Estatísticas da Wikcionário malaio

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist

Metrics have been collected from a full archive dump, which contains all revisions of every article, meta data and raw content.
See also metrics definitions


 
Monthly counts & Quarterly rankings: junho 2014
 
DataWikcionaristasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
jun 20140%   +1%   -67%+1%+1%+1%+1%+1%0%0%
mai 20140%   +6%   +9%+4%+4%+4%+4%+7%+4%0%
abr 20140%   +5%   -39%+3%+4%+2%+3%+5%0%0%
mar 20140%   +9%   +22%+4%+4%+4%+5%+7%+11%0%
fev 20140%   +2%   +132%+2%+2%0%+2%+1%0%0%
jan 2014+4%   0%   -34%0%0%0%+1%0%0%0%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
jun 201426 1 2,1 k116,9964703,4 Mb326 k22 k29 k52996191
mai 201426 312,1 k317,19692123,3 Mb323 k21 k29 k52296191
abr 201426 211,9 k317,99901943,2 Mb311 k20 k27 k48792191
mar 201426 211,9 k518,710073203,1 Mb299 k20 k27 k46692191
fev 201426 211,7 k120,210552623,0 Mb287 k19 k25 k43683191
jan 20142612 1,7 k 20,510641132,9 Mb282 k19 k25 k43383191
dez 201325 1 1,7 k 20,410631712,9 Mb282 k19 k25 k43283191
nov 201325 2 1,7 k 20,31063482,9 Mb282 k19 k25 k43283191
out 201325 1 1,7 k 20,3106282,9 Mb281 k19 k25 k43283191
set 201325 2 1,7 k 20,31062182,9 Mb281 k19 k25 k43283191
ago 201325 1 1,7 k 20,310622242,9 Mb281 k19 k25 k43283191
jul 201325 2 1,7 k 20,210621522,9 Mb281 k19 k24 k43283191
jun 201325 2 1,7 k 20,110541092,9 Mb278 k19 k24 k43183191
mai 201325 1 1,7 k 20,210581032,9 Mb278 k19 k24 k43183190
abr 201325 1 1,7 k 20,11058992,9 Mb278 k19 k24 k43083190
mar 201325 1 1,6 k 20,11060972,9 Mb277 k19 k24 k42883190
fev 201325 2 1,6 k420,110592682,9 Mb277 k19 k24 k42882190
jan 201325 2 1,5 k121,211192322,8 Mb274 k19 k20 k42827190
dez 201225 1 1,5 k 21,411341472,8 Mb274 k19 k20 k42826190
nov 201225 1 1,5 k121,311341332,8 Mb274 k19 k19 k42827190
out 201225   1,5 k 21,611382182,7 Mb269 k19 k19 k42726187
set 201225   1,5 k 21,511381772,7 Mb268 k19 k19 k42726187
ago 201225 1 1,5 k 21,411321612,7 Mb267 k19 k19 k42626187
jul 20122511 1,5 k 21,311311012,7 Mb266 k19 k19 k42026187
jun 201224 2 1,5 k 21,311251822,7 Mb264 k19 k19 k41826187
mai 201224 2 1,5 k 21,211251552,7 Mb263 k19 k18 k41826186
abr 201224 1 1,5 k 21,211271252,7 Mb263 k19 k18 k41526186
mar 201224 1 1,5 k 21,111271212,7 Mb263 k19 k18 k41426186
fev 201224 1 1,5 k 21,111271592,7 Mb262 k19 k18 k41426186
jan 2012241  1,5 k 20,911222462,7 Mb261 k19 k18 k41326186
dez 20112314 1,5 k120,811213452,7 Mb261 k19 k17 k41326186
nov 201122 1 1,4 k 2111291332,6 Mb257 k19 k16 k39925186
out 20112223 1,4 k 2111321132,6 Mb256 k19 k16 k39925186
set 201120   1,4 k 21,11129272,6 Mb254 k18 k16 k39825186
ago 201120 1 1,4 k 21,11129572,6 Mb254 k18 k16 k39825185
jul 201120   1,4 k 2111291882,6 Mb254 k18 k16 k39825185
jun 201120   1,4 k 20,91130472,6 Mb254 k18 k16 k39825185
mai 201120 1 1,4 k 20,911302602,6 Mb254 k18 k16 k39825185
abr 201120 1 1,4 k 20,81131912,6 Mb253 k18 k16 k39825184
mar 201120   1,4 k 20,711301312,6 Mb253 k18 k15 k39825184
fev 201120 1 1,4 k 20,61131712,6 Mb253 k18 k15 k39825184
jan 201120   1,4 k 20,61131522,6 Mb253 k18 k15 k39825184
dez 201020   1,4 k 20,51131762,6 Mb253 k18 k15 k39925184
nov 201020 111,4 k 20,511316702,6 Mb253 k18 k15 k39925184
out 201020 111,4 k 2011312682,6 Mb253 k18 k15 k39925184
set 201020 111,4 k 19,811313162,6 Mb253 k18 k14 k39925184
ago 2010201211,4 k 19,611311552,6 Mb253 k18 k14 k39925184
jul 201019 211,4 k 19,511315342,6 Mb253 k18 k14 k39923184
jun 201019 2 1,4 k 19,211321012,5 Mb253 k18 k13 k39623184
mai 201019 311,4 k 19,111313632,5 Mb252 k18 k13 k39523184
abr 2010191421,4 k 1911261,3 k2,5 Mb250 k18 k13 k39123184
mar 201018 321,4 k 18,211034592,5 Mb244 k18 k13 k38523184
fev 2010181321,4 k 1811057182,4 Mb243 k18 k13 k38323184
jan 201017 411,4 k 17,610891,1 k2,4 Mb239 k18 k12 k37822184
dez 200917 321,4 k 16,910701,3 k2,4 Mb234 k18 k12 k37822184
nov 200917 321,3 k 16,110481,0 k2,3 Mb228 k18 k12 k37122184
out 2009171421,3 k115,410351,1 k2,2 Mb224 k18 k12 k36622184
set 200916 321,3 k114,810198342,2 Mb219 k18 k12 k36122184
ago 200916 311,3 k214,410173832,1 Mb216 k17 k12 k35922184
jul 200916 311,3 k 14,610312642,1 Mb209 k16 k11 k34922184
jun 200916 321,3 k114,510261,1 k2,1 Mb208 k16 k11 k34822184
mai 200916 321,2 k 13,910329732,0 Mb206 k16 k11 k34522184
