011552416 183 4       
jun 2011552286 183 4      1
mai 2011542246 183 4       
abr 2011542156 183 4      3
mar 2011512046 183 4       
fev 2011512046 183 4       
jan 2011511955 183 4       
dez 2010511895 183 4      17
nov 2010391875 183 4      8
out 2010351815  83 4      5
set 2010351795  83 4      3
ago 2010351745  83 4      10
jul 2010351595  83 4      9
jun 2010341595  83 4      16
mai 2010251365  81 2      20
abr 2010221323  80         
mar 2010221213  80         
fev 2010221193  80         
jan 2010221173  80         
dez 2009221023  80         
nov 2009221003  80         
out 200922993  80         
set 200922963  80         
ago 200922893  80         
jul 200922893  80         
jun 200922873  80         
mai 200922853  79         
abr 200922833  79         
mar 200922743  79         
fev 200922693  79         
jan 200922633  79         
dez 200822633  79         
nov 200822633  79         
out 200822453  79         
set 200822343  79         
ago 200822333  79         
jul 200822323  79         
jun 200822323  79         
mai 200821282  79         
abr 200821262  79         
mar 200821262  79         
fev 200821242  79         
jan 200821242  79         
dez 200721232  79         
nov 200721212  79         
out 200721212  79         
set 200721182  79         
ago 20072116   79         
jul 20072114   79         
jun 20072114   79         
mai 20072014   79         
abr 20072014   79         
mar 20072014   79         
fev 20072014   79         
jan 20072014   79         
dez 20062013   78         
nov 20062013   78         
out 20062013   78         
set 20062011   78         
ago 20062010   78         
jul 20062010   78         
jun 2006199   78         
mai 2006198   78         
abr 2006198   78         
mar 2006198   78         
fev 2006198   78         
jan 2006108   78         
dez 2005105   78         
nov 2005101   78         
out 2005101   78         
set 2005101   78         
ago 2005101   78         
jul 2005101   78         
jun 2005101   78         
mai 2005101   78         
abr 2005101   78         
mar 200510    78         
fev 200510    78         
jan 200510    78         
dez 200410    78         
nov 200410    78         
out 200410    78         
set 200410    78         
ago 200410    78         
jul 200410    78         

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

jul 2004: 1 1 viti

jan 2005: 1 1 Tabana levu

fev 2005: 1 1 Tabana levu

fev 2006: 1 1 Viti

jul 2006: 1 1 main Page

dez 2006: 1 1 Tabana levu

jun 2008: 1 1 Main Page

fev 2009: 1 1 viti

mar 2009: 1 1 viti

mai 2009: 1 1 gone

jun 2009: 1 1 manu

jul 2009: 1 1 viti

ago 2009: 1 1 manu

set 2009: 1 1 tolu

jan 2010: 1 1 manu

fev 2010: 1 1 turaga

mar 2010: 1 1 dua

abr 2010: 1 1 manu

mai 2010: 1 2 yapolo , 2 1 Vosa Vaka-viti

jun 2010: 1 1 bière

jul 2010: 1 1 man

ago 2010: 1 1 man

set 2010: 1 1 papillon

out 2010: 1 1 butterfly

nov 2010: 1 2 yapolo , 2 1 பெண்

dez 2010: 1 1 bebe

abr 2011: 1 1 விலங்கு

jun 2011: 1 1 தேங்காய்

out 2011: 1 1 modig

nov 2011: 1 2 ผู้ชาย , 2 2 писати , 3 2 aujourd'hui , 4 2 don't , 5 2 boil (n) , 6 2 Tabana levu , 7 1 don’t

jan 2012: 1 1 l’

fev 2012: 1 1 আদমি

mar 2012: 1 1 آدمی

abr 2012: 1 2 basikete

mai 2012: 1 1 Tabana levu

jul 2012: 1 1

ago 2012: 1 1

out 2012: 1 1 šiandien

nov 2012: 1 2 owl , 2 1 inkosi

dez 2012: 1 1

jan 2013: 1 1 아니오

fev 2013: 1 1 gnjevan

abr 2013: 1 2 Tabana levu , 2 1 bankovka

mai 2013: 1 1 kort

jun 2013: 1 1 johr

jul 2013: 1 1 אופניים

ago 2013: 1 1 bačva

out 2013: 1 1 plorar

jan 2014: 1 1 簡單

fev 2014: 1 1 中間

mar 2014: 1 1 øje

abr 2014: 1 1 дам

mai 2014: 1 1 سافر

No data on this page have been normalized to 30 day months (as WMF does on certain traffic reports).
Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Segunda-feira, 30 de junho 2014 21:41

Dump file fjwiktionary-20140622-pages-meta-history.xml.7z (full dump), size 6.8 Mb as 7z -> 81 Mb
Dump processed till May 31, 2014, on server stat1002, ready at Sun-22/06/2014-19:45 after 1 min, 7 sec.

Versão do script:2.6
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.