Estatísticas da Wikcionário malaio

Zoom           
 
January 2014: Unfortunately monthly database dump generation is delayed for many wikis. Reports will appear later than usual. Our sincere apologies for any inconvenience caused.
Upd. March 2: Dump generation was restarted on February 12. All dumps are up to date now for December, some not for January, some days to go. This is an intermediate update.

Metrics have been collected from a full archive dump, which contains all revisions of every article, meta data and raw content.
See also metrics definitions


 
Monthly counts & Quarterly rankings: janeiro 2015
 
DataWikcionaristasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
jan 20150%   +3%   +35%+4%+5%+4%+1%-1%+4%0%
dez 20140%   +1%   +251%+1%+2%+1%+1%0%+3%0%
nov 2014+4%   +1%   -72%+1%+1%+1%0%0%-1%0%
out 20140%   +4%   -14%+4%+5%+4%+1%+1%+8%0%
set 20140%   +5%   +169%+4%+4%+2%+2%+2%+8%0%
ago 20140%   +1%   -12%+1%+1%+1%+1%+1%+5%0%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
jan 201527 3 2,5 k314,69592233,9 Mb391 k25 k32 k171126186
dez 201427 1 2,4 k1159521653,8 Mb374 k24 k31 k172121186
nov 20142712 2,4 k115,1952473,7 Mb368 k23 k31 k172118186
out 201426 212,3 k315,39501663,7 Mb363 k23 k31 k172119186
set 201426 212,3 k415,79451943,6 Mb347 k22 k30 k170110186
ago 201426 2 2,2 k116,4954723,4 Mb334 k22 k30 k167102186
jul 201426 1 2,1 k116,5952823,4 Mb330 k22 k29 k16597186
jun 201426 1 2,1 k116,8962703,4 Mb326 k22 k29 k16496186
mai 201426 312,1 k3179672123,3 Mb323 k21 k29 k16496186
abr 201426 212,0 k317,99881943,2 Mb311 k20 k27 k16092186
mar 201426 211,9 k518,710043203,1 Mb299 k20 k27 k16092186
fev 201426 211,7 k120,110522623,0 Mb287 k19 k25 k15583186
jan 20142612 1,7 k 20,410611132,9 Mb283 k19 k25 k15483186
dez 201325 1 1,7 k 20,310601712,9 Mb282 k19 k25 k15483186
nov 201325 2 1,7 k 20,31060482,9 Mb282 k19 k25 k15483186
out 201325 1 1,7 k 20,3105982,9 Mb281 k19 k25 k15483186
set 201325 2 1,7 k 20,31059182,9 Mb281 k19 k25 k15483186
ago 201325 1 1,7 k 20,310592242,9 Mb281 k19 k25 k15483186
jul 201325 2 1,7 k 20,110591522,9 Mb281 k19 k24 k15483186
jun 201325 2 1,7 k 20,110511092,9 Mb278 k19 k24 k15483186
mai 201325 1 1,7 k 20,110551032,9 Mb278 k19 k24 k15483186
abr 201325 1 1,7 k 20,11056992,9 Mb278 k19 k24 k15483186
mar 201325 1 1,7 k 20,11058972,9 Mb277 k19 k24 k15583186
fev 201325 2 1,6 k42010572682,9 Mb277 k19 k24 k15582186
jan 201325 2 1,5 k121,211162322,8 Mb274 k19 k20 k15527186
dez 201225 1 1,5 k 21,411311472,8 Mb274 k19 k20 k15526186
nov 201225 1 1,5 k121,311311332,8 Mb274 k19 k19 k15527186
out 201225   1,5 k 21,611382182,7 Mb269 k19 k19 k15626186
set 201225   1,5 k 21,511371772,7 Mb268 k19 k19 k15626186
ago 201225 1 1,5 k 21,311311612,7 Mb267 k19 k19 k15626186
jul 20122511 1,5 k 21,311301012,7 Mb266 k19 k19 k15626186
jun 201224 2 1,5 k 21,311241822,7 Mb264 k19 k19 k15626186
mai 201224 2 1,5 k 21,211251552,7 Mb263 k19 k18 k15626186
abr 201224 1 1,5 k 21,211271252,7 Mb263 k19 k18 k15526186
mar 201224 1 1,5 k 21,111271212,7 Mb263 k19 k18 k15526186
fev 201224 1 1,5 k 21,111271592,7 Mb262 k19 k18 k15526186
jan 2012241  1,5 k 20,911222462,7 Mb261 k19 k18 k15526186
dez 20112314 1,5 k120,811213452,7 Mb261 k19 k17 k15526186
nov 201122 1 1,4 k 2111291332,6 Mb257 k19 k16 k15525186
out 20112223 1,4 k 2111321132,6 Mb256 k19 k16 k15525186
set 201120   1,4 k 21,11129272,6 Mb254 k18 k16 k15425186
ago 201120 1 1,4 k 21,11129572,6 Mb254 k18 k16 k15425185
jul 201120   1,4 k 2111291882,6 Mb254 k18 k16 k15425185
jun 201120   1,4 k 20,91130472,6 Mb254 k18 k16 k15425185
mai 201120 1 1,4 k 20,911302602,6 Mb254 k18 k16 k15425185
abr 201120 1 1,4 k 20,81131912,6 Mb253 k18 k16 k15425184
mar 201120   1,4 k 20,711301312,6 Mb253 k18 k15 k15425184
fev 201120 1 1,4 k 20,61131712,6 Mb253 k18 k15 k15425184
jan 201120   1,4 k 20,61131522,6 Mb253 k18 k15 k15425184
dez 201020   1,4 k 20,51131762,6 Mb253 k18 k15 k15525184
nov 201020 111,4 k 20,511316702,6 Mb253 k18 k15 k15525184
out 201020 111,4 k 2011312682,6 Mb253 k18 k15 k15525184
set 201020 111,4 k 19,811313162,6 Mb253 k18 k14 k15525184
ago 2010201211,4 k 19,611311552,6 Mb253 k18 k14 k15525184
jul 201019 211,4 k 19,511315342,6 Mb253 k18 k14 k15523184
jun 201019 2 1,4 k 19,211321012,5 Mb253 k18 k13 k15523184
mai 201019 311,4 k 19,111313632,5 Mb252 k18 k13 k15523184
abr 2010191421,4 k 1911261,3 k2,5 Mb250 k18 k13 k15923184
mar 201018 321,4 k 18,211034592,5 Mb244 k18 k13 k16523184
fev 2010181321,4 k 1811057182,4 Mb243 k18 k13 k16923184
jan 201017 411,4 k 17,610891,1 k2,4 Mb239 k18 k12 k17422184
dez 200917 321,4 k 16,910701,3 k2,4 Mb234 k18 k12 k17722184
nov 200917 321,3 k 16,110481,0 k2,3 Mb228 k18 k12 k18022184
