Estatísticas da Wikcionário malaio

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist

Metrics have been collected from a full archive dump, which contains all revisions of every article, meta data and raw content.
See also metrics definitions


 
Monthly counts & Quarterly rankings: fevereiro 2015
 
DataWikcionaristasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
fev 2015+4%   +5%   +53%+5%+6%+4%+3%-3%+6%0%
jan 20150%   +3%   +35%+4%+5%+4%+1%-1%+4%0%
dez 20140%   +1%   +251%+1%+2%+1%+1%0%+3%0%
nov 2014+4%   +1%   -72%+1%+1%+1%0%0%-1%0%
out 20140%   +4%   -14%+4%+5%+4%+1%+1%+8%0%
set 20140%   +5%   +169%+4%+4%+2%+2%+2%+8%0%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
fev 2015281422,6 k414,19643414,1 Mb413 k26 k33 k166134186
jan 201527 3 2,5 k314,69592233,9 Mb391 k25 k32 k171126186
dez 201427 1 2,4 k1159521653,8 Mb374 k24 k31 k172121186
nov 20142712 2,4 k115,1952473,7 Mb368 k23 k31 k172118186
out 201426 212,3 k315,39501663,7 Mb363 k23 k31 k172119186
set 201426 212,3 k415,79451943,6 Mb347 k22 k30 k170110186
ago 201426 2 2,2 k116,4954723,4 Mb334 k22 k30 k167102186
jul 201426 1 2,1 k116,5952823,4 Mb330 k22 k29 k16597186
jun 201426 1 2,1 k116,8962703,4 Mb326 k22 k29 k16496186
mai 201426 312,1 k3179672123,3 Mb323 k21 k29 k16496186
abr 201426 212,0 k317,99881943,2 Mb311 k20 k27 k16092186
mar 201426 211,9 k518,710043203,1 Mb299 k20 k27 k16092186
fev 201426 211,7 k120,110522623,0 Mb287 k19 k25 k15583186
jan 20142612 1,7 k 20,410611132,9 Mb283 k19 k25 k15483186
dez 201325 1 1,7 k 20,310601712,9 Mb282 k19 k25 k15483186
nov 201325 2 1,7 k 20,31060482,9 Mb282 k19 k25 k15483186
out 201325 1 1,7 k 20,3105982,9 Mb281 k19 k25 k15483186
set 201325 2 1,7 k 20,31059182,9 Mb281 k19 k25 k15483186
ago 201325 1 1,7 k 20,310592242,9 Mb281 k19 k25 k15483186
jul 201325 2 1,7 k 20,110591522,9 Mb281 k19 k24 k15483186
jun 201325 2 1,7 k 20,110511092,9 Mb278 k19 k24 k15483186
mai 201325 1 1,7 k 20,110551032,9 Mb278 k19 k24 k15483186
abr 201325 1 1,7 k 20,11056992,9 Mb278 k19 k24 k15483186
mar 201325 1 1,7 k 20,11058972,9 Mb277 k19 k24 k15583186
fev 201325 2 1,6 k42010572682,9 Mb277 k19 k24 k15582186
jan 201325 2 1,5 k121,211162322,8 Mb274 k19 k20 k15527186
dez 201225 1 1,5 k 21,411311472,8 Mb274 k19 k20 k15526186
nov 201225 1 1,5 k121,311311332,8 Mb274 k19 k19 k15527186
out 201225   1,5 k 21,611382182,7 Mb269 k19 k19 k15626186
set 201225   1,5 k 21,511371772,7 Mb268 k19 k19 k15626186
ago 201225 1 1,5 k 21,311311612,7 Mb267 k19 k19 k15626186
jul 20122511 1,5 k 21,311301012,7 Mb266 k19 k19 k15626186
jun 201224 2 1,5 k 21,311241822,7 Mb264 k19 k19 k15626186
mai 201224 2 1,5 k 21,211251552,7 Mb263 k19 k18 k15626186
abr 201224 1 1,5 k 21,211271252,7 Mb263 k19 k18 k15526186
mar 201224 1 1,5 k 21,111271212,7 Mb263 k19 k18 k15526186
fev 201224 1 1,5 k 21,111271592,7 Mb262 k19 k18 k15526186
jan 2012241  1,5 k 20,911222462,7 Mb261 k19 k18 k15526186
dez 20112314 1,5 k120,811213452,7 Mb261 k19 k17 k15526186
nov 201122 1 1,4 k 2111291332,6 Mb257 k19 k16 k15525186
out 20112223 1,4 k 2111321132,6 Mb256 k19 k16 k15525186
set 201120   1,4 k 21,11129272,6 Mb254 k18 k16 k15425186
ago 201120 1 1,4 k 21,11129572,6 Mb254 k18 k16 k15425185
jul 201120   1,4 k 2111291882,6 Mb254 k18 k16 k15425185
jun 201120   1,4 k 20,91130472,6 Mb254 k18 k16 k15425185
mai 201120 1 1,4 k 20,911302602,6 Mb254 k18 k16 k15425185
abr 201120 1 1,4 k 20,81131912,6 Mb253 k18 k16 k15425184
mar 201120   1,4 k 20,711301312,6 Mb253 k18 k15 k15425184
fev 201120 1 1,4 k 20,61131712,6 Mb253 k18 k15 k15425184
jan 201120   1,4 k 20,61131522,6 Mb253 k18 k15 k15425184
dez 201020   1,4 k 20,51131762,6 Mb253 k18 k15 k15525184
nov 201020 111,4 k 20,511316702,6 Mb253 k18 k15 k15525184
out 201020 111,4 k 2011312682,6 Mb253 k18 k15 k15525184
set 201020 111,4 k 19,811313162,6 Mb253 k18 k14 k15525184
ago 2010201211,4 k 19,611311552,6 Mb253 k18 k14 k15525184
jul 201019 211,4 k 19,511315342,6 Mb253 k18 k14 k15523184
jun 201019 2 1,4 k 19,211321012,5 Mb253 k18 k13 k15523184
mai 201019 311,4 k 19,111313632,5 Mb252 k18 k13 k15523184
abr 2010191421,4 k 1911261,3 k2,5 Mb250 k18 k13 k15923184
mar 201018 321,4 k 18,211034592,5 Mb244 k18 k13 k16523184
fev 2010181321,4 k 1811057182,4 Mb243 k18 k13 k16923184
jan 201017 411,4 k 17,610891,1 k2,4 Mb239 k18 k12 k17422184
dez 200917 321,4 k 16,910701,3 k2,4 Mb234 k18 k12 k17722184
nov 200917 321,3 k 16,110481,0 k2,3 Mb228 k18 k12 k18022184
out 2009171421,3 k115,410351,1 k2,2 Mb224 k18 k12 k18322184
