Estatísticas da Wikcionário sicilian

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist

Metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.
See also metrics definitions


 
Monthly counts & Quarterly rankings: dezembro 2015
 
DataWikcionaristasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
dez 20150%   0%   -9%      0%
nov 20150%   0%   -71%      0%
out 20150%   +2%   -56%      +2%
set 20150%   +6%   +168%      +2%
ago 20150%   0%   +48%      +1%
jul 20150%   0%   -14%      0%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
dez 201520   19 k 6,7 405      3,1 k
nov 201520   19 k 6,7 444      3,1 k
out 201520 2219 k116,6 1,6 k      3,1 k
set 201520 1118 k376,7 3,5 k      3,0 k
ago 201520 1117 k16,9 1,3 k      2,9 k
jul 201520 1 17 k 6,8 888      2,9 k
jun 201520   17 k 6,8 1,0 k      2,9 k
mai 201520   17 k 6,7 147      2,9 k
abr 201520   17 k 6,7 151      2,9 k
mar 201520   17 k 6,750310811 Mb1,1 M168 k56 k1,9 k672,9 k
fev 201520   17 k 6,750311211 Mb1,1 M168 k55 k1,9 k672,9 k
jan 201520   17 k 6,750310011 Mb1,1 M168 k55 k1,9 k672,9 k
dez 201420 1 17 k 6,750310411 Mb1,1 M167 k55 k1,9 k672,9 k
nov 201420 1 17 k16,75038711 Mb1,1 M167 k55 k1,9 k672,9 k
out 201420 1 17 k 6,75033911 Mb1,1 M167 k55 k1,9 k672,9 k
set 201420 1 17 k 6,75024311 Mb1,1 M167 k55 k1,9 k672,9 k
ago 201420 1 17 k16,750211111 Mb1,1 M167 k55 k1,9 k672,9 k
jul 201420 1 17 k 6,75018711 Mb1,1 M167 k54 k1,9 k672,8 k
jun 201420 1 17 k 6,75019311 Mb1,1 M166 k54 k1,9 k672,8 k
mai 201420 1 17 k16,750017011 Mb1,1 M166 k54 k1,9 k672,8 k
abr 20142011 17 k 6,75004611 Mb1,1 M166 k54 k1,9 k672,8 k
mar 201419 1 17 k 6,75004611 Mb1,1 M166 k54 k1,9 k672,8 k
fev 201419   17 k 6,75004211 Mb1,1 M166 k54 k1,9 k672,8 k
jan 201419 1117 k 6,750046711 Mb1,1 M166 k54 k1,9 k672,8 k
dez 201319   17 k 6,74991,2 k11 Mb1,1 M166 k54 k1,9 k672,8 k
nov 201319   17 k 6,6499111 Mb1,1 M166 k52 k1,9 k672,8 k
out 201319   17 k 6,6499811 Mb1,1 M165 k52 k1,9 k642,8 k
set 201319   17 k 6,6499311 Mb1,1 M165 k52 k1,9 k642,8 k
ago 201319   17 k 6,649946211 Mb1,1 M165 k52 k1,9 k642,8 k
jul 201319   17 k 6,649926811 Mb1,1 M165 k52 k1,9 k642,8 k
jun 201319   17 k 6,649915711 Mb1,1 M165 k51 k1,9 k642,8 k
mai 201319 1 17 k 6,649942211 Mb1,1 M165 k51 k1,9 k642,8 k
abr 201319   17 k 6,549918011 Mb1,1 M165 k51 k1,9 k642,8 k
mar 201319   17 k 6,549913611 Mb1,1 M165 k51 k1,9 k642,8 k
fev 201319   17 k 6,549917011 Mb1,1 M165 k50 k1,9 k642,8 k
jan 201319   17 k 6,549933511 Mb1,1 M165 k50 k1,9 k642,8 k
dez 201219   17 k 6,549925611 Mb1,1 M165 k50 k1,9 k642,8 k
nov 201219   17 k 6,549923711 Mb1,1 M165 k50 k1,9 k642,8 k
out 201219 2 17 k 6,549940011 Mb1,1 M165 k49 k1,9 k642,8 k
set 20121912 17 k 6,449947611 Mb1,1 M165 k49 k1,9 k642,8 k
ago 201218   17 k 6,449933411 Mb1,1 M165 k49 k1,9 k632,8 k
jul 201218 1 17 k 6,449925511 Mb1,1 M165 k48 k1,9 k632,8 k
jun 201218 1117 k86,44991,1 k11 Mb1,1 M165 k48 k1,9 k632,8 k
mai 201218 1 17 k 6,450026811 Mb1,0 M163 k47 k1,9 k632,7 k
abr 201218   17 k 6,450032111 Mb1,0 M163 k46 k1,9 k632,7 k
mar 201218   17 k 6,450027111 Mb1,0 M163 k46 k1,9 k632,7 k
fev 201218 1117 k16,45001,2 k11 Mb1,0 M163 k46 k1,9 k632,7 k
jan 201218   17 k 6,349639111 Mb1,0 M163 k45 k1,9 k632,7 k
dez 201118   17 k 6,349676611 Mb1,0 M163 k45 k1,9 k632,7 k
nov 201118   17 k 6,249641011 Mb1,0 M163 k44 k1,9 k632,7 k
out 201118 1 17 k 6,24961,2 k11 Mb1,0 M163 k44 k1,9 k632,7 k
set 201118 1117 k16,149630011 Mb1,0 M162 k42 k1,9 k632,7 k
ago 201118 1 17 k 6,149719711 Mb1,0 M162 k42 k1,9 k632,7 k
jul 201118   17 k 6,149620511 Mb1,0 M162 k42 k1,9 k632,7 k
jun 20111811 17 k 6,149618111 Mb1,0 M162 k41 k1,9 k632,7 k
mai 201117   17 k 6,149629411 Mb1,0 M162 k41 k1,9 k632,7 k
abr 201117   17 k 6,149652211 Mb1,0 M162 k41 k1,9 k632,7 k
mar 201117   17 k 649628011 Mb1,0 M162 k40 k1,9 k632,7 k
fev 20111712 17 k 649628611 Mb1,0 M162 k40 k1,9 k632,7 k
jan 201116   17 k 649529411 Mb1,0 M162 k40 k1,9 k632,7 k
dez 201016 2117 k1649571811 Mb1,0 M162 k40 k1,9 k552,7 k
nov 201016 1117 k 649516711 Mb1,0 M162 k39 k1,9 k552,7 k
out 201016 2217 k 5,949562511 Mb1,0 M162 k39 k1,9 k552,7 k
set 201016 3217 k 5,949280811 Mb1,0 M161 k38 k1,9 k552,7 k
ago 20101613117 k15,949050511 Mb1,0 M162 k38 k1,9 k552,7 k
jul 201015 2217 k 5,949080711 Mb1,0 M161 k38 k1,9 k552,7 k
jun 201015 2217 k25,84874,8 k10 Mb1,0 M161 k37 k1,9 k552,7 k
mai 201015 3217 k15,54822,2 k10 Mb994 k159 k37 k1,9 k552,7 k
abr 20101513217 k225,44983,1 k10 Mb1,0 M163 k36 k1,9 k552,7 k
mar 201014 3216 k755,450412 k10 Mb993 k159 k32 k1,9 k552,7 k
fev 201014 4214 k65,548710 k8,2 Mb820 k128 k26 k1,7 k552,3 k