out 2009171421,3 k115,410351,1 k2,2 Mb224 k18 k12 k18322184
set 200916 321,3 k114,810198342,2 Mb219 k18 k12 k19422184
ago 200916 311,3 k214,410173832,1 Mb216 k17 k12 k19622184
jul 200916 311,3 k 14,610312642,1 Mb209 k16 k11 k19922184
jun 200916 321,3 k114,510261,1 k2,1 Mb208 k16 k11 k20122184
mai 200916 321,2 k 13,910329732,0 Mb206 k16 k11 k20222184
abr 200916 321,2 k 13,210295352,0 Mb204 k16 k11 k20422184
mar 200916 311,2 k 12,810306152,0 Mb203 k16 k11 k20820184
fev 2009161411,2 k 12,410293132,0 Mb202 k16 k9,8 k21120184
jan 200915 1 1,2 k 12,21032482,0 Mb201 k16 k9,1 k21520184
dez 20081511 1,2 k 12,21032562,0 Mb199 k16 k9,0 k22320184
nov 200814 3 1,2 k112,310271081,9 Mb198 k16 k9,0 k22320183
out 200814 3 1,2 k212,410372541,9 Mb196 k16 k8,8 k22320183
set 2008141311,1 k 12,710754371,9 Mb195 k16 k8,7 k22320183
ago 200813 2 1,1 k 12,41068691,9 Mb192 k15 k8,6 k22320183
jul 200813 1 1,1 k 12,41069681,9 Mb191 k15 k8,5 k22320183
jun 200813 1 1,1 k112,410681061,9 Mb190 k15 k8,5 k22320184
mai 200813 2 1,1 k 12,610642871,8 Mb186 k15 k8,3 k22120184
abr 200813 211,1 k212,510604461,8 Mb183 k15 k7,9 k22020184
mar 200813 221,0 k312,710426731,7 Mb170 k14 k7,7 k24720184
fev 200813 229161213,210401,9 k1,6 Mb155 k13 k6,9 k24120181
jan 200813131572917,710251,0 k1,0 Mb92 k7,0 k4,3 k18411181
dez 20071224 306129,71047119599 kb46 k1,3 k2,2 k1085180
nov 200710 1 283 31,7109225582 kb44 k1,2 k2,1 k1095179
out 200710 21277 32,310831,1 k570 kb43 k1,2 k2,1 k1085178
set 200710 31269129,21049653531 kb41 k1,2 k2,0 k1066179
ago 200710 21252 28,610851,6 k504 kb39 k1,1 k2,0 k1096179
jul 200710 21237 23,81027828423 kb36 k1,0 k1,9 k1086179
jun 200710 21223 21,6997964373 kb33 k9801,9 k1046153
mai 200710 31210118,3865869315 kb27 k9251,8 k1026153
abr 200710 21193 15,5827734259 kb24 k8581,7 k976153
mar 200710 21182 12,4830565240 kb23 k7941,6 k866134
fev 200710 21168110767516215 kb19 k7271,7 k805750
jan 20071023114518,1681376170 kb15 k5951,4 k583041
dez 2006811 106 7,571540124 kb11 k3791,1 k17308
nov 20067 1 95 7,969435110 kb9,6 k3018831308
out 20067 2 87 8,26437097 kb8,2 k2447721308
set 20067 1 76 8,55574978 kb6,2 k185696 307
ago 20067 2164 9,357815373 kb5,4 k156564 447
jul 2006712154 8,245115853 kb3,7 k124496 447
jun 20066 2 46 6,24652945 kb3,3 k107458 447
mai 2006611 34 7,64212835 kb2,2 k97326 447
abr 20065   27 8,5465332 kb1,9 k97248 457
mar 20065 1 26 8,74811432 kb1,8 k97248 457
fev 2006511 22 9,73784626 kb1,3 k77233 457
jan 20064   22 7,6378226 kb1,3 k77225 45 
dez 20054   22 7,5378726 kb1,3 k77223 45 
nov 2005411 22 7,23781724 kb1,3 k7793 45 
out 20053   19 7,4436124 kb1,3 k7793 45 
set 20053   19 7,4436524 kb1,3 k7793 45 
ago 20053   18 7,5287452 kb8875933   
jul 20053   17 7,74813222 kb1,3 k7023 45 
jun 20053   16 6,2490221 kb1,3 k6826 45 
mai 20053   16 6,1490221 kb1,3 k6823 45 
abr 20053   16 5,9491 21 kb1,3 k6823 45 
mar 20053   16 5,9491 21 kb1,3 k6823 45 
fev 20053   16 5,9491421 kb1,3 k6823 45 
jan 20053   16 5,7491321 kb1,3 k6823 45 
dez 20043   16 5,5491 21 kb1,3 k6723 45 
nov 20043   16 5,5491121 kb1,3 k6723 45 
out 20043   16 5,4491321 kb1,3 k6723 45 
set 20043   16 5,2491221 kb1,3 k6723 45 
ago 20043   16 5,1491 21 kb1,3 k6713 45 
jul 2004311 16 5,14914121 kb1,3 k6713 45 
jun 20042 1 15 2,7517916 kb1,1 k526 45 
mai 20042   14 2,3548216 kb1,0 k525 45 
abr 20042   12 2,538525,0 kb612425   
mar 20042   12 2,334264,5 kb541424   
fev 20042   12 1,8349 4,7 kb553424 2 
jan 20042   12 1,8349 4,7 kb553424 2 
dez 2003211 12 1,8349124,7 kb553424 2 
nov 2003111 6 1,7275102,0 kb219214 2 
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
The following table ranks this project in relation to projects in other languages with 1000+ articles
Note: data for month(s) after Dec 2014 for one or more large projects are not yet known.
As a temporary approximation missing data for a project are substituted by the highest historic value for that project.
Once those missing data are available final rankings for recent months can shift one or more positions.
out 20146436524097422279836968915653130
jul 20146231594897582293846970915556130
abr 20146132504098411266826972915556130
jan 20146037484997591289826769915556130
out 201360436346976012110826768895456130
jul 20136039535195641284796667875555130
abr 20135836675195661187796566875555130
jan 20135845605494641186786365925576130
out 20125834784893591184776364885574130
jul 20125738705393691196756164875475130
abr 20125740665292671189756165855475130
jan 20125632775090611180736065835275130
out 20115720484889711191716063795176130
jul 20116144814987661174706063775076130
abr 20115834654585621187685963764875130