abr 200916 321,2 k 13,210295352,0 Mb204 k16 k11 k33922184
mar 200916 311,2 k 12,810306152,0 Mb203 k16 k11 k33520184
fev 2009161411,2 k 12,410293132,0 Mb202 k16 k9,8 k33320184
jan 200915 1 1,2 k 12,21032482,0 Mb201 k16 k9,1 k32720184
dez 20081511 1,2 k 12,21032562,0 Mb199 k16 k9,0 k32620184
nov 200814 3 1,2 k112,310271081,9 Mb198 k16 k9,0 k32220183
out 200814 3 1,2 k212,410372541,9 Mb196 k16 k8,8 k32120183
set 2008141311,1 k 12,710754371,9 Mb195 k16 k8,7 k31420183
ago 200813 2 1,1 k 12,41068691,9 Mb192 k15 k8,6 k31020183
jul 200813 1 1,1 k 12,41069681,9 Mb191 k15 k8,5 k30720183
jun 200813 1 1,1 k112,410681061,9 Mb190 k15 k8,5 k30620184
mai 200813 2 1,1 k 12,610642871,8 Mb186 k15 k8,3 k30220184
abr 200813 211,1 k212,510604461,8 Mb183 k15 k7,9 k29820184
mar 200813 221,0 k312,710426731,7 Mb170 k14 k7,7 k32320184
fev 200813 229161213,210401,9 k1,6 Mb155 k13 k6,9 k31220181
jan 200813131572917,710251,0 k1,0 Mb92 k7,0 k4,3 k24011181
dez 20071224 306129,71047119599 kb46 k1,3 k2,2 k1565180
nov 200710 1 283 31,7109225582 kb44 k1,2 k2,1 k1555179
out 200710 21277 32,310831,1 k570 kb43 k1,2 k2,1 k1495178
set 200710 31269129,21049653531 kb41 k1,2 k2,0 k1466179
ago 200710 21252 28,610851,6 k504 kb39 k1,1 k2,0 k1496179
jul 200710 21237 23,81027828423 kb36 k1,0 k1,9 k1466179
jun 200710 21223 21,6997964373 kb33 k9801,9 k1426153
mai 200710 31210118,3865869315 kb27 k9251,8 k1406153
abr 200710 21193 15,5827734259 kb24 k8581,7 k1356153
mar 200710 21182 12,4830565240 kb23 k7941,6 k1246134
fev 200710 21168110767516215 kb19 k7271,7 k1175750
jan 20071023114518,1681376170 kb15 k5951,4 k853041
dez 2006811 106 7,571540124 kb11 k3791,1 k19308
nov 20067 1 95 7,969435110 kb9,6 k3018832308
out 20067 2 87 8,26437097 kb8,2 k2447722308
set 20067 1 76 8,55574978 kb6,2 k1856961307
ago 20067 2164 9,357815373 kb5,4 k1565641447
jul 2006712154 8,245115853 kb3,7 k1244961447
jun 20066 2 46 6,24652945 kb3,3 k1074581447
mai 2006611 34 7,64212835 kb2,2 k97326 447
abr 20065   27 8,5465332 kb1,9 k97248 457
mar 20065 1 26 8,74811432 kb1,8 k97248 457
fev 2006511 22 9,73784626 kb1,3 k77233 457
jan 20064   22 7,6378226 kb1,3 k77225 45 
dez 20054   22 7,5378726 kb1,3 k77223 45 
nov 2005411 22 7,23781724 kb1,3 k7793 45 
out 20053   19 7,4436124 kb1,3 k7793 45 
set 20053   19 7,4436524 kb1,3 k7793 45 
ago 20053   18 7,5287452 kb8875933   
jul 20053   17 7,74813222 kb1,3 k7023 45 
jun 20053   16 6,2490221 kb1,3 k6826 45 
mai 20053   16 6,1490221 kb1,3 k6823 45 
abr 20053   16 5,9491 21 kb1,3 k6823 45 
mar 20053   16 5,9491 21 kb1,3 k6823 45 
fev 20053   16 5,9491421 kb1,3 k6823 45 
jan 20053   16 5,7491321 kb1,3 k6823 45 
dez 20043   16 5,5491 21 kb1,3 k6723 45 
nov 20043   16 5,5491121 kb1,3 k6723 45 
out 20043   16 5,4491321 kb1,3 k6723 45 
set 20043   16 5,2491221 kb1,3 k6723 45 
ago 20043   16 5,1491 21 kb1,3 k6713 45 
jul 2004311 16 5,14914121 kb1,3 k6713 45 
jun 20042 1 15 2,7517916 kb1,1 k526 45 
mai 20042   14 2,3548216 kb1,0 k525 45 
abr 20042   12 2,538525,0 kb612425   
mar 20042   12 2,334264,5 kb541424   
fev 20042   12 1,8349 4,7 kb553424 2 
jan 20042   12 1,8349 4,7 kb553424 2 
dez 2003211 12 1,8349124,7 kb553424 2 
nov 2003111 6 1,7275102,0 kb219214 2 
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
The following table ranks this project in relation to projects in other languages with 1000+ articles
abr 20146032503998401365826972915155116
jan 20145938484998571389836869915455116
out 201360426546986013106836868895355116
jul 20136039525196621384806767875254116
abr 20135836685196661287806666875054116
jan 20135843615495631186786365925272116
out 20125733764894591184776364885371116
jul 20125636695194641191756164875371116
abr 20125640675293661189756165855071116
jan 20125432744991601179736065834971116
out 20115719474890701189716063794872116
jul 20116144814988651174706063774672116
abr 20115833634486591186685963764471116
jan 20115634755084611290665962764369116
out 20105535876683611272665961754267116
jul 20105642677280641369645559754066116
abr 20105337464079571350625457723968116
jan 20105531426576591246615454693967116
out 20095536464475562349615354693967116
jul 20095439516575602269605154683765116
abr 20095247473872511258595052683464116
jan 20095158694271561274594949673464116
out 20085136434271431251584947653362115