jan 201014 2213 k234,84702,0 k7,7 Mb765 k121 k23 k1,7 k552,0 k
dez 200914 1113 k 4,94681517,3 Mb722 k113 k23 k1,7 k552,0 k
nov 200914 2213 k 4,94687727,3 Mb722 k113 k22 k1,7 k552,0 k
out 200914 3213 k 4,94688577,3 Mb720 k113 k22 k1,7 k552,0 k
set 20091413213 k 4,84676007,2 Mb719 k113 k22 k1,7 k552,0 k
ago 200913 2213 k 4,84671,3 k7,2 Mb718 k113 k22 k1,7 k552,0 k
jul 200913 2213 k14,74668607,2 Mb715 k112 k22 k1,7 k552,0 k
jun 200913 3213 k14,64652,3 k7,2 Mb711 k112 k21 k1,7 k552,0 k
mai 200913 2213 k14,44581,5 k7,1 Mb697 k110 k21 k1,7 k552,0 k
abr 200913 2213 k54,34583,7 k7,0 Mb696 k109 k21 k1,7 k552,0 k
mar 200913 2212 k14,14459906,8 Mb672 k102 k20 k1,7 k562,0 k
fev 20091311112 k 44333346,6 Mb652 k99 k19 k1,7 k562,0 k
jan 200912 1 12 k 44331036,6 Mb652 k99 k19 k1,7 k562,0 k
dez 200812 1112 k 44332186,6 Mb652 k99 k19 k1,7 k562,0 k
nov 200812 1 12 k 3,94311176,6 Mb648 k98 k18 k1,7 k562,0 k
out 200812 2 12 k13,94311176,6 Mb647 k98 k18 k1,7 k562,0 k
set 200812 1112 k123,94301,9 k6,5 Mb645 k97 k18 k1,7 k562,0 k
ago 200812 2112 k223,94283,3 k6,3 Mb625 k94 k18 k1,7 k561,9 k
jul 200812 1111 k313,84253,2 k5,9 Mb587 k87 k17 k1,7 k561,6 k
jun 200812 1 10 k 3,94131515,3 Mb524 k76 k14 k1,7 k561,4 k
mai 20081212110 k133,94131,0 k5,3 Mb524 k76 k14 k1,7 k561,4 k
abr 200811 1110,0 k123,94051,5 k5,0 Mb494 k72 k13 k1,7 k561,4 k
mar 2008111319,6 k293,93852,8 k4,6 Mb447 k69 k12 k1,5 k561,3 k
fev 200810 218,8 k443489583,8 Mb367 k58 k9,2 k821561,2 k
jan 200810 118,6 k93,93261,7 k3,5 Mb340 k53 k8,4 k796581,2 k
dez 2007101218,4 k 3,92761762,9 Mb278 k43 k7,7 k734581,1 k
nov 200791418,3 k263,82724,2 k2,9 Mb273 k43 k7,5 k723581,1 k
out 20078 227,6 k403,720311 k2,0 Mb180 k31 k6,9 k458785
set 20078 116,3 k42,71062,4 k927 kb65 k9,9 k6,8 k 6369
ago 20078 116,2 k 2,3103372847 kb61 k8,8 k6,7 k158160
jul 20078 116,2 k 2,3103832835 kb60 k8,6 k6,7 k158142
jun 20078 116,2 k12,1103266816 kb60 k8,4 k6,7 k158108
mai 20078 1 6,2 k 2,1103126811 kb60 k8,4 k6,7 k15867
abr 2007811 6,2 k 2,110391809 kb60 k8,4 k6,6 k15867
mar 20077 1 6,2 k 2,110355808 kb60 k8,4 k6,5 k15867
fev 20077   6,2 k 2,1103122806 kb60 k8,4 k6,4 k15867
jan 20077 1 6,2 k 2103194805 kb60 k8,4 k6,3 k15867
dez 20067   6,2 k 210290798 kb59 k8,2 k6,2 k15867
nov 20067   6,2 k 2102103796 kb59 k8,2 k6,1 k15867
out 20067   6,2 k 2102143795 kb59 k8,2 k6,0 k15867
set 20067   6,2 k 210281794 kb59 k8,2 k5,8 k25867
ago 2006711 6,2 k 1,9102118793 kb59 k8,2 k5,8 k25867
jul 20066   6,2 k 1,9102132790 kb59 k8,2 k5,7 k15865
jun 20066   6,2 k 1,9102204788 kb59 k8,2 k5,5 k15865
mai 20066   6,1 k 1,910292785 kb59 k8,2 k5,3 k15865
abr 20066   6,1 k 1,910262783 kb59 k8,2 k5,2 k15865
mar 20066   6,1 k 1,9102267783 kb59 k8,2 k5,2 k15865
fev 2006611 6,1 k11,8102167780 kb59 k8,2 k5,0 k15865
jan 20065   6,1 k 1,8102104776 kb59 k8,2 k4,8 k15865
dez 20055 1 6,1 k 1,810216774 kb59 k8,2 k4,7 k15465
nov 20055   6,1 k 1,8102165773 kb59 k8,1 k4,7 k15465
out 20055   6,1 k 1,710250772 kb59 k8,1 k4,7 k15465
set 20055   6,1 k 1,710246771 kb59 k8,1 k4,6 k15465
ago 20055   6,1 k 1,71021,6 k771 kb59 k8,1 k4,6 k15465
jul 20055   6,1 k 1,5102511745 kb59 k8,1 k2,9 k15465
jun 20055   6,1 k 1,41021735 kb58 k8,1 k2,3 k15465
mai 20055 1 6,1 k 1,410210735 kb58 k8,1 k2,3 k15465
abr 20055   6,1 k 1,41022734 kb58 k8,1 k2,3 k15465
mar 20055 2 6,1 k 1,41022,1 k734 kb58 k8,1 k2,3 k15465
fev 20055 2 6,1 k6711012,0 k693 kb58 k8,0 k21515465
jan 200554414,2 k13611104,4 k518 kb43 k5,6 k11515340
dez 20041   3 3112287,6 kb54618106 60 
nov 20041   1 1445 1,8 kb77 106 9 
out 200411  1 144511,8 kb77 106 9 
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
The following table ranks this project in relation to projects in other languages with 1000+ articles
out 201576 5233693242 53      136
jul 201573 64 71 38 74      136
abr 201573   71 36 92      136
jan 2015733274437058331690645434801869136
out 2014734061466661331593615433791868136
jul 2014733360486558321692595133781868136
abr 2014722960476357311787595133771866136
jan 2014734162396058331673575032771866136
out 20137342784660623316112575031771867136
jul 2013724079515863351575554930761865136
abr 2013693780515864371578554830751862136
jan 2013684582545667361583544630751761136
out 2012673649495363371576524430731760136
jul 2012674868535269381580504329711662136
abr 2012673978525265361575504327681662136
jan 2012673579505264341572494127671660136
out 2011653967485167341556473927651559136
jul 2011634381484969361571463827651560136
abr 2011643381454660371666443726641357136
jan 2011633579504361381768413425631155136
out 2010623563424260401660413223621058136
jul 2010654665423966381863383021601156136