jan 20115535775083611292665962764773130
out 20105436876582611272665961754671130
jul 20105544677279651369645559754370130
abr 20105338474078571349625457724071130
jan 20105531416376591245615454693870130
out 20095538464476562349615354693871130
jul 20095439526676612269605154683669130
abr 20095349483873531258595052683268130
jan 20095158684272571274594949672868130
out 20085136424272431251584947652766129
jul 20085231584471571277574847632565129
abr 20085042484269501251544442622461129
jan 2008473941477331676742585156642772129
out 2007503949467861646432665975692875129
jul 2007494347417857646434696175692473129
abr 2007473955387861616146706275682169129
jan 2007462341367956545455716577632648129
out 2006523948437753494970696480636644129
jul 2006483541337552454553686879636234129
abr 2006533854357348414173656870605233129
jan 2006554559346741363690646668514334122
out 2005533249266335303069576163543828111
jul 2005473343255834262643495354602724106
abr 200543254121513020207046525055232193
jan 200539223519422415154940414150172281
out 200431242916342010103933333634101969
jul 2004251524102616442024282929101252
abr 200410785953313991075819
jan 2004744373221088773616
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100ediçõesbytes
 WikcionaristasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikcionaristas (usuários registrados)
A = Wikcionaristas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikcionaristas que editaram pelo menos dez vezes desde que chegaram
C = Wikcionaristas que contribuíram cinco vezes ou mais este mês
D = Wikcionaristas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  5  10  100  1  3  5  10  25  100  250  5  10  1  3  5  10  25  100  250  1000  2500  5  10  100 
Monthly counts for recent history of wiki
jan 201574322  22 4321     5553221  11 
dez 201422111  21 111      52211    11 
nov 201432211     31       43221    11 
out 2014332211     1        633221      
set 2014322111     521      9432     11 
ago 201442221  11 4        8441     1  
jul 201453111  11 211      4331        
jun 201421111  11 111      3111        
mai 2014633111  11 22       6431        
abr 2014322211  1  1111     10221        
mar 20144222111 11 3111     8221        
fev 2014222211  111311      72222       
jan 2014222    21 2111     7321        
dez 2013221    11131       821         
nov 201352211     2111     1021         
out 2013211       211      532111      
set 2013422       22       6321        
ago 2013111    11111       42          
jul 201322221  111111      6211        
jun 201322222  11 111      3111        
mai 2013411    22 1        411      1  
abr 20132111   21 111      4111        
mar 20133111   21 3111   1 4221     11 
fev 201332211  321322      732         
jan 201322211  22122       52221    11 
Quarterly counts for entire history of wiki
jan 201574322  22 4321     5553221  11 
out 2014332211     1        633221      
jul 201453111  11 211      4331        
abr 2014322211  1  1111     10221        
jan 2014222    21 2111     7321        
out 2013211       211      532111      
jul 201322221  111111      6211        
abr 20132111   21 111      4111        
jan 201322211  22122       52221    11 
out 201221    22121       6211     1  
jul 20124211   21 311      14422        
abr 20123111   43 221      533         
jan 2012      3212        61       21 
out 20113332   32 2111     711      11 
jul 2011      3311        311         
abr 201121111  21          422         
jan 20112     11 1        51          
out 20102111111    31       6221        
jul 20104221111    211      11          
abr 20106444422    42111    841      11 
jan 20104443311    211111   5333        
out 20096443321    322111   733111      
jul 2009433331     22111    5222111  11 
abr 20094333221    42111    7432111     
jan 20093111   11 832111   12531111  11 
out 200853333  11 844311   1477521111   
jul 200821111  1  42211    54211111    
abr 2008222221  11 422111   52211111    
jan 20085333311 11 444211   53333111    
out 200722221111   31       3322111     
jul 20072222111 11 54311    4433111     
abr 20072222211 11 22111    2222111     
jan 2007333331  11 321      4332        
out 20062221   11 1        3111        
jul 2006322211     21       5           
abr 20061                             
jan 2006                  2           
out 2005                              
jul 2005                              
abr 2005                              
jan 2005                              
out 2004                              
jul 200421111              1111        
abr 20042                 1           
jan 2004                  2111        