jul 20085129584470561277574847633261115
abr 20084942494268491251544442623257115
jan 2008473941467231666642575156643068115
out 2007513749467660636332655872693570115
jul 2007504047407654636334676072683368115
abr 2007474053407660606046686173662965115
jan 2007452340377457535355686373623043115
out 2006533649437251494967666275616240115
jul 2006483440326949454551656475616431115
abr 2006543853357247414169626570585631115
jan 2006564356346641363684626367504933108
out 200553324826643530306856606452452899
jul 200548324225593426264348525559372494
abr 200545254121523020206745505154332187
jan 200538213519432415154940414248252177
out 200431242816342010103833333632191966
jul 2004241725102616441924282929161250
abr 200410785953313991067819
jan 2004744373221088764616
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100ediçõesbytes
 WikcionaristasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikcionaristas (usuários registrados)
A = Wikcionaristas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikcionaristas que editaram pelo menos dez vezes desde que chegaram
C = Wikcionaristas que contribuíram cinco vezes ou mais este mês
D = Wikcionaristas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  5  10  100  1  3  5  10  25  100  250  5  10  1  3  5  10  25  100  250  1000  2500  5  10  100 
Monthly counts for recent history of wiki
jun 201421111  11 111      3111        
mai 2014633111  11 22       6431        
abr 2014322211  1  1111     12221        
mar 20144222111 11 3111     8221        
fev 2014222211  111311      73222       
jan 2014222    21 2111     7321        
dez 2013221    11131       831         
nov 201352211     2111     1021         
out 2013211       211      632111      
set 2013422       22       73211       
ago 2013111    11111       42          
jul 201322221  111111      6311        
jun 201322222  11 111      3111        
mai 2013411    22 1        411      1  
abr 20132111   21 111      4111        
mar 20133111   21 3111   1 4221     11 
fev 201332211  321322      833         
jan 201322211  22122       62221    11 
dez 2012211    3312111   118311     1  
nov 201211111  31 21       311111      
out 201221    22121       6211     1  
set 20122     22111       522         
ago 20126311   21141       733         
jul 20124211   21 311      14422        
jun 2012222    6411        6221        
mai 20123221   3312111     61111       
abr 20123111   43 221      6331        
mar 20122111   44 3        411         
fev 2012211    22 211      3321        
jan 2012      3212        61       21 
Quarterly counts for entire history of wiki
abr 2014322211  1  1111     12221        
jan 2014222    21 2111     7321        
out 2013211       211      632111      
jul 201322221  111111      6311        
abr 20132111   21 111      4111        
jan 201322211  22122       62221    11 
out 201221    22121       6211     1  
jul 20124211   21 311      14422        
abr 20123111   43 221      6331        
jan 2012      3212        61       21 
out 20113332   32 2111     821      11 
jul 2011      3311        311         
abr 201121111  21          422         
jan 20112     11 1        51          
out 20102111111    31       6221        
jul 20104221111    211      11          
abr 20106444422    42111    852      11 
jan 20104443311    211111   5333        
out 20096443321    322111   733111      
jul 2009433331     22111    5222111  11 
abr 20094333221    42111    7432111     
jan 20093111   11 832111   12531111  11 
out 200853333  11 844311   1477521111   
jul 200821111  1  42211    54211111    
abr 2008222221  11 422111   52211111    
jan 20085333311 11 444211   53333111    
out 200722221111   31       4322111     
jul 20072222111 11 54311    4433111     
abr 20072222211 11 22111    2222111     
jan 2007333331  11 321      4332        
out 20062221   11 1        3111        
jul 2006322211     21       5           
abr 20061                             
jan 2006                  2           
out 2005                              
jul 2005                              
abr 2005                              
jan 2005                              
out 2004                              
jul 200421111              1111        
abr 20042                 1           
jan 2004                  2111        