abr 2010633652373924401533373019571155136
jan 2010633260354419461737423424591155136
out 2009604053434555451654413523591254136
jul 2009604061384254431652403522571153136
abr 2009585059364041481632403322571151136
jan 200958596642385945166838332257947136
out 200855364843375643146136312255944135
jul 200853325537361644162537302255841135
abr 200854426341363039143537322356741135
jan 2008544361463630402035383124551040135
out 2007574050243314373010443825547435135
jul 2007564360393459545433565341519036134
abr 2007543759473161535077514936498437134
jan 2007534759442966504365504735457837134
out 2006513966432853453959464233436730134
jul 2006524067382653433856393931405827134
abr 2006483753352248403453373526314727134
jan 2006484559341741322845343122234027126
out 2005423350261536272648272320213623114
jul 2005363043251235262424242118212917109
abr 20053024402173118175818181514231697
jan 20052451318811514317171230171885
out 200454212916622111114857595921113273
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100ediçõesbytes
 WikcionaristasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikcionaristas (usuários registrados)
A = Wikcionaristas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikcionaristas que editaram pelo menos dez vezes desde que chegaram
C = Wikcionaristas que contribuíram cinco vezes ou mais este mês
D = Wikcionaristas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  2500  10000  5  10  100  1000  1  3  5  10  25  100  250  1000  2500  5  10  1  3  5  10  25  100  250  1000  5  10  100 
dez 20152       221 3          111     11 
nov 20152       221 51         311111  111
out 20153222221   321 31         422211  21 
set 2015111111111 331 1321111111  42111   11 
ago 20151111111   222 31         311111  11 
jul 2015311      221 2          1       11 
jun 20151       2211           11111   111
mai 2015        33                     11 
abr 20151       331          223211    21 
mar 20152       32  2        111       11 
fev 20153       22  32         92      11 
jan 201541      22  31         211     111
dez 2014111      22                     111
nov 201422111        52         42111   11 
out 20144111         1          3          
set 201421111        4          511     11 
ago 201431111    11             5211    11 
jul 20142111     11  31         2111       
jun 201421111    11  1          2          
mai 201431111    11  2          32111      
abr 20143211     11  2          9          
mar 2014411      11  4          2          
fev 201411      11  3          5          
jan 20141111111   221 1          6221       
out 20153222221   321 31         422211  21 
jul 2015311      221 2          1       11 
abr 20151       331          223211    21 
jan 201541      22  31         211     111
out 20144111         1          3          
jul 20142111     11  31         2111       
abr 20143211     11  2          9          
jan 20141111111   221 1          6221       
out 201311          5          41         
jul 2013        111 1          51         
abr 20132       211 1          1          
jan 2013        431            2       11 
out 2012222      321            621     11 
jul 2012411      421 2          6111    1  
abr 2012        54  11         422        
jan 20123       331 1          2       21 
out 20113211     332            6       11 
jul 20111       221 1          21         
abr 20112       332            211        
jan 201121      221 1          5          
out 20103222222       1          72221      
jul 20107322222       1          11111      
abr 201075322221      2111111    4321111 11 
jan 201022222211      4          3222       
out 20093332221       2          4          
jul 20093222222       1          411     11 
abr 2009332222211     311        522111     
jan 2009221      32  1          411     111
out 200822221    21  3          643        
jul 200841111111  221121         62         
abr 200811111111  22  311        611111  1  
jan 200821111111  221 411111     5111       
out 2007322222111111  332211     32221111   
jul 20071111111   11             111111     
abr 2007111      11  1          111        
jan 200752111    111            2          
out 20061       111            2          
jul 2006        111            2          
abr 2006        11             211        
jan 20061       111            2          
out 2005        11                        
jul 20052       111            1          
abr 20051                      11         
jan 2005444421    2222433        432221     
out 20041                                 