 

Distribuição de edições de artigos por wikcionaristas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikcionaristasEdições total
1109100.0%28,225100.0%
34440.4%28,14099.7%
102623.9%28,04199.3%
321614.7%27,88598.8%
10087.3%27,44697.2%
31643.7%26,70794.6%
100043.7%26,70794.6%
316221.8%23,27682.5%
1000010.9%18,45065.4%

 

7 wikcionaristas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions
agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
MalaysiaboyUC4 01,40999523147nov 04, 20134527705729499
26 RamadanUC6 0246539710dez 01, 20111156187-907
SNN95UC10+67252436284abr 23, 20136472921233124
CommonsDelinkerUC18 01812-nov 09, 20072639----
5662595laiUC43...4499jan 10, 2015202222
LotjeUC107...11--jan 23, 20157----
AldnonymousUC108...11--jan 28, 20152----

 

20 wikcionaristas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
On Wheezier PlotUC118,450jul 24, 20063112out 20, 20101563
InterwicketUC24,826jan 29, 20092192nov 08, 20101544
AuroraUC32,022set 17, 20053422out 13, 2014109
PM PoonUC5262set 22, 20053417ago 13, 20063092
KamalzackUC7125ago 12, 20111267set 24, 2013493
KurniasanUC8106set 23, 20082320jan 25, 20111466
Amir Hamzah 2008UC973out 20, 20111198ago 02, 2012911
YosriUC1168nov 10, 20034099fev 05, 20092185
WhjaygUC1260jan 17, 20082570fev 28, 20082528
AlamnirvanaUC1355abr 06, 20101760abr 18, 20111383
KhairulkhalidUC1439jun 30, 20043866jul 21, 20043845
Putera Luqman Tunku AndreUC1533dez 23, 20072595jan 01, 20082586
JufertUC1631jan 17, 20072935mar 11, 20072882
Thijs!botUC1718ago 22, 20063083jun 20, 20072781
ZfcUC1916nov 07, 20053371nov 07, 20053371
MunshiUC2014ago 25, 20101619ago 25, 20101619
SyahirSQRT2UC2114jul 11, 2012933ago 15, 2012898
NiduzziUC2212out 31, 20063013dez 06, 20082246
FanatixUC2312mar 09, 20092153jul 10, 2014204
AntukecikUC2411jun 11, 20063155dez 04, 20072614

 

usuários anônimos, ordenados por número de contribuições
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
60.52.72.252282
60.53.47.20566
60.50.250.1459
60.52.75.17454
82.243.126.5854
60.50.244.20953
60.49.111.5549
60.49.107.4448
60.50.255.17347
60.51.124.3644

No total 2.333 edições foram feitas por usuários anônimos, de um total de 36.162 edições ( 6e %)
  