set 200916 321,3 k114,810198342,2 Mb219 k18 k12 k19422184
ago 200916 311,3 k214,410173832,1 Mb216 k17 k12 k19622184
jul 200916 311,3 k 14,610312642,1 Mb209 k16 k11 k19922184
jun 200916 321,3 k114,510261,1 k2,1 Mb208 k16 k11 k20122184
mai 200916 321,2 k 13,910329732,0 Mb206 k16 k11 k20222184
abr 200916 321,2 k 13,210295352,0 Mb204 k16 k11 k20422184
mar 200916 311,2 k 12,810306152,0 Mb203 k16 k11 k20820184
fev 2009161411,2 k 12,410293132,0 Mb202 k16 k9,8 k21120184
jan 200915 1 1,2 k 12,21032482,0 Mb201 k16 k9,1 k21520184
dez 20081511 1,2 k 12,21032562,0 Mb199 k16 k9,0 k22320184
nov 200814 3 1,2 k112,310271081,9 Mb198 k16 k9,0 k22320183
out 200814 3 1,2 k212,410372541,9 Mb196 k16 k8,8 k22320183
set 2008141311,1 k 12,710754371,9 Mb195 k16 k8,7 k22320183
ago 200813 2 1,1 k 12,41068691,9 Mb192 k15 k8,6 k22320183
jul 200813 1 1,1 k 12,41069681,9 Mb191 k15 k8,5 k22320183
jun 200813 1 1,1 k112,410681061,9 Mb190 k15 k8,5 k22320184
mai 200813 2 1,1 k 12,610642871,8 Mb186 k15 k8,3 k22120184
abr 200813 211,1 k212,510604461,8 Mb183 k15 k7,9 k22020184
mar 200813 221,0 k312,710426731,7 Mb170 k14 k7,7 k24720184
fev 200813 229161213,210401,9 k1,6 Mb155 k13 k6,9 k24120181
jan 200813131572917,710251,0 k1,0 Mb92 k7,0 k4,3 k18411181
dez 20071224 306129,71047119599 kb46 k1,3 k2,2 k1085180
nov 200710 1 283 31,7109225582 kb44 k1,2 k2,1 k1095179
out 200710 21277 32,310831,1 k570 kb43 k1,2 k2,1 k1085178
set 200710 31269129,21049653531 kb41 k1,2 k2,0 k1066179
ago 200710 21252 28,610851,6 k504 kb39 k1,1 k2,0 k1096179
jul 200710 21237 23,81027828423 kb36 k1,0 k1,9 k1086179
jun 200710 21223 21,6997964373 kb33 k9801,9 k1046153
mai 200710 31210118,3865869315 kb27 k9251,8 k1026153
abr 200710 21193 15,5827734259 kb24 k8581,7 k976153
mar 200710 21182 12,4830565240 kb23 k7941,6 k866134
fev 200710 21168110767516215 kb19 k7271,7 k805750
jan 20071023114518,1681376170 kb15 k5951,4 k583041
dez 2006811 106 7,571540124 kb11 k3791,1 k17308
nov 20067 1 95 7,969435110 kb9,6 k3018831308
out 20067 2 87 8,26437097 kb8,2 k2447721308
set 20067 1 76 8,55574978 kb6,2 k185696 307
ago 20067 2164 9,357815373 kb5,4 k156564 447
jul 2006712154 8,245115853 kb3,7 k124496 447
jun 20066 2 46 6,24652945 kb3,3 k107458 447
mai 2006611 34 7,64212835 kb2,2 k97326 447
abr 20065   27 8,5465332 kb1,9 k97248 457
mar 20065 1 26 8,74811432 kb1,8 k97248 457
fev 2006511 22 9,73784626 kb1,3 k77233 457
jan 20064   22 7,6378226 kb1,3 k77225 45 
dez 20054   22 7,5378726 kb1,3 k77223 45 
nov 2005411 22 7,23781724 kb1,3 k7793 45 
out 20053   19 7,4436124 kb1,3 k7793 45 
set 20053   19 7,4436524 kb1,3 k7793 45 
ago 20053   18 7,5287452 kb8875933   
jul 20053   17 7,74813222 kb1,3 k7023 45 
jun 20053   16 6,2490221 kb1,3 k6826 45 
mai 20053   16 6,1490221 kb1,3 k6823 45 
abr 20053   16 5,9491 21 kb1,3 k6823 45 
mar 20053   16 5,9491 21 kb1,3 k6823 45 
fev 20053   16 5,9491421 kb1,3 k6823 45 
jan 20053   16 5,7491321 kb1,3 k6823 45 
dez 20043   16 5,5491 21 kb1,3 k6723 45 
nov 20043   16 5,5491121 kb1,3 k6723 45 
out 20043   16 5,4491321 kb1,3 k6723 45 
set 20043   16 5,2491221 kb1,3 k6723 45 
ago 20043   16 5,1491 21 kb1,3 k6713 45 
jul 2004311 16 5,14914121 kb1,3 k6713 45 
jun 20042 1 15 2,7517916 kb1,1 k526 45 
mai 20042   14 2,3548216 kb1,0 k525 45 
abr 20042   12 2,538525,0 kb612425   
mar 20042   12 2,334264,5 kb541424   
fev 20042   12 1,8349 4,7 kb553424 2 
jan 20042   12 1,8349 4,7 kb553424 2 
dez 2003211 12 1,8349124,7 kb553424 2 
nov 2003111 6 1,7275102,0 kb219214 2 
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
The following table ranks this project in relation to projects in other languages with 1000+ articles
jan 20156438424396443279836868925554126
out 20146437493897422279836968915453126
jul 20146230574797582292846970915256126
abr 20146033493698411266826972915255126
jan 20145934464997591289826769915255126
out 201360395846976112108826768895155126
jul 20136040525195641284796667875354126
abr 20135837675095651186796566875354126
jan 20135843595494621186786365925271126
out 20125634754993591185776364885271126
jul 20125537685393671194756164875271126
abr 20125640645292661188756165855271126
jan 20125332764990601179736065835072126
out 20115719464889711191716063794973126
jul 20116042794887661173706063774773126
abr 20115834634585621187685963764571126
jan 20115435765083601289665962764469126
out 20105336806282601272665961754367126
jul 20105543626680631368645559754066126
abr 20105337463779571349625457723766126
jan 20105530405976591245615454693565126