 

Distribuição de edições de artigos por wikcionaristas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikcionaristasEdições total
1125100.0%91,253100.0%
33931.2%91,13299.9%
101915.2%91,01299.7%
32118.8%90,87099.6%
10064.8%90,55999.2%
31643.2%90,19498.8%
100021.6%89,07497.6%
316221.6%89,07497.6%
1000010.8%79,65587.3%
3162310.8%79,65587.3%

 

2 wikcionaristas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions
agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
SarvaturiUC1 079,65529,370-mai 09, 2006352212,166-4,825-
EudigioiaUC44+1731--dez 28, 20121097----

 

20 wikcionaristas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
InterwicketUC29,419jan 29, 20092526nov 08, 20101878
PeppepzUC3774abr 29, 2014610out 17, 201574
Pippu d'AngeloUC4346jan 13, 20054003mai 14, 20082786
SabineCretellaUC5234jan 11, 20054005set 13, 20101934
CommonsDelinkerUC6131jan 16, 20082905nov 29, 201531
StrabbismuUC791fev 09, 20063611jan 25, 20073261
Hégésippe CormierUC870dez 22, 20053660nov 28, 20092223
Accarjemicu ra canigghiaUC958fev 03, 20102156jan 27, 2015337
RederUC1058ago 31, 20101947set 01, 20101946
Scorpios90UC1134fev 04, 20111790set 26, 20121190
Klone123UC1227set 04, 20092308out 22, 20092260
EsbarduUC1321nov 08, 20072974jun 03, 20121305
MelosUC1421fev 03, 20082887mar 21, 20082840
SergioUpload-scUC1520jan 25, 20053991jan 25, 20053991
GerardMUC1618jan 11, 20054005jul 09, 20053826
CraudiuUC1714ago 05, 20063434ago 05, 20063434
.sEdivadUC1811abr 03, 20111732mar 03, 2014667
ZuCarruUC1910jun 02, 20111672jun 02, 20111672
EsseTiUC209mai 13, 20073153mai 13, 20073153
Wim bUC219mar 09, 20082852mar 09, 20082852