15 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
HydrizBotUC12,168mai 23, 20111348jan 22, 20158--
Luckas-botUC21,499fev 03, 20101822jan 27, 2014368--
VolkovBotUC3591jan 31, 20082556mar 22, 2013679--
RobotGMwiktUC4527set 05, 20063069jun 06, 20082429--
KamikazeBotUC5281dez 04, 20111153mar 07, 2013694--
YS-BotUC6251dez 27, 2012764jan 29, 20151--
AvocatoBotUC7208out 31, 20111187ago 03, 2013545--
SieBotUC816jun 04, 20072797fev 04, 20082552--
Makecat-botUC916nov 10, 2012811jan 23, 2013737--
CarsracBotUC1014dez 28, 2012763mai 30, 2013610--
JAnDbotUC1113mai 01, 20072831jan 19, 201511--
EdmundobotUC1211dez 29, 20082223dez 29, 20082223--
EscarbotUC135nov 28, 20062985dez 19, 20072599--
AlexbotUC142jan 20, 20082567jan 20, 20082567--
QualiaBotUC152jul 23, 20082382jul 27, 20082378--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110JpgPng
jan 20153,3 k8164103661,1 k3232      16312
dez 20143,2 k8053973669863231      6112
nov 20143,2 k8033973669703229      4512
out 20143,2 k7993973669453229      16612
set 20143,1 k7983973668463228      19112
ago 20143,0 k7923973668393228      6012
jul 20143,0 k7873973668373227      6812
jun 20142,9 k7873973668293227      4512
mai 20142,9 k7873973668283227      19112
abr 20142,8 k7873973668233227      18312
mar 20142,7 k7833973668133227      29912
fev 20142,5 k7793973667973227      13612
jan 20142,5 k7753973667683224      1612
dez 20132,5 k7623963667673224      1012
nov 20132,5 k7593963667633224      4212
out 20132,5 k7523963667633224      712
set 20132,5 k7433963667593222      1712
ago 20132,5 k7253963667593222      912
jul 20132,5 k7223963667593222      4812
jun 20132,5 k7193963667582222      5212
mai 20132,5 k7183963637581219      1112
abr 20132,5 k7163963637581219      1912
mar 20132,5 k7123963627521218      2612
fev 20132,5 k7043963607491218      7712
jan 20132,4 k6983963607491217      7512
dez 20122,3 k6873953607461214      712
nov 20122,3 k6823953607441214      5712
out 20122,3 k6763953607211211      512
set 20122,3 k6713953607141211      312
ago 20122,3 k6663953607061210      3312
jul 20122,3 k6603953606991208      1812
jun 20122,3 k6533953606921204      1212
mai 20122,3 k6403943606871203      2212
abr 20122,3 k6343943606771202      2212
mar 20122,3 k6243943606751201      2312
fev 20122,3 k6213943606751201      912
jan 20122,3 k6133943606721201       12
dez 20112,3 k6053943606721201      6012
nov 20112,3 k5913943586491200      3612
out 20112,2 k5783943586481199      3212
set 20112,2 k5743943586481199      412
ago 20112,2 k5713943586481199      912
jul 20112,2 k5653943586481199       12
jun 20112,2 k5543943586481199      412
mai 20112,2 k5513943586361199      1712
abr 20112,2 k5473943586361199      3012
mar 20112,2 k5383943586341195      112
fev 20112,2 k5343943586341195      1712
jan 20112,2 k5263933586341195      212
dez 20102,2 k5203933586341195       12
nov 20102,2 k5193933586341195      66812
out 20102,2 k5153933586341195      26612
set 20102,2 k5113923586341195      31612
ago 20102,2 k5053923586341195      14912
jul 20102,2 k4913923586341195      53412
jun 20102,2 k4913923586341195      10012
mai 20102,2 k4763923586341195      36312
abr 20102,2 k4753893586321195      126312
mar 20102,2 k4693893586321195      45912
fev 20102,2 k4643893586081194      71412
jan 20102,2 k4593893586051194      109412
dez 20092,2 k4453893586041194      131612
nov 20092,2 k4443893586021194      102412
out 20092,2 k4433893586021194      107812
set 20092,2 k4403893586021194      81812
ago 20092,2 k4333893586021193      32612
jul 20092,1 k4333693585961193      25012
jun 20092,1 k4323663585851182      104512
mai 20092,1 k4293663585761177      95312
abr 20092,1 k4243653585401171      52312
mar 20092,1 k4133643585381166      61312
fev 20092,1 k4083643585381166      30612
jan 20092,0 k4023633585381165      2412
dez 20082,0 k3943633585381165      3012
nov 20082,0 k3903633585321160      8312
out 20082,0 k3743603545271157      23812
set 20082,0 k3623593525191155      41512
ago 20081,9 k3583591525151155      631 
jul 20081,9 k3093591515131153      551 
jun 20081,9 k3073591515111153      241 
mai 20081,9 k2573591505111152      891 
abr 20081,9 k2133201505091152      2131 
mar 20081,8 k1673201504891146      4891 
fev 20081,8 k1612631504641143      7821 
jan 20081,4 k159185146378182      5761 
dez 20071,2 k15795146169133      1111 
nov 20071,1 k11390145151132      191 
out 20071,1 k11176144145131      10561 
set 20071,1 k11076144137131      6281 
ago 20071,1 k10875144128130      15441 
jul 20071,1 k10775144111127      7941 
jun 20071,0 k8674 44110127      954  
mai 20071,0 k8572 42108127      831  
abr 20071,0 k8556 4289127      699  
mar 20074018544 4274126      488  
fev 20073028533 407018      469  
jan 20072728427 404814      315  
dez 20061988225 404014      14  
nov 20061878225 404013      12  
out 20061798125 403912      24  
set 20061708024 403912      10  
ago 20061681122 403412      149  
jul 20061321122 402911      151  
jun 200679921 402811      25  
mai 200671921 402211      18  
abr 200658818 402011      1  
mar 200657818 402011      13  
fev 200653818 401711      42  
jan 200645718 401711         
dez 200545618 401611      1  
nov 200543316 401611      16  
out 200535310 40161          
set 20053539 40161          
ago 20053539 40161          
jul 20053338 4016           
jun 20053338 4016           
mai 20053338 3916           
abr 20053328 3916           
mar 20053318 3916           
fev 20053318 3916           
jan 20053217 3916           
dez 20043217 3916           
nov 20043217 3816           
out 20043217 3816           
set 20043117 3816           
ago 20043117 3816           
jul 20043117 3816           
jun 200415 4 3816           
mai 200414 2 3416           
abr 200412   3416           
mar 200412   3316           
fev 200412   218           
jan 200412   135           
dez 200312   12           
nov 20036                