out 20095536454276532349615354693566126
jul 20095439516176602269605154683264126
abr 20095248483673521258595052682863126
jan 20095159664272561274594949672663126
out 20085036414172431250584947652661125
jul 20085031544571571278574847632460125
abr 20084942464068471250544442622356125
jan 2008473840447131666642575155642568125
out 2007503849457661636332635771702772125
jul 2007494246387657636334665971692370125
abr 2007473952367660606046676072672066125
jan 2007452340347554535354676373642442125
out 2006503847427252494968666376626541125
jul 2006473439326849454552656574626034125
abr 2006543652347346414172636669605135125
jan 2006534456346841363688636668524237119
out 2005523350266435303071576163553930107
jul 2005473242255934262644495355622826102
abr 200543254221522920207246515156212393
jan 200539233619432415155041424250162282
out 20043027311634201010413333363392070
jul 200425152410261644202428292971254
abr 200410785953313991074819
jan 2004744373221088773616
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100ediçõesbytes
 WikcionaristasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikcionaristas (usuários registrados)
A = Wikcionaristas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikcionaristas que editaram pelo menos dez vezes desde que chegaram
C = Wikcionaristas que contribuíram cinco vezes ou mais este mês
D = Wikcionaristas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  5  10  100  1  3  5  10  25  100  250  5  10  1  3  5  10  25  100  250  1000  2500  5  10  100 
Monthly counts for recent history of wiki
fev 2015544432  21 7422     13644211  11 
jan 201574322  22 4321     5553221  11 
dez 201422111  21 111      32211    11 
nov 201432211     31       43221    11 
out 2014332211     1        633221      
set 2014322111     521      8432     11 
ago 201442221  11 4        8441     1  
jul 201453111  11 211      4331        
jun 201421111  11 111      3111        
mai 2014633111  11 22       6431        
abr 2014322211  1  1111     9221        
mar 20144222111 11 3111     7221        
fev 2014222211  111311      62222       
jan 2014222    21 2111     6321        
dez 2013221    11131       521         
nov 201352211     2111     921         
out 2013211       211      532111      
set 2013422       22       6321        
ago 2013111    11111       42          
jul 201322221  111111      6211        
jun 201322222  11 111      3111        
mai 2013411    22 1        411      1  
abr 20132111   21 111      4111        
mar 20133111   21 3111   1 4221     11 
fev 201332211  321322      732         
jan 201322211  22122       42221    11 
Quarterly counts for entire history of wiki
jan 201574322  22 4321     5553221  11 
out 2014332211     1        633221      
jul 201453111  11 211      4331        
abr 2014322211  1  1111     9221        
jan 2014222    21 2111     6321        
out 2013211       211      532111      
jul 201322221  111111      6211        
abr 20132111   21 111      4111        
jan 201322211  22122       42221    11 
out 201221    22121       6211     1  
jul 20124211   21 311      14422        
abr 20123111   43 221      533         
jan 2012      3212        61       21 
out 20113332   32 2111     711      11 
jul 2011      3311        211         
abr 201121111  21          422         
jan 20112     11 1        51          
out 20102111111    31       5221        
jul 20104221111    211      11          
abr 20106444422    42111    741      11 
jan 20104443311    211111   5333        
out 20096443321    322111   733111      
jul 2009433331     22111    5222111  11 
abr 20094333221    42111    7432111     
jan 20093111   11 832111   12531111  11 
out 200853333  11 844311   1477521111   
jul 200821111  1  42211    54211111    
abr 2008222221  11 422111   52211111    
jan 20085333311 11 444211   53333111    
out 200722221111   31       3322111     
jul 20072222111 11 54311    4433111     
abr 20072222211 11 22111    2222111     
jan 2007333331  11 321      4332        
out 20062221   11 1        3111        
jul 2006322211     21       5           
abr 20061                             
jan 2006                  2           
out 2005                              
jul 2005                              
abr 2005                              
jan 2005                              
out 2004                              
jul 200421111              1111        
abr 20042                 1           
jan 2004                  2111        