 

Distribuição de edições de artigos por wikcionaristas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikcionaristasEdições total
1104100.0%27,471100.0%
34341.3%27,39399.7%
102524.0%27,29799.4%
321514.4%27,14498.8%
10087.7%26,77797.5%
31643.8%26,04394.8%
100032.9%25,26392.0%
316221.9%23,27684.7%
1000011.0%18,45067.2%

 

2 wikcionaristas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions
agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
AuroraUC3 01,98711,50319set 17, 20053207214-5037
MalaysiaboyUC4 0780511271nov 04, 20132374123459-

 

20 wikcionaristas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
On Wheezier PlotUC118,450jul 24, 20062897out 20, 20101348
InterwicketUC24,826jan 29, 20091977nov 08, 20101329
PM PoonUC5262set 22, 20053202ago 13, 20062877
26 RamadanUC6241dez 01, 2011941fev 02, 2013512
KamalzackUC7125ago 12, 20111052set 24, 2013278
KurniasanUC8106set 23, 20082105jan 25, 20111251
Amir Hamzah 2008UC973out 20, 2011983ago 02, 2012696
YosriUC1068nov 10, 20033884fev 05, 20091970
WhjaygUC1160jan 17, 20082355fev 28, 20082313
AlamnirvanaUC1255abr 06, 20101545abr 18, 20111168
KhairulkhalidUC1339jun 30, 20043651jul 21, 20043630
Putera Luqman Tunku AndreUC1433dez 23, 20072380jan 01, 20082371
JufertUC1531jan 17, 20072720mar 11, 20072667
Thijs!botUC1618ago 22, 20062868jun 20, 20072566
ZfcUC1716nov 07, 20053156nov 07, 20053156
CommonsDelinkerUC1816nov 09, 20072424mai 31, 201429
MunshiUC1914ago 25, 20101404ago 25, 20101404
SyahirSQRT2UC2014jul 11, 2012718ago 15, 2012683
NiduzziUC2112out 31, 20062798dez 06, 20082031
AntukecikUC2211jun 11, 20062940dez 04, 20072399

 

usuários anônimos, ordenados por número de contribuições
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
60.52.72.252282
60.53.47.20566
60.50.250.1459
82.243.126.5854
60.52.75.17454
60.50.244.20953
60.49.111.5549
60.49.107.4448
60.50.255.17347
60.50.241.10744

No total 2.321 edições foram feitas por usuários anônimos, de um total de 35.213 edições ( 6e %)
  