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

nov 2003: 1 2 etnologi , 2 1 arkeologi

dez 2003: 1 1 khazanah

mar 2004: 1 1 arkeologi

abr 2004: 1 2 arkeologi

mai 2004: 1 1 nga'dau

jun 2004: 1 2 ajal , 2 1 nga'dau

jul 2004: 1 2 abang , 2 1 abandon

set 2004: 1 1 ajal

fev 2005: 1 1 abang

mai 2005: 1 1 haiwan

set 2005: 1 1 arkeologi

nov 2005: 1 1 gedung

dez 2005: 1 1 bonggol

fev 2006: 1 2 cadang , 2 1 arkeologi

mar 2006: 1 1 ajal

abr 2006: 1 1 Laman Utama

mai 2006: 1 2 Laman Utama , 2 1 rumah

jun 2006: 1 1 bacaan

jul 2006: 1 1 Kamus bahasa Indonesia/Un

ago 2006: 1 2 Bumi , 2 1 Kamus bahasa Indonesia/Is

set 2006: 1 1 Wiktionary

out 2006: 1 1 perempuan

nov 2006: 1 1 e

dez 2006: 1 1 l

jan 2007: 1 2 v , 2 2 u , 3 2 t , 4 2 r , 5 2 q , 6 1 penomboran

fev 2007: 1 3 sering , 2 2 sembilan , 3 2 lapan , 4 2 tujuh , 5 2 enam , 6 2 lima , 7 2 empat , 8 2 tiga , 9 2 dua , 10 2 satu , 11 2 sifar , 12 2 3 , 13 2 2 , 14 1 kerap

mar 2007: 1 3 Laman Utama , 2 2 on'yomi , 3 2 , 4 2 agama , 5 2 agar , 6 1 kesembilan-sembilan

abr 2007: 1 1 senarai perkataan Z

mai 2007: 1 2 saat , 2 2 perisian , 3 2 hasil , 4 1 rawak

jun 2007: 1 2 badak , 2 1 Kamus Wiki

jul 2007: 1 1 luah

ago 2007: 1 2 Rumi , 2 2 riadah , 3 2 pusing , 4 2 bisa , 5 1 etnologi

set 2007: 1 2 cereka , 2 2 fiksyen , 3 2 seram , 4 2 luak , 5 2 ubat , 6 2 baru , 7 2 imbas , 8 2 alpa , 9 2 pusing , 10 2 rawak , 11 2 karut , 12 2 wahana , 13 2 , 14 2 sering , 15 2 aduk , 16 2 aduhai , 17 2 aduh , 18 2 acuh , 19 2 acap , 20 2 abiotik

out 2007: 1 2 catur , 2 2 besar , 3 1 buah

nov 2007: 1 2 b , 2 1 banci

dez 2007: 1 3 musuh , 2 3 sahabat , 3 3 rakan , 4 2 jalan

jan 2008: 1 3 muzik klasikal , 2 3 opera , 3 3 respons , 4 3 suka , 5 2 kami , 6 2 kita , 7 1

fev 2008: 1 3 kucing , 2 3 perah , 3 2 kad , 4 2 kanji , 5 2 kaki , 6 2 hidung , 7 2 telinga , 8 2 datang , 9 2 tangan , 10 2 bahasa , 11 2 anjing , 12 2 negara , 13 2 nama , 14 2 malam , 15 2 petang , 16 2 pagi , 17 2 subuh , 18 2 bintang , 19 1 Rabu