 

Distribuição de edições de artigos por wikcionaristas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikcionaristasEdições total
1110100.0%28,527100.0%
34540.9%28,44199.7%
102724.5%28,34299.4%
321715.5%28,18698.8%
10098.2%27,77297.4%
31643.6%26,82094.0%
100043.6%26,82094.0%
316221.8%23,27681.6%
1000010.9%18,45064.7%

 

6 wikcionaristas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions
agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
MalaysiaboyUC4 01,522117631111nov 04, 20134808235734147
26 RamadanUC5+12651942225dez 01, 2011118419912922
SNN95UC7+41941291,258851abr 23, 20136755728555340
Sa'yUC14...47471717fev 06, 20152121211010
CommonsDelinkerUC19-11812-nov 09, 20072667----
Joachim MosUC59+3721--mai 25, 2013643----

 

20 wikcionaristas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
On Wheezier PlotUC118,450jul 24, 20063140out 20, 20101591
InterwicketUC24,826jan 29, 20092220nov 08, 20101572
AuroraUC32,022set 17, 20053450out 13, 2014137
PM PoonUC6262set 22, 20053445ago 13, 20063120
KamalzackUC8125ago 12, 20111295set 24, 2013521
KurniasanUC9106set 23, 20082348jan 25, 20111494
Amir Hamzah 2008UC1073out 20, 20111226ago 02, 2012939
YosriUC1168nov 10, 20034127fev 05, 20092213
WhjaygUC1260jan 17, 20082598fev 28, 20082556
AlamnirvanaUC1355abr 06, 20101788abr 18, 20111411
KhairulkhalidUC1539jun 30, 20043894jul 21, 20043873
Putera Luqman Tunku AndreUC1633dez 23, 20072623jan 01, 20082614
JufertUC1731jan 17, 20072963mar 11, 20072910
Thijs!botUC1818ago 22, 20063111jun 20, 20072809
ZfcUC2016nov 07, 20053399nov 07, 20053399
MunshiUC2114ago 25, 20101647ago 25, 20101647
SyahirSQRT2UC2214jul 11, 2012961ago 15, 2012926
NiduzziUC2312out 31, 20063041dez 06, 20082274
FanatixUC2412mar 09, 20092181jul 10, 2014232
AntukecikUC2511jun 11, 20063183dez 04, 20072642

 

usuários anônimos, ordenados por número de contribuições
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
60.52.72.252282
60.53.47.20566
60.50.250.1459
60.52.75.17454
82.243.126.5854
60.50.244.20953
60.49.111.5549
60.49.107.4448
60.50.255.17347
60.50.241.10744

No total 2.336 edições foram feitas por usuários anônimos, de um total de 36.503 edições ( 6e %)
  