15 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
HydrizBotUC12,033mai 23, 20111133ago 23, 2013310--
Luckas-botUC21,499fev 03, 20101607jan 27, 2014153--
VolkovBotUC3591jan 31, 20082341mar 22, 2013464--
RobotGMwiktUC4527set 05, 20062854jun 06, 20082214--
KamikazeBotUC5281dez 04, 2011938mar 07, 2013479--
AvocatoBotUC6208out 31, 2011972ago 03, 2013330--
YS-BotUC7205dez 27, 2012549jun 23, 20146--
SieBotUC816jun 04, 20072582fev 04, 20082337--
Makecat-botUC916nov 10, 2012596jan 23, 2013522--
CarsracBotUC1014dez 28, 2012548mai 30, 2013395--
JAnDbotUC1111mai 01, 20072616jun 26, 2012733--
EdmundobotUC1211dez 29, 20082008dez 29, 20082008--
EscarbotUC135nov 28, 20062770dez 19, 20072384--
AlexbotUC142jan 20, 20082352jan 20, 20082352--
QualiaBotUC152jul 23, 20082167jul 27, 20082163--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110JpgPng
jun 20142,9 k8663973668293227      4512
mai 20142,9 k8663973668283227      19112
abr 20142,8 k8663973668233227      18312
mar 20142,7 k8603973668133227      29912
fev 20142,5 k8563973667973227      13612
jan 20142,5 k8503973667683224      1612
dez 20132,5 k8353963667673224      1012
nov 20132,5 k8313963667633224      4212
out 20132,5 k8203963667633224      712
set 20132,5 k8083963667593222      1712
ago 20132,5 k7833963667593222      912
jul 20132,5 k7803963667593222      4812
jun 20132,5 k7763963667582222      5212
mai 20132,5 k7753963637581219      1112
abr 20132,5 k7733963637581219      1912
mar 20132,5 k7693963627521218      2612
fev 20132,5 k7603963607491218      7712
jan 20132,4 k7513963607491217      7512
dez 20122,3 k7393953607461214      712
nov 20122,3 k7333953607441214      5712
out 20122,3 k7273953607211211      512
set 20122,3 k7223953607141211      312
ago 20122,3 k7163953607061210      3312
jul 20122,3 k7053953606991208      1812
jun 20122,3 k6983953606921204      1212
mai 20122,3 k6843943606871203      2212
abr 20122,3 k6783943606771202      2212
mar 20122,3 k6663943606751201      2312
fev 20122,3 k6613943606751201      912
jan 20122,3 k6483943606721201       12
dez 20112,3 k6393943606721201      6012
nov 20112,3 k6253943586491200      3612
out 20112,2 k6123943586481199      3212
set 20112,2 k6053943586481199      412
ago 20112,2 k6013943586481199      912
jul 20112,2 k5943943586481199       12
jun 20112,2 k5823943586481199      412
mai 20112,2 k5783943586361199      1712
abr 20112,2 k5713943586361199      3012
mar 20112,2 k5613943586341195      112
fev 20112,2 k5573943586341195      1712
jan 20112,2 k5483933586341195      212
dez 20102,2 k5423933586341195       12
nov 20102,2 k5413933586341195      66812
out 20102,2 k5353933586341195      26612
set 20102,2 k5313923586341195      31612
ago 20102,2 k5253923586341195      14912
jul 20102,2 k5113923586341195      53412
jun 20102,2 k5113923586341195      10012
mai 20102,2 k4893923586341195      36312
abr 20102,2 k4883893586321195      126312
mar 20102,2 k4773893586321195      45912
fev 20102,2 k4723893586081194      71412
jan 20102,2 k4673893586051194      109412
dez 20092,2 k4523893586041194      131612
nov 20092,2 k4513893586021194      102412
out 20092,2 k4503893586021194      107812
set 20092,2 k4463893586021194      81812
ago 20092,2 k4393893586021193      32612
jul 20092,1 k4393693585961193      25012
jun 20092,1 k4383663585851182      104512
mai 20092,1 k4353663585761177      95312
abr 20092,1 k4303653585401171      52312
mar 20092,1 k4183643585381166      61312
fev 20092,1 k4123643585381166      30612
jan 20092,0 k4063633585381165      2412
dez 20082,0 k3983633585381165      3012
nov 20082,0 k3943633585321160      8312
out 20082,0 k3753603545271157      23812
set 20082,0 k3633593525191155      41512
ago 20081,9 k3593591525151155      631 
jul 20081,9 k3103591515131153      551 
jun 20081,9 k3083591515111153      241 
mai 20081,9 k2583591505111152      891 
abr 20081,9 k2143201505091152      2131 
mar 20081,8 k1683201504891146      4891 
fev 20081,8 k1622631504641143      7821 
jan 20081,4 k160185146378182      5761 
dez 20071,2 k15895146169133      1111 
nov 20071,1 k11490145151132      191 
out 20071,1 k11276144145131      10561 
set 20071,1 k11076144137131      6281 
ago 20071,1 k10875144128130      15441 
jul 20071,1 k10775144111127      7941 
jun 20071,0 k8674 44110127      954  
mai 20071,0 k8572 42108127      831  
abr 20071,0 k8556 4289127      699  
mar 20074018544 4274126      488  
fev 20073028533 407018      469  
jan 20072728427 404814      315  
dez 20061988225 404014      14  
nov 20061878225 404013      12  
out 20061798125 403912      24  
set 20061708024 403912      10  
ago 20061681122 403412      149  
jul 20061321122 402911      151  
jun 200679921 402811      25  
mai 200671921 402211      18  
abr 200658818 402011      1  
mar 200657818 402011      13  
fev 200653818 401711      42  
jan 200645718 401711         
dez 200545618 401611      1  
nov 200543316 401611      16  
out 200535310 40161          
set 20053539 40161          
ago 20053539 40161          
jul 20053338 4016           
jun 20053338 4016           
mai 20053338 3916           
abr 20053328 3916           
mar 20053318 3916           
fev 20053318 3916           
jan 20053217 3916           
dez 20043217 3916           
nov 20043217 3816           
out 20043217 3816           
set 20043117 3816           
ago 20043117 3816           
jul 20043117 3816           
jun 200415 4 3816           
mai 200414 2 3416           
abr 200412   3416           
mar 200412   3316           
fev 200412   218           
jan 200412   135           
dez 200312   12           
nov 20036                