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 753 edições foram feitas por usuários anônimos, de um total de 125306 edições ( 0e %)
  


14 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
HydrizBotUC18,880mar 18, 20111748dez 31, 2015---
RobotGMwiktUC28,421jan 26, 20053990jun 06, 200827631,691-
Luckas-botUC34,762mar 06, 20092490jan 27, 2014702--
RobotSCwikt~scnwiktionaryUC44,273jan 26, 20053990fev 02, 200539834,222-
SpaceBirdyBotUC52,184mar 30, 20082831jan 02, 20102188--
KamikazeBotUC61,972out 18, 20111534mar 06, 20131029--
VolkovBotUC71,035ago 20, 20073054mar 21, 20131014--
YS-BotUC8999set 13, 20121203out 18, 201573--
AvocatoBotUC9342nov 01, 20111520ago 08, 2013874--
JAnDbotUC10277jun 10, 20121298dez 30, 2015---
SzajciBotUC1155set 09, 20082668jan 12, 20092543--
CarsracBotUC1235nov 17, 20121138mai 30, 2013944--
MonoBotUC1324jan 18, 20082903jun 14, 20082755--
Makecat-botUC1420nov 10, 20121145abr 05, 2013999--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110JpgPng
dez 201522 k42946244698383623       1410
nov 201522 k42646244698383623       1410
out 201522 k42646244698383517       1410
set 201521 k42546244698033459       1410
ago 201520 k42445244698013441       1410
jul 201520 k42443244697963438       1410
jun 201520 k42343244697963438       1410
mai 201520 k42343244697963411       1410
abr 201520 k42343244697963411       1410
mar 201520 k42236244697963407      21410
fev 201520 k42236244697963407      41410
jan 201520 k41536244697963407      71410
dez 201420 k41336244697963407      81410
nov 201420 k41336244697963407      861410
out 201420 k40936244697763406      341410
set 201420 k40836244697733406      341410
ago 201420 k40436244697703406      741410
jul 201420 k40036244697693405      311410
jun 201420 k39936244697693405      621410
mai 201420 k39936244697693405      1341410
abr 201420 k39736244697673405      191410
mar 201420 k39436244697673405      111410
fev 201420 k39236244697673405      31410
jan 201420 k38736244697673405      3301410
dez 201320 k38136244697673400      41410
nov 201320 k38136244697673400      11410
out 201320 k37536244697673400      41410
set 201320 k37136244697673400      11410
ago 201320 k35936244697673400      11410
jul 201320 k35635244697673400       1410
jun 201320 k35435244697673400      41410
mai 201320 k35235244697673400      71410
abr 201320 k35035234697673400      21310
mar 201320 k34735234697673400      11310
fev 201320 k34335234697673400      21310
jan 201320 k33835234697673400       1310
dez 201220 k33635234697673400      41310
nov 201220 k32935234697673400      51310
out 201220 k32935234697673400      141310
set 201220 k32535234697673397      311310
ago 201220 k32035234697673397      41310
jul 201220 k31635234697673397      131310
jun 201220 k31235234697673397      7361310
mai 201220 k30335234697653378      121310
abr 201220 k29835234697643377       1310
mar 201220 k29235234697643377      21310
fev 201220 k29135234697643377      9391310
jan 201220 k28335234697603373      41310
dez 201120 k28035234697603373      11310
nov 201120 k27535234697603373      31310
out 201120 k26435234697593373      271310
set 201120 k25835234697593373      1711310
ago 201120 k25535234697593369      891310
jul 201119 k24935234697593369      11310
jun 201119 k24135234697593369      111310
mai 201119 k23835234697593369       1310
abr 201119 k23235234697593369      21310
mar 201119 k22735234697593369      21310
fev 201119 k22635234697593369      991310
jan 201119 k22035234697593369      61310
dez 201019 k21535234697593369      1451310
nov 201019 k21335234697593369      1581310
out 201019 k21035234687593369      6231310
set 201019 k20735234687593369      8031310
ago 201019 k20235234687593368      4931310
jul 201019 k18635234687583361      8051310
jun 201019 k18635234687583361      48301310
mai 201019 k17335234687563361      21951310
abr 201019 k17235234687533334      30601310
mar 201019 k16835224687413274      115361210
fev 201016 k15535154687073201      10263105
jan 201015 k15035154686973192      2021105
dez 200915 k13635154686973183      144105
nov 200915 k13435154686973183      771105
out 200915 k13235154686973183      849105
set 200915 k12935154686973183      600105
ago 200915 k12535144686973183      1324104
jul 200915 k12435144686973183      858104
jun 200915 k12235144686953183      2304104
mai 200915 k12035144676943182      1482104
abr 200915 k12035144676933181      3717104
mar 200914 k11235144676923175      949104
fev 200914 k10935144676912173      267104
jan 200914 k10435144676912173      11104
dez 200814 k10335144676912173      110104
nov 200814 k10235144676912173      10104
out 200814 k8834144676912173      86104
set 200814 k7934144676901173      1838104
ago 200814 k7634144676861172      3246104
jul 200813 k7334144676861163      1449104
jun 200812 k7034144666861163      18104
mai 200812 k6732144666861163      780104
abr 200811 k6132144666841159      1384104
mar 200811 k5831124666691106      269693
fev 20089,9 k563011462663186      82183
jan 20089,8 k52299460658184      159872
dez 20079,4 k48299460655179      14172
nov 20079,4 k46299460655179      412172
out 20078,4 k45295460654174      1077332
set 20076,7 k33222455119 49      23452 
ago 20076,4 k29222455101 38      3672 
jul 20076,4 k28222455100 37      8042 
jun 20076,3 k2622228898 35      2522 
mai 20076,3 k242227288 4      92 
abr 20076,3 k232227288 4      92 
mar 20076,3 k232227287 4      52 
fev 20076,2 k231927287 4       2 
jan 20076,2 k221927287 3      742 
dez 20066,2 k221927287 3      12 
nov 20066,2 k221927287 3       2 
out 20066,2 k211927287 3      22 
set 20066,2 k191927287 3       2 
ago 20066,2 k191927287 3      152 
jul 20066,2 k181927287 3       2 
jun 20066,2 k171927287 3      12 
mai 20066,2 k161927287 3      32 
abr 20066,2 k151727287 3       2 
mar 20066,2 k141727287 3       2 
fev 20066,2 k141727287 3      262 
jan 20066,2 k141727287 3      22 
dez 20056,2 k121727287 3      52 
nov 20056,2 k71727271 3       2 
out 20056,2 k71727271 3       2 
set 20056,2 k71727271 3      12 
ago 20056,2 k71727271 3      12 
jul 20056,2 k71727271 3      32 
jun 20056,2 k71727271 3      12 
mai 20056,2 k71727271 3      62 
abr 20056,2 k71727271 3      12 
mar 20056,2 k61727271 3      212 
fev 20056,2 k61727269 3      1292 
jan 20054,3 k61727269 3      1852 
dez 20043   72            
nov 20041                
out 20041                