15 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
HydrizBotUC12,168mai 23, 20111376jan 22, 201536--
Luckas-botUC21,499fev 03, 20101850jan 27, 2014396--
VolkovBotUC3591jan 31, 20082584mar 22, 2013707--
RobotGMwiktUC4527set 05, 20063097jun 06, 20082457--
KamikazeBotUC5281dez 04, 20111181mar 07, 2013722--
YS-BotUC6256dez 27, 2012792fev 26, 20151--
AvocatoBotUC7208out 31, 20111215ago 03, 2013573--
JAnDbotUC844mai 01, 20072859fev 28, 2015---
SieBotUC916jun 04, 20072825fev 04, 20082580--
Makecat-botUC1016nov 10, 2012839jan 23, 2013765--
CarsracBotUC1114dez 28, 2012791mai 30, 2013638--
EdmundobotUC1211dez 29, 20082251dez 29, 20082251--
EscarbotUC135nov 28, 20063013dez 19, 20072627--
AlexbotUC142jan 20, 20082595jan 20, 20082595--
QualiaBotUC152jul 23, 20082410jul 27, 20082406--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110JpgPng
fev 20153,4 k82841531541,3 k3242      30212
jan 20153,3 k7834103661,1 k3232      16312
dez 20143,2 k7743973669833231      6112
nov 20143,2 k7743973669673229      4512
out 20143,2 k7703973669423229      16612
set 20143,1 k7693973668433228      19112
ago 20143,0 k7643973668363228      6012
jul 20143,0 k7593973668343227      6812
jun 20142,9 k7593973668263227      4512
mai 20142,9 k7593973668253227      19112
abr 20142,8 k7593973668203227      18312
mar 20142,7 k7563973668103227      29912
fev 20142,5 k7533973667943227      13612
jan 20142,5 k7493973667653224      1612
dez 20132,5 k7383963667643224      1012
nov 20132,5 k7373963667603224      4212
out 20132,5 k7313963667603224      712
set 20132,5 k7223963667563222      1712
ago 20132,5 k7063963667563222      912
jul 20132,5 k7033963667563222      4812
jun 20132,5 k7003963667552222      5212
mai 20132,5 k6993963637551219      1112
abr 20132,5 k6973963637551219      1912
mar 20132,5 k6933963627491218      2612
fev 20132,5 k6853963607461218      7712
jan 20132,4 k6793963607461217      7512
dez 20122,3 k6703953607431214      712
nov 20122,3 k6653953607411214      5712
out 20122,3 k6593953607181211      512
set 20122,3 k6543953607111211      312
ago 20122,3 k6493953607031210      3312
jul 20122,3 k6433953606961208      1812
jun 20122,3 k6363953606891204      1212
mai 20122,3 k6243943606841203      2212
abr 20122,3 k6183943606741202      2212
mar 20122,3 k6083943606721201      2312
fev 20122,3 k6053943606721201      912
jan 20122,3 k5983943606691201       12
dez 20112,3 k5903943606691201      6012
nov 20112,3 k5763943586461200      3612
out 20112,2 k5643943586451199      3212
set 20112,2 k5603943586451199      412
ago 20112,2 k5573943586451199      912
jul 20112,2 k5513943586451199       12
jun 20112,2 k5433943586451199      412
mai 20112,2 k5403943586351199      1712
abr 20112,2 k5363943586351199      3012
mar 20112,2 k5273943586331195      112
fev 20112,2 k5233943586331195      1712
jan 20112,2 k5153933586331195      212
dez 20102,2 k5103933586331195       12
nov 20102,2 k5093933586331195      66812
out 20102,2 k5053933586331195      26612
set 20102,2 k5023923586331195      31612
ago 20102,2 k4963923586331195      14912
jul 20102,2 k4823923586331195      53412
jun 20102,2 k4823923586331195      10012
mai 20102,2 k4693923586331195      36312
abr 20102,2 k4683893586311195      126312
mar 20102,2 k4623893586311195      45912
fev 20102,2 k4573893586071194      71412
jan 20102,2 k4533893586041194      109412
dez 20092,2 k4403893586031194      131612
nov 20092,2 k4393893586011194      102412
out 20092,2 k4383893586011194      107812
set 20092,2 k4353893586011194      81812
ago 20092,2 k4303893586011193      32612
jul 20092,1 k4303693585951193      25012
jun 20092,1 k4293663585841182      104512
mai 20092,1 k4263663585751177      95312
abr 20092,1 k4233653585391171      52312
mar 20092,1 k4123643585371166      61312
fev 20092,1 k4073643585371166      30612
jan 20092,0 k4013633585371165      2412
dez 20082,0 k3933633585371165      3012
nov 20082,0 k3893633585311160      8312
out 20082,0 k3733603545261157      23812
set 20082,0 k3613593525181155      41512
ago 20081,9 k3573591525141155      631 
jul 20081,9 k3083591515121153      551 
jun 20081,9 k3063591515101153      241 
mai 20081,9 k2563591505101152      891 
abr 20081,9 k2123201505081152      2131 
mar 20081,8 k1663201504881146      4891 
fev 20081,8 k1612631504631143      7821 
jan 20081,4 k159185146377182      5761 
dez 20071,2 k15795146169133      1111 
nov 20071,1 k11390145151132      191 
out 20071,1 k11176144145131      10561 
set 20071,1 k11076144137131      6281 
ago 20071,1 k10875144128130      15441 
jul 20071,1 k10775144111127      7941 
jun 20071,0 k8674 44110127      954  
mai 20071,0 k8572 42108127      831  
abr 20071,0 k8556 4289127      699  
mar 20074018544 4274126      488  
fev 20073028533 407018      469  
jan 20072728427 404814      315  
dez 20061988225 404014      14  
nov 20061878225 404013      12  
out 20061798125 403912      24  
set 20061708024 403912      10  
ago 20061681122 403412      149  
jul 20061321122 402911      151  
jun 200679921 402811      25  
mai 200671921 402211      18  
abr 200658818 402011      1  
mar 200657818 402011      13  
fev 200653818 401711      42  
jan 200645718 401711         
dez 200545618 401611      1  
nov 200543316 401611      16  
out 200535310 40161          
set 20053539 40161          
ago 20053539 40161          
jul 20053338 4016           
jun 20053338 4016           
mai 20053338 3916           
abr 20053328 3916           
mar 20053318 3916           
fev 20053318 3916           
jan 20053217 3916           
dez 20043217 3916           
nov 20043217 3816           
out 20043217 3816           
set 20043117 3816           
ago 20043117 3816           
jul 20043117 3816           
jun 200415 4 3816           
mai 200414 2 3416           
abr 200412   3416           
mar 200412   3316           
fev 200412   218           
jan 200412   135           
dez 200312   12           
nov 20036                