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

nov 2003: 1 2 etnologi , 2 1 arkeologi

dez 2003: 1 1 khazanah

mar 2004: 1 1 arkeologi

abr 2004: 1 2 arkeologi

mai 2004: 1 1 nga'dau

jun 2004: 1 2 ajal , 2 1 nga'dau

jul 2004: 1 2 abang , 2 1 abandon

set 2004: 1 1 ajal

fev 2005: 1 1 abang

mai 2005: 1 1 haiwan

set 2005: 1 1 arkeologi

nov 2005: 1 1 gedung

dez 2005: 1 1 bonggol

fev 2006: 1 2 cadang , 2 1 arkeologi

mar 2006: 1 1 ajal

abr 2006: 1 1 Laman Utama

mai 2006: 1 2 Laman Utama , 2 1 rumah

jun 2006: 1 1 bacaan

jul 2006: 1 1 Kamus bahasa Indonesia/Un

ago 2006: 1 2 Bumi , 2 1 Kamus bahasa Indonesia/Is

set 2006: 1 1 Wiktionary

out 2006: 1 1 perempuan

nov 2006: 1 1 e

dez 2006: 1 1 l

jan 2007: 1 2 v , 2 2 u , 3 2 t , 4 2 r , 5 2 q , 6 1 penomboran

fev 2007: 1 3 sering , 2 2 sembilan , 3 2 lapan , 4 2 tujuh , 5 2 enam , 6 2 lima , 7 2 empat , 8 2 tiga , 9 2 dua , 10 2 satu , 11 2 sifar , 12 2 3 , 13 2 2 , 14 1 kerap

mar 2007: 1 3 Laman Utama , 2 2 on'yomi , 3 2 , 4 2 agama , 5 2 agar , 6 1 kesembilan-sembilan

abr 2007: 1 1 senarai perkataan Z

mai 2007: 1 2 saat , 2 2 perisian , 3 2 hasil , 4 1 rawak

jun 2007: 1 2 badak , 2 1 Kamus Wiki

jul 2007: 1 1 luah

ago 2007: 1 2 Rumi , 2 2 riadah , 3 2 pusing , 4 2 bisa , 5 1 etnologi

set 2007: 1 2 cereka , 2 2 fiksyen , 3 2 seram , 4 2 luak , 5 2 ubat , 6 2 baru , 7 2 imbas , 8 2 alpa , 9 2 pusing , 10 2 rawak , 11 2 karut , 12 2 wahana , 13 2 , 14 2 sering , 15 2 aduk , 16 2 aduhai , 17 2 aduh , 18 2 acuh , 19 2 acap , 20 2 abiotik

out 2007: 1 2 catur , 2 2 besar , 3 1 buah

nov 2007: 1 2 b , 2 1 banci

dez 2007: 1 3 musuh , 2 3 sahabat , 3 3 rakan , 4 2 jalan

jan 2008: 1 3 muzik klasikal , 2 3 opera , 3 3 respons , 4 3 suka , 5 2 kami , 6 2 kita , 7 1

fev 2008: 1 3 kucing , 2 3 perah , 3 2 kad , 4 2 kanji , 5 2 kaki , 6 2 hidung , 7 2 telinga , 8 2 datang , 9 2 tangan , 10 2 bahasa , 11 2 anjing , 12 2 negara , 13 2 nama , 14 2 malam , 15 2 petang , 16 2 pagi , 17 2 subuh , 18 2 bintang , 19 1 Rabu