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

out 2004: 1 1 Pàggina principali

dez 2004: 1 1 Pàggina principali

jan 2005: 1 3 etimoluggìa , 2 3 Pàggina principali , 3 2 filoluggìa , 4 2 abbanniari , 5 2 abbentu , 6 2 abbaffari , 7 2 Utente:SabineCretella/lista/D , 8 2 giappunisi , 9 1 етимология

fev 2005: 1 2 abbummatu , 2 2 abbullari , 3 2 accattari , 4 2 accabbari , 5 1 Synonym

mar 2005: 1 2 acciuncari , 2 2 acchianari , 3 1 Saturnu

abr 2005: 1 1 accucchiari

mai 2005: 1 1 ajutu

jun 2005: 1 1 lìttira

jul 2005: 1 1 maritàrisi

ago 2005: 1 1 pillari

set 2005: 1 1 mafia

dez 2005: 1 1 canciamentu

jan 2006: 1 1 pirsuna

fev 2006: 1 2 ottugrafìa , 2 1 cicala

mai 2006: 1 1 Wikizziunariu

jun 2006: 1 1 ciuciu

ago 2006: 1 1 buttana

out 2006: 1 1 strèusu

dez 2006: 1 1 nilvia

jan 2007: 1 1 fari li pistigni

mar 2007: 1 1 ncazzàrisi

abr 2007: 1 1 cafè

mai 2007: 1 1 taliata

jun 2007: 1 1 abbirintu

jul 2007: 1 1 buhhiularu

ago 2007: 1 1 cascjarizzu

set 2007: 1 1 UTC

out 2007: 1 2 ddi , 2 2 chidda , 3 2 chiddi , 4 2 chiddu , 5 2 chista , 6 2 chissi , 7 2 chissa , 8 2 luordu , 9 2 agrestu , 10 2 fallaci , 11 2 magru , 12 2 medianu , 13 2 midianu , 14 2 mansu , 15 2 mancarusu , 16 2 malacriatu , 17 2 malcriatu , 18 2 largu , 19 2 làricu , 20 2 lurdu , 21 2 linnu , 22 2 gàutu , 23 2 irbusu , 24 2 jàuru , 25 2 àjiru