mar 2008: 1 2 planet , 2 2 Neptun , 3 1 kronik

abr 2008: 1 2 utara , 2 2 barat , 3 2 tinggi , 4 2 timur , 5 2 kayu , 6 1 oren

mai 2008: 1 2 putih mata , 2 2 biru , 3 2 hijau , 4 1 hitam

jun 2008: 1 2 tawar , 2 1 celaka

jul 2008: 1 1 mustahil

ago 2008: 1 2 mışıq , 2 1 laksa

set 2008: 1 4 percuma , 2 3 celaka , 3 2 mangga , 4 1 nga'dau

out 2008: 1 3 manre , 2 3 wedding , 3 3 indo , 4 3 seddi , 5 3 istilah , 6 3 sekolah , 7 3 resonance , 8 2 pepek , 9 2 short story , 10 2 cerpen , 11 2 golok , 12 2 تاهي , 13 2 tahi , 14 2 kau , 15 2 lampe , 16 1

nov 2008: 1 2 suasa , 2 2 tollolang , 3 2 Mesia , 4 2 slave , 5 2 hamba

dez 2008: 1 2 doorknob , 2 2 tombol pintu , 3 1 leksikon

jan 2009: 1 1 wombat

fev 2009: 1 2 tadbir , 2 2 bomoh , 3 2 dukun , 4 2 pawang , 5 2 doktor , 6 2 ahli perubatan , 7 2 tabib , 8 2 tabah , 9 2 pedati , 10 1 kala

mar 2009: 1 2 kerajaan , 2 2 din , 3 2 kala , 4 2 tabah , 5 2 meong , 6 2 golok , 7 2 zaměření , 8 2 seddi , 9 2 歡迎 , 10 2 keramat , 11 2 kronik , 12 2 hari , 13 2 negara , 14 2 petang , 15 2 Zuhal , 16 2 Marikh , 17 2 candu , 18 2 tahil , 19 2 lelaki , 20 2 imbas , 21 2 Rumi , 22 2 obor , 23 1 hak

abr 2009: 1 2 ข้าว , 2 2 , 3 2 kad , 4 2 , 5 2 , 6 2 , 7 2 , 8 2 , 9 2 , 10 2 opera , 11 2 , 12 2 snek , 13 2 muda , 14 1 manusia

mai 2009: 1 2 perkasa , 2 2 pustaka , 3 2 kaut , 4 2 pawang , 5 2 meong , 6 2 , 7 2 , 8 2 , 9 2 , 10 2 , 11 2 , 12 2 世界 , 13 2 , 14 2 , 15 2 , 16 2 , 17 2 , 18 2 國家 , 19 2 , 20 2 国家 , 21 2 , 22 2 , 23 2 , 24 2 bintang , 25 2

jun 2009: 1 2 الله , 2 2 keju , 3 2 terjemah , 4 2 , 5 2 gong , 6 2 , 7 2 , 8 2 , 9 2 , 10 2 , 11 2 , 12 2 , 13 2 , 14 2 , 15 2 daging , 16 2 , 17 2 , 18 2 , 19 2 , 20 2 森林 , 21 2 , 22 2 , 23 2 , 24 2 , 25 2

jul 2009: 1 3 DB , 2 2 rasa , 3 2 عيسى , 4 2 planet , 5 2 , 6 2 語言 , 7 2 , 8 2 , 9 2 alpa , 10 2 kasut , 11 2 awam , 12 2 iman , 13 2 dekad , 14 1 zat

ago 2009: 1 2 bateri , 2 2 cendawan , 3 2 pekak , 4 2 basikal , 5 2 timur , 6 2 parti , 7 2 jam , 8 2 ikan , 9 2 api , 10 2 bahasa , 11 2 besar , 12 2 dam , 13 2 gering , 14 2 dan , 15 2 sering , 16 1

set 2009: 1 2 , 2 2 , 3 2 , 4 2 askar , 5 2 kampung , 6 1

out 2009: 1 2 pelacur , 2 2 adalah , 3 2 ialah , 4 2 aktif , 5 2 ketam , 6 2 manusia , 7 2 itu , 8 2 Braille , 9 2 putih , 10 2 kayu , 11 2 hidung , 12 2 jantung , 13 2 ular , 14 2 kami , 15 2 naga , 16 2 harimau , 17 2 kuda , 18 2 orang , 19 2 sungai , 20 2 alas , 21 2 sudu , 22 1 bahari

nov 2009: 1 2 hitung , 2 2 pelacur , 3 2 arkeologi , 4 2 tropika , 5 2 bunga , 6 2 ya , 7 2 pagi , 8 2 suka , 9 2 legenda , 10 2 ais , 11 2 abai , 12 2 abactinal , 13 2 abad , 14 1 bahari

dez 2009: 1 2 logam , 2 2 album , 3 2 lari , 4 2 tangan , 5 2 petang , 6 2 mulut , 7 2 Tahun Baru , 8 2 ibu , 9 2 Matahari , 10 2 balai , 11 2 padi

jan 2010: 1 3 karya , 2 2 hitam , 3 2 katak , 4 2 atas , 5 2 padat , 6 2 kanji , 7 2 kaki , 8 2 sayang , 9 2 bambu , 10 1 rona