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

nov 2003: 1 2 etnologi , 2 1 arkeologi

dez 2003: 1 1 khazanah

mar 2004: 1 1 arkeologi

abr 2004: 1 2 arkeologi

mai 2004: 1 1 nga'dau

jun 2004: 1 2 ajal , 2 1 nga'dau

jul 2004: 1 2 abang , 2 1 abandon

set 2004: 1 1 ajal

fev 2005: 1 1 abang

mai 2005: 1 1 haiwan

set 2005: 1 1 arkeologi

nov 2005: 1 1 gedung

dez 2005: 1 1 bonggol

fev 2006: 1 2 cadang , 2 1 arkeologi

mar 2006: 1 1 ajal

abr 2006: 1 1 Laman Utama

mai 2006: 1 2 Laman Utama , 2 1 rumah

jun 2006: 1 1 bacaan

jul 2006: 1 1 Kamus bahasa Indonesia/Un

ago 2006: 1 2 Bumi , 2 1 Kamus bahasa Indonesia/Is

set 2006: 1 1 Wiktionary

out 2006: 1 1 perempuan

nov 2006: 1 1 e

dez 2006: 1 1 l

jan 2007: 1 2 v , 2 2 u , 3 2 t , 4 2 r , 5 2 q , 6 1 penomboran

fev 2007: 1 3 sering , 2 2 sembilan , 3 2 lapan , 4 2 tujuh , 5 2 enam , 6 2 lima , 7 2 empat , 8 2 tiga , 9 2 dua , 10 2 satu , 11 2 sifar , 12 2 3 , 13 2 2 , 14 1 kerap

mar 2007: 1 3 Laman Utama , 2 2 on'yomi , 3 2 , 4 2 agama , 5 2 agar , 6 1 kesembilan-sembilan

abr 2007: 1 1 senarai perkataan Z

mai 2007: 1 2 saat , 2 2 perisian , 3 2 hasil , 4 1 rawak

jun 2007: 1 2 badak , 2 1 Kamus Wiki

jul 2007: 1 1 luah

ago 2007: 1 2 Rumi , 2 2 riadah , 3 2 pusing , 4 2 bisa , 5 1 etnologi

set 2007: 1 2 cereka , 2 2 fiksyen , 3 2 seram , 4 2 luak , 5 2 ubat , 6 2 baru , 7 2 imbas , 8 2 alpa , 9 2 pusing , 10 2 rawak , 11 2 karut , 12 2 wahana , 13 2 , 14 2 sering , 15 2 aduk , 16 2 aduhai , 17 2 aduh , 18 2 acuh , 19 2 acap , 20 2 abiotik

out 2007: 1 2 catur , 2 2 besar , 3 1 buah

nov 2007: 1 2 b , 2 1 banci

dez 2007: 1 3 musuh , 2 3 sahabat , 3 3 rakan , 4 2 jalan

jan 2008: 1 3 muzik klasikal , 2 3 opera , 3 3 respons , 4 3 suka , 5 2 kami , 6 2 kita , 7 1

fev 2008: 1 3 kucing , 2 3 perah , 3 2 kad , 4 2 kanji , 5 2 kaki , 6 2 hidung , 7 2 telinga , 8 2 datang , 9 2 tangan , 10 2 bahasa , 11 2 anjing , 12 2 negara , 13 2 nama , 14 2 malam , 15 2 petang , 16 2 pagi , 17 2 subuh , 18 2 bintang , 19 1 Rabu

mar 2008: 1 2 planet , 2 2 Neptun , 3 1 kronik

abr 2008: 1 2 utara , 2 2 barat , 3 2 tinggi , 4 2 timur , 5 2 kayu , 6 1 oren

mai 2008: 1 2 putih mata , 2 2 biru , 3 2 hijau , 4 1 hitam

jun 2008: 1 2 tawar , 2 1 celaka

jul 2008: 1 1 mustahil

ago 2008: 1 2 mışıq , 2 1 laksa

set 2008: 1 4 percuma , 2 3 celaka , 3 2 mangga , 4 1 nga'dau

out 2008: 1 3 manre , 2 3 wedding , 3 3 indo , 4 3 seddi , 5 3 istilah , 6 3 sekolah , 7 3 resonance , 8 2 pepek , 9 2 short story , 10 2 cerpen , 11 2 golok , 12 2 تاهي , 13 2 tahi , 14 2 kau , 15 2 lampe , 16 1