nov 2007: 1 2 pàggina , 2 2 tiatru , 3 2 austu , 4 2 agneddu , 5 2 accusari , 6 2 allegru , 7 2 purtughisi , 8 2 dizziunariu , 9 2 coniugali , 10 2 sustantivu , 11 2 lazzu , 12 2 gaddutu , 13 2 furricu , 14 2 furdìcula , 15 2 fràggili , 16 2 firricu , 17 2 firranti , 18 2 filàutu , 19 2 oceddu , 20 2 babbu , 21 2 auceddu , 22 2 ddazzu , 23 2 armalu , 24 2 ardìcula , 25 2 aneddu

dez 2007: 1 2 arà , 2 1 conxunción

jan 2008: 1 1 ipericu

fev 2008: 1 2 catananna , 2 1 pena

mar 2008: 1 2 vinu , 2 2 armali , 3 2 banniari , 4 2 vanniari , 5 2 cristianu , 6 2 abbummatu , 7 2 abbullari , 8 2 abbadari , 9 2 pitanza , 10 2 bannizzari , 11 2 abbanniari , 12 2 abbiari , 13 2 abbentu , 14 2 acchianari , 15 1 signa

abr 2008: 1 1 filtru

mai 2008: 1 2 fazzulettu , 2 2 muccaturi , 3 1 Durlindana

jun 2008: 1 1 cità

jul 2008: 1 2 pìritu , 2 1 aceddu dû malutempu

ago 2008: 1 2 motherboard , 2 1 ozari

set 2008: 1 1 zifulà

out 2008: 1 1 capillutu

nov 2008: 1 1 ghiurnali

dez 2008: 1 1 gaddorfu

jan 2009: 1 1 mali

fev 2009: 1 2 esperantu , 2 1 fini

mar 2009: 1 2 rouge , 2 2 lutu , 3 2 liara , 4 2 drittu , 5 2 luta , 6 2 lissa , 7 2 lippu , 8 2 disa , 9 2 mù ccà , 10 1 brìndisi

abr 2009: 1 3 acqua , 2 2 vindita , 3 2 altru , 4 2 oy , 5 2 pir , 6 2 territoriu , 7 2 sou , 8 2 , 9 2 et , 10 2 principali , 11 2 càmmara , 12 2 tirruri , 13 2 sternu , 14 2 esternu , 15 2 nnipinnenza , 16 2 mustu , 17 2 arruri , 18 2 erruri , 19 2 cosmoluggìa , 20 2 chìmica , 21 2 furchetta , 22 2 dannu , 23 2 lardu , 24 2 lanza , 25 2 chianu

mai 2009: 1 2 transitivu , 2 2 fiata , 3 2 daga , 4 2 calessi , 5 2 guadagnari , 6 2 corra , 7 2 risposta , 8 2 riga , 9 2 pupa , 10 2 lugghiu , 11 2 carta , 12 2 birra , 13 2 anatomia , 14 2 cravatta , 15 2 giugnu , 16 2 furmaggiu , 17 2 stanza , 18 2 , 19 2 trumma , 20 2 alcol , 21 2 tunisinu , 22 2 ucràinu , 23 2 turcu , 24 2 sluvaccu , 25 2 macèduni

jun 2009: 1 2 demm , 2 2 ġemel , 3 2 sekonda , 4 2 singulari , 5 2 plurali , 6 2 aparu , 7 2 altru , 8 2 bedda , 9 2 stima , 10 2 passa , 11 2 lavari , 12 2 nascita , 13 2 barca , 14 2 um , 15 2 grazia , 16 2 volta , 17 2 visu , 18 2 terminale , 19 2 soma , 20 2 saliva , 21 2 roba , 22 2 questione , 23 2 patata , 24 2 papa , 25 2 pane

jul 2009: 1 2 termini relatati , 2 2 ras , 3 2 qalb , 4 2 pronunzji , 5 2 popolazzjoni , 6 2 nazzjon , 7 2 navigazzjoni , 8 2 lessiku , 9 2 kwotazzjonijiet , 10 2 kwotazzjoni , 11 2 koordinazzjoni , 12 2 konġunzjoni , 13 2 kollezzjoni , 14 1 francupruvinzali

ago 2009: 1 2 ogni , 2 2 malu , 3 2 normali , 4 2 riccu , 5 2 fàcili , 6 2 scienza , 7 2 scemu , 8 2 agghiu , 9 2 malacunnutta , 10 2 lintu , 11 2 làdiu , 12 2 prena , 13 2 facceri , 14 2 azzanìa , 15 2 accia , 16 1 grara

set 2009: 1 3 taccia , 2 3 amenta , 3 2 ancuni , 4 2 verru , 5 2 ntonzi , 6 2 basilicò , 7 2 basi , 8 2 vardari , 9 2 uardari , 10 2 guardari , 11 2 esami , 12 2 babbaluci

out 2009: 1 2 sfardari , 2 2 battaglia , 3 2 brocca , 4 2 boi , 5 2 cafè , 6 2 galega , 7 2 bureddu , 8 1 meriu