mar 2008: 1 2 planet , 2 2 Neptun , 3 1 kronik

abr 2008: 1 2 utara , 2 2 barat , 3 2 tinggi , 4 2 timur , 5 2 kayu , 6 1 oren

mai 2008: 1 2 putih mata , 2 2 biru , 3 2 hijau , 4 1 hitam

jun 2008: 1 2 tawar , 2 1 celaka

jul 2008: 1 1 mustahil

ago 2008: 1 2 mışıq , 2 1 laksa

set 2008: 1 4 percuma , 2 3 celaka , 3 2 mangga , 4 1 nga'dau

out 2008: 1 3 manre , 2 3 wedding , 3 3 indo , 4 3 seddi , 5 3 istilah , 6 3 sekolah , 7 3 resonance , 8 2 pepek , 9 2 short story , 10 2 cerpen , 11 2 golok , 12 2 تاهي , 13 2 tahi , 14 2 kau , 15 2 lampe , 16 1

nov 2008: 1 2 suasa , 2 2 tollolang , 3 2 Mesia , 4 2 slave , 5 2 hamba

dez 2008: 1 2 doorknob , 2 2 tombol pintu , 3 1 leksikon

jan 2009: 1 1 wombat

fev 2009: 1 2 tadbir , 2 2 bomoh , 3 2 dukun , 4 2 pawang , 5 2 doktor , 6 2 ahli perubatan , 7 2 tabib , 8 2 tabah , 9 2 pedati , 10 1 kala

mar 2009: 1 2 kerajaan , 2 2 din , 3 2 kala , 4 2 tabah , 5 2 meong , 6 2 golok , 7 2 zaměření , 8 2 seddi , 9 2 歡迎 , 10 2 keramat , 11 2 kronik , 12 2 hari , 13 2 negara , 14 2 petang , 15 2 Zuhal , 16 2 Marikh , 17 2 candu , 18 2 tahil , 19 2 lelaki , 20 2 imbas , 21 2 Rumi , 22 2 obor , 23 1 hak

abr 2009: 1 2 ข้าว , 2 2 , 3 2 kad , 4 2 , 5 2 , 6 2 , 7 2 , 8 2 , 9 2 , 10 2 opera , 11 2 , 12 2 snek , 13 2 muda , 14 1 manusia

mai 2009: 1 2 perkasa , 2 2 pustaka , 3 2 kaut , 4 2 pawang , 5 2 meong , 6 2 , 7 2 , 8 2 , 9 2 , 10 2 , 11 2 , 12 2 世界 , 13 2 , 14 2 , 15 2 , 16 2 , 17 2 , 18 2 國家 , 19 2 , 20 2 国家 , 21 2 , 22 2 , 23 2 , 24 2 bintang , 25 2

jun 2009: 1 2 الله , 2 2 keju , 3 2 terjemah , 4 2 , 5 2 gong , 6 2 , 7 2 , 8 2 , 9 2 , 10 2 , 11 2 , 12 2 , 13 2 , 14 2 , 15 2 daging , 16 2 , 17 2 , 18 2 , 19 2 , 20 2 森林 , 21 2 , 22 2 , 23 2 , 24 2 , 25 2

jul 2009: 1 3 DB , 2 2 rasa , 3 2 عيسى , 4 2 planet , 5 2 , 6 2 語言 , 7 2 , 8 2 , 9 2 alpa , 10 2 kasut , 11 2 awam , 12 2 iman , 13 2 dekad , 14 1 zat

ago 2009: 1 2 bateri , 2 2 cendawan , 3 2 pekak , 4 2 basikal , 5 2 timur , 6 2 parti , 7 2 jam , 8 2 ikan , 9 2 api , 10 2 bahasa , 11 2 besar , 12 2 dam , 13 2 gering , 14 2 dan , 15 2 sering , 16 1

set 2009: 1 2 , 2 2 , 3 2 , 4 2 askar , 5 2 kampung , 6 1

out 2009: 1 2 pelacur , 2 2 adalah , 3 2 ialah , 4 2 aktif , 5 2 ketam , 6 2 manusia , 7 2 itu , 8 2 Braille , 9 2 putih , 10 2 kayu , 11 2 hidung , 12 2 jantung , 13 2 ular , 14 2 kami , 15 2 naga , 16 2 harimau , 17 2 kuda , 18 2 orang , 19 2 sungai , 20 2 alas , 21 2 sudu , 22 1 bahari

nov 2009: 1 2 hitung , 2 2 pelacur , 3 2 arkeologi , 4 2 tropika , 5 2 bunga , 6 2 ya , 7 2 pagi , 8 2 suka , 9 2 legenda , 10 2 ais , 11 2 abai , 12 2 abactinal , 13 2 abad , 14 1 bahari