nov 2008: 1 2 suasa , 2 2 tollolang , 3 2 Mesia , 4 2 slave , 5 2 hamba

dez 2008: 1 2 doorknob , 2 2 tombol pintu , 3 1 leksikon

jan 2009: 1 1 wombat

fev 2009: 1 2 tadbir , 2 2 bomoh , 3 2 dukun , 4 2 pawang , 5 2 doktor , 6 2 ahli perubatan , 7 2 tabib , 8 2 tabah , 9 2 pedati , 10 1 kala

mar 2009: 1 2 kerajaan , 2 2 din , 3 2 kala , 4 2 tabah , 5 2 meong , 6 2 golok , 7 2 zaměření , 8 2 seddi , 9 2 歡迎 , 10 2 keramat , 11 2 kronik , 12 2 hari , 13 2 negara , 14 2 petang , 15 2 Zuhal , 16 2 Marikh , 17 2 candu , 18 2 tahil , 19 2 lelaki , 20 2 imbas , 21 2 Rumi , 22 2 obor , 23 1 hak

abr 2009: 1 2 ข้าว , 2 2 , 3 2 kad , 4 2 , 5 2 , 6 2 , 7 2 , 8 2 , 9 2 , 10 2 opera , 11 2 , 12 2 snek , 13 2 muda , 14 1 manusia

mai 2009: 1 2 perkasa , 2 2 pustaka , 3 2 kaut , 4 2 pawang , 5 2 meong , 6 2 , 7 2 , 8 2 , 9 2 , 10 2 , 11 2 , 12 2 世界 , 13 2 , 14 2 , 15 2 , 16 2 , 17 2 , 18 2 國家 , 19 2 , 20 2 国家 , 21 2 , 22 2 , 23 2 , 24 2 bintang , 25 2

jun 2009: 1 2 الله , 2 2 keju , 3 2 terjemah , 4 2 , 5 2 gong , 6 2 , 7 2 , 8 2 , 9 2 , 10 2 , 11 2 , 12 2 , 13 2 , 14 2 , 15 2 daging , 16 2 , 17 2 , 18 2 , 19 2 , 20 2 森林 , 21 2 , 22 2 , 23 2 , 24 2 , 25 2

jul 2009: 1 3 DB , 2 2 rasa , 3 2 عيسى , 4 2 planet , 5 2 , 6 2 語言 , 7 2 , 8 2 , 9 2 alpa , 10 2 kasut , 11 2 awam , 12 2 iman , 13 2 dekad , 14 1 zat

ago 2009: 1 2 bateri , 2 2 cendawan , 3 2 pekak , 4 2 basikal , 5 2 timur , 6 2 parti , 7 2 jam , 8 2 ikan , 9 2 api , 10 2 bahasa , 11 2 besar , 12 2 dam , 13 2 gering , 14 2 dan , 15 2 sering , 16 1

set 2009: 1 2 , 2 2 , 3 2 , 4 2 askar , 5 2 kampung , 6 1

out 2009: 1 2 pelacur , 2 2 adalah , 3 2 ialah , 4 2 aktif , 5 2 ketam , 6 2 manusia , 7 2 itu , 8 2 Braille , 9 2 putih , 10 2 kayu , 11 2 hidung , 12 2 jantung , 13 2 ular , 14 2 kami , 15 2 naga , 16 2 harimau , 17 2 kuda , 18 2 orang , 19 2 sungai , 20 2 alas , 21 2 sudu , 22 1 bahari

nov 2009: 1 2 hitung , 2 2 pelacur , 3 2 arkeologi , 4 2 tropika , 5 2 bunga , 6 2 ya , 7 2 pagi , 8 2 suka , 9 2 legenda , 10 2 ais , 11 2 abai , 12 2 abactinal , 13 2 abad , 14 1 bahari

dez 2009: 1 2 logam , 2 2 album , 3 2 lari , 4 2 tangan , 5 2 petang , 6 2 mulut , 7 2 Tahun Baru , 8 2 ibu , 9 2 Matahari , 10 2 balai , 11 2 padi

jan 2010: 1 3 karya , 2 2 hitam , 3 2 katak , 4 2 atas , 5 2 padat , 6 2 kanji , 7 2 kaki , 8 2 sayang , 9 2 bambu , 10 1 rona

fev 2010: 1 3 monsun , 2 2 biologi , 3 2 kronik , 4 2 makan , 5 2 Neptun , 6 2 Utarid , 7 2 lelaki , 8 2 kambing , 9 2 dara , 10 2 aksi , 11 2 agensi , 12 2 abandon , 13 2 abacus , 14 1 toko

mar 2010: 1 2 ala , 2 2 baharu , 3 2 tidur , 4 2 cahaya , 5 2 sakit , 6 2 malam , 7 2 panas , 8 2 respons , 9 1 kodok