fev 2010: 1 3 monsun , 2 2 biologi , 3 2 kronik , 4 2 makan , 5 2 Neptun , 6 2 Utarid , 7 2 lelaki , 8 2 kambing , 9 2 dara , 10 2 aksi , 11 2 agensi , 12 2 abandon , 13 2 abacus , 14 1 toko

mar 2010: 1 2 ala , 2 2 baharu , 3 2 tidur , 4 2 cahaya , 5 2 sakit , 6 2 malam , 7 2 panas , 8 2 respons , 9 1 kodok

abr 2010: 1 3 etnologi , 2 2 origami , 3 2 terima kasih , 4 2 hitam , 5 2 bomba , 6 2 merah , 7 2 kakak , 8 2 tinggi , 9 2 kanan , 10 2 anjing , 11 2 nama , 12 2 sahabat , 13 2 kawan , 14 2 genting , 15 2 baru , 16 2 makanan , 17 2 tebuan , 18 1 usul

mai 2010: 1 2 gendut , 2 2 hakim , 3 2 langit , 4 2 hutan , 5 2 lagi , 6 2 ayam , 7 2 hasil

jun 2010: 1 1 gereja

jul 2010: 1 2 gereja , 2 2 Kamus bahasa Indonesia/Oy , 3 1 majlis

ago 2010: 1 2 buncit , 2 2 gendut , 3 2 , 4 2 adat , 5 2 aku

set 2010: 1 1 gereja

out 2010: 1 2 huruf , 2 1 origami

nov 2010: 1 1 majlis

jan 2011: 1 1

fev 2011: 1 1 maksud

mar 2011: 1 1

abr 2011: 1 1 buyut

mai 2011: 1 1 canggih

jun 2011: 1 1 Bioteknologi

ago 2011: 1 1 lawat

set 2011: 1 1 Poligon

out 2011: 1 1 kuala

nov 2011: 1 2 komku , 2 2 kita , 3 1 adi

dez 2011: 1 2 ا , 2 1 anak tumbuhan

fev 2012: 1 1 Japan

mar 2012: 1 1 trimas

abr 2012: 1 1 ابه

mai 2012: 1 2 aardvark , 2 1 keluarga

jun 2012: 1 1 Lampiran:Unikod

jul 2012: 1 2 hidrogen

ago 2012: 1 2 ijuk , 2 1 kanibalisme

set 2012: 1 1 zakar

out 2012: 1 1 adi

nov 2012: 1 1 easy come, easy go

dez 2012: 1 1 ustazah

jan 2013: 1 1 accretion

fev 2013: 1 1 administration

mar 2013: 1 2 makanan , 2 1 naif

abr 2013: 1 1 ardvark

mai 2013: 1 2 bahasa , 2 1 gedebe

jun 2013: 1 2 guring , 2 1 tutoi

jul 2013: 1 1 makzul

ago 2013: 1 1 bentang

set 2013: 1 2 gajet , 2 2 , 3 1 jelajah

out 2013: 1 1 jelajah

nov 2013: 1 3 cahaya , 2 2 kurrat

dez 2013: 1 2 harem , 2 1 berkemungkinan

jan 2014: 1 1 berkemungkinan

fev 2014: 1 2 abau , 2 2 abar , 3 2 abashed , 4 1 abyad

mar 2014: 1 2 qiamullail , 2 2 qasidah , 3 2 abiogenesis , 4 2 abintara , 5 1 ares

abr 2014: 1 2 azan , 2 2 قضاء , 3 2 berabad-abad , 4 1 玫瑰

mai 2014: 1 2 теория , 2 2 Латвия , 3 2 qari , 4 1 maslahat

jun 2014: 1 1 Ramadan

jul 2014: 1 2 апрель , 2 2 телевидение , 3 1 lê zêde kirin

ago 2014: 1 2 малайзийский , 2 2 gedebe , 3 1 팔월

set 2014: 1 2 referendum , 2 2 Malaysia , 3 2 生日快乐 , 4 2 生日快樂 , 5 2 ذوالقعدة , 6 2 September , 7 1 rodzynek

out 2014: 1 2 , 2 2 Zulhijah , 3 2 ذوالحجة , 4 1 cauldron

nov 2014: 1 2 , 2 1 oktagon

dez 2014: 1 2 mirai , 2 1 yayi

jan 2015: 1 3 idealisme , 2 2 maru , 3 2 , 4 2 nyamuk , 5 2 kecil , 6 2 しょう , 7 2 ローマ字 , 8 2 romaji , 9 2 Tulisan Cina Ringkas , 10 2 未来 , 11 2 tinja , 12 1 sepina

No data on this page have been normalized to 30 day months (as WMF does on certain traffic reports).
Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Terça-feira, 3 de março 2015 04:04

Dump file mswiktionary-20150220-pages-meta-history.xml.7z (full dump), size 8.6 Mb as 7z -> 984 Mb
Dump processed till Jan 31, 2015, on server stat1002, ready at Sat-21/02/2015-10:32 after 1 min, 16 sec.

Versão do script:2.6
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.