dez 2009: 1 2 logam , 2 2 album , 3 2 lari , 4 2 tangan , 5 2 petang , 6 2 mulut , 7 2 Tahun Baru , 8 2 ibu , 9 2 Matahari , 10 2 balai , 11 2 padi

jan 2010: 1 3 karya , 2 2 hitam , 3 2 katak , 4 2 atas , 5 2 padat , 6 2 kanji , 7 2 kaki , 8 2 sayang , 9 2 bambu , 10 1 rona

fev 2010: 1 3 monsun , 2 2 biologi , 3 2 kronik , 4 2 makan , 5 2 Neptun , 6 2 Utarid , 7 2 lelaki , 8 2 kambing , 9 2 dara , 10 2 aksi , 11 2 agensi , 12 2 abandon , 13 2 abacus , 14 1 toko

mar 2010: 1 2 ala , 2 2 baharu , 3 2 tidur , 4 2 cahaya , 5 2 sakit , 6 2 malam , 7 2 panas , 8 2 respons , 9 1 kodok

abr 2010: 1 3 etnologi , 2 2 origami , 3 2 terima kasih , 4 2 hitam , 5 2 bomba , 6 2 merah , 7 2 kakak , 8 2 tinggi , 9 2 kanan , 10 2 anjing , 11 2 nama , 12 2 sahabat , 13 2 kawan , 14 2 genting , 15 2 baru , 16 2 makanan , 17 2 tebuan , 18 1 usul

mai 2010: 1 2 gendut , 2 2 hakim , 3 2 langit , 4 2 hutan , 5 2 lagi , 6 2 ayam , 7 2 hasil

jun 2010: 1 1 gereja

jul 2010: 1 2 gereja , 2 2 Kamus bahasa Indonesia/Oy , 3 1 majlis

ago 2010: 1 2 buncit , 2 2 gendut , 3 2 , 4 2 adat , 5 2 aku

set 2010: 1 1 gereja

out 2010: 1 2 huruf , 2 1 origami

nov 2010: 1 1 majlis

jan 2011: 1 1

fev 2011: 1 1 maksud

mar 2011: 1 1

abr 2011: 1 1 buyut

mai 2011: 1 1 canggih

jun 2011: 1 1 Bioteknologi

ago 2011: 1 1 lawat

set 2011: 1 1 Poligon

out 2011: 1 1 kuala

nov 2011: 1 2 komku , 2 2 kita , 3 1 adi

dez 2011: 1 2 ا , 2 1 anak tumbuhan

fev 2012: 1 1 Japan

mar 2012: 1 1 trimas

abr 2012: 1 1 ابه

mai 2012: 1 2 aardvark , 2 1 keluarga

jun 2012: 1 1 Lampiran:Unikod

jul 2012: 1 2 hidrogen

ago 2012: 1 2 ijuk , 2 1 kanibalisme

set 2012: 1 1 zakar

out 2012: 1 1 adi

nov 2012: 1 1 easy come, easy go

dez 2012: 1 1 ustazah

jan 2013: 1 1 accretion

fev 2013: 1 1 administration

mar 2013: 1 2 makanan , 2 1 naif

abr 2013: 1 1 ardvark

mai 2013: 1 2 bahasa , 2 1 gedebe

jun 2013: 1 2 guring , 2 1 tutoi

jul 2013: 1 1 makzul

ago 2013: 1 1 bentang

set 2013: 1 2 gajet , 2 2 , 3 1 jelajah

out 2013: 1 1 jelajah

nov 2013: 1 3 cahaya , 2 2 kurrat

dez 2013: 1 2 harem , 2 1 berkemungkinan

jan 2014: 1 1 berkemungkinan

fev 2014: 1 2 abau , 2 2 abar , 3 2 abashed , 4 1 abyad

mar 2014: 1 2 qiamullail , 2 2 qasidah , 3 2 abiogenesis , 4 2 abintara , 5 1 ares

abr 2014: 1 2 azan , 2 2 قضاء , 3 2 berabad-abad , 4 1 玫瑰

mai 2014: 1 2 теория , 2 2 Латвия , 3 2 qari , 4 1 maslahat

jun 2014: 1 1 Ramadan

No data on this page have been normalized to 30 day months (as WMF does on certain traffic reports).
Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Sábado, 2 de agosto 2014 20:19

Dump file mswiktionary-20140702-pages-meta-history.xml.7z (full dump), size 7.5 Mb as 7z -> 951 Mb
Dump processed till Jun 30, 2014, on server stat1002, ready at Sun-13/07/2014-11:15 after 1 min, 15 sec.

Versão do script:2.6
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.