abr 2010: 1 3 etnologi , 2 2 origami , 3 2 terima kasih , 4 2 hitam , 5 2 bomba , 6 2 merah , 7 2 kakak , 8 2 tinggi , 9 2 kanan , 10 2 anjing , 11 2 nama , 12 2 sahabat , 13 2 kawan , 14 2 genting , 15 2 baru , 16 2 makanan , 17 2 tebuan , 18 1 usul

mai 2010: 1 2 gendut , 2 2 hakim , 3 2 langit , 4 2 hutan , 5 2 lagi , 6 2 ayam , 7 2 hasil

jun 2010: 1 1 gereja

jul 2010: 1 2 gereja , 2 2 Kamus bahasa Indonesia/Oy , 3 1 majlis

ago 2010: 1 2 buncit , 2 2 gendut , 3 2 , 4 2 adat , 5 2 aku

set 2010: 1 1 gereja

out 2010: 1 2 huruf , 2 1 origami

nov 2010: 1 1 majlis

jan 2011: 1 1

fev 2011: 1 1 maksud

mar 2011: 1 1

abr 2011: 1 1 buyut

mai 2011: 1 1 canggih

jun 2011: 1 1 Bioteknologi

ago 2011: 1 1 lawat

set 2011: 1 1 Poligon

out 2011: 1 1 kuala

nov 2011: 1 2 komku , 2 2 kita , 3 1 adi

dez 2011: 1 2 ا , 2 1 anak tumbuhan

fev 2012: 1 1 Japan

mar 2012: 1 1 trimas

abr 2012: 1 1 ابه

mai 2012: 1 2 aardvark , 2 1 keluarga

jun 2012: 1 1 Lampiran:Unikod

jul 2012: 1 2 hidrogen

ago 2012: 1 2 ijuk , 2 1 kanibalisme

set 2012: 1 1 zakar

out 2012: 1 1 adi

nov 2012: 1 1 easy come, easy go

dez 2012: 1 1 ustazah

jan 2013: 1 1 accretion

fev 2013: 1 1 administration

mar 2013: 1 2 makanan , 2 1 naif

abr 2013: 1 1 ardvark

mai 2013: 1 2 bahasa , 2 1 gedebe

jun 2013: 1 2 guring , 2 1 tutoi

jul 2013: 1 1 makzul

ago 2013: 1 1 bentang

set 2013: 1 2 gajet , 2 2 , 3 1 jelajah

out 2013: 1 1 jelajah

nov 2013: 1 3 cahaya , 2 2 kurrat

dez 2013: 1 2 harem , 2 1 berkemungkinan

jan 2014: 1 1 berkemungkinan

fev 2014: 1 2 abau , 2 2 abar , 3 2 abashed , 4 1 abyad

mar 2014: 1 2 qiamullail , 2 2 qasidah , 3 2 abiogenesis , 4 2 abintara , 5 1 ares

abr 2014: 1 2 azan , 2 2 قضاء , 3 2 berabad-abad , 4 1 玫瑰

mai 2014: 1 2 теория , 2 2 Латвия , 3 2 qari , 4 1 maslahat

jun 2014: 1 1 Ramadan

jul 2014: 1 2 апрель , 2 2 телевидение , 3 1 lê zêde kirin

ago 2014: 1 2 малайзийский , 2 2 gedebe , 3 1 팔월

set 2014: 1 2 referendum , 2 2 Malaysia , 3 2 生日快乐 , 4 2 生日快樂 , 5 2 ذوالقعدة , 6 2 September , 7 1 rodzynek

out 2014: 1 2 , 2 2 Zulhijah , 3 2 ذوالحجة , 4 1 cauldron

nov 2014: 1 2 , 2 1 oktagon

dez 2014: 1 2 mirai , 2 1 yayi

jan 2015: 1 3 idealisme , 2 2 maru , 3 2 , 4 2 nyamuk , 5 2 kecil , 6 2 しょう , 7 2 ローマ字 , 8 2 romaji , 9 2 Tulisan Cina Ringkas , 10 2 未来 , 11 2 tinja , 12 1 sepina

fev 2015: 1 3 , 2 3 아홉 , 3 3 여덟 , 4 3 일곱 , 5 3 여섯 , 6 3 информатика , 7 2 방송 , 8 2 다섯 , 9 2 , 10 2 , 11 2 , 12 2 , 13 2 하나 , 14 2 Lampiran:Variasi \"i\" , 15 2 terma , 16 2 nine , 17 2 नौ , 18 2 नवन् , 19 2 حیوان , 20 2 réinventeront , 21 2 dermatofita , 22 1 𩇓

No data on this page have been normalized to 30 day months (as WMF does on certain traffic reports).
Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Sexta-feira, 27 de março 2015 00:00

Dump file mswiktionary-20150317-pages-meta-history.xml.7z (full dump), size 9.0 Mb as 7z -> 993 Mb
Dump processed till Feb 28, 2015, on server stat1002, ready at Tue-17/03/2015-21:26 after 1 min, 17 sec.

Versão do script:2.6
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.