nov 2009: 1 2 celu , 2 2 ciumi , 3 2 cheyenne , 4 2 cherokee , 5 2 pedi , 6 1 spicchiu

dez 2009: 1 2 scaminari , 2 2 terra

jan 2010: 1 2 daga , 2 2 gula , 3 2 ladin , 4 2 lepru , 5 2 hindi , 6 2 luna , 7 2 deu , 8 1 armôna

fev 2010: 1 3 laberint , 2 2 alè , 3 2 palàura , 4 2 trita , 5 2 triti , 6 2 littori , 7 2 orra , 8 2 làntana , 9 2 angustia , 10 2 fraca , 11 2 navigazioni , 12 2 gufi , 13 2 scaliari , 14 2 nachitizzonna , 15 2 polirrimàtica , 16 2 accarièmicu , 17 2 agace , 18 2 scandiu , 19 2 tabbutu , 20 2 ànima , 21 2 ova , 22 2 sala , 23 2 ponti , 24 2 parola , 25 2 rìu

mar 2010: 1 3 глагол , 2 3 местоимение , 3 3 земля , 4 3 овёс , 5 3 kış , 6 2 azzurro , 7 2 privado , 8 2 privato , 9 2 privé , 10 2 private , 11 2 huitanta , 12 2 bana , 13 2 ilkbahar , 14 2 vircocu , 15 2 bèc , 16 2 argent , 17 2 aglon , 18 2 grafia , 19 2 abada , 20 2 abado , 21 2 pansa , 22 2 orto- , 23 2 iso- , 24 2 -ismu , 25 2 psico-

abr 2010: 1 3 tuvagghiuni , 2 3 moi , 3 2 action , 4 2 ila , 5 2 stecca , 6 2 binu , 7 2 beca , 8 2 ira , 9 2 ruma , 10 2 sonni , 11 2 blocchi , 12 2 frendi , 13 2 bega , 14 2 emma , 15 2 panti , 16 2 lova , 17 2 legga , 18 2 ghenga , 19 2 fessa , 20 2 buccia , 21 2 falò , 22 2 faia , 23 2 dora , 24 2 contri , 25 2 checca

mai 2010: 1 2 scujàttulu , 2 2 asarciziu , 3 2 cureanu , 4 2 águila , 5 2 fuerte , 6 2 cráneo , 7 2 bastante , 8 2 abuso , 9 2 adultu , 10 2 osso , 11 2 abelha , 12 2 abraço , 13 2 abuse , 14 2 USA , 15 2 abus , 16 2 action , 17 2 bore , 18 2 biology , 19 2 basque , 20 2 bailar , 21 2 asturiano , 22 2 aragonês , 23 2 arabe , 24 2 agosto , 25 2 vieillir

jun 2010: 1 3 cornu , 2 3 anciova , 3 2 cedda , 4 2 nsira , 5 2 August , 6 2 août , 7 2 olla , 8 2 cara , 9 2 èvèque , 10 2 libèrtât , 11 2 fagu , 12 2 crema , 13 2 casteddu , 14 2 caminu , 15 2 furesta , 16 2 blusa , 17 2 riparu , 18 2 gazza , 19 2 piriscia , 20 2 uttena , 21 2 manghjà , 22 2 insità , 23 2 incatarrì , 24 2 ira , 25 2 argent

jul 2010: 1 2 arcu , 2 2 ndivinari , 3 1 August

ago 2010: 1 2 accio , 2 2 acchiare , 3 2 accattare , 4 1 comparisce

set 2010: 1 2 dubitari , 2 2 arricampàrisi , 3 2 cuenzo , 4 2 cuculone , 5 2 cucuacia , 6 2 controra , 7 2 comparisce , 8 2 chiummo , 9 2 cazzare

out 2010: 1 2 jiri , 2 2 firmari , 3 1 appanzicàrisi

nov 2010: 1 1 cara

dez 2010: 1 2 sdurrubbari , 2 2 scunchiurutu , 3 1 scunchjurutu

jan 2011: 1 1 tabutu

fev 2011: 1 1 to ma

mar 2011: 1 1 papa

abr 2011: 1 1 a vanedda

jun 2011: 1 1 sbarrachiari

jul 2011: 1 1 palummu

ago 2011: 1 1 limaccia

set 2011: 1 1 sgangatello

out 2011: 1 1 violo

nov 2011: 1 1 visu

dez 2011: 1 1 éga

jan 2012: 1 1 musca

fev 2012: 1 1 razzina

mar 2012: 1 1 palummu

mai 2012: 1 1 camarata

jun 2012: 1 2 ترش , 2 2 گل , 3 1 irbicedda

jul 2012: 1 2 teccà , 2 1 tè ccà

ago 2012: 1 1 muffula

set 2012: 1 3 trazzera , 2 2 beni , 3 1 scògghiri

out 2012: 1 1 ebràicu

nov 2012: 1 1 prezzu

dez 2012: 1 1 cuttigghiu

fev 2013: 1 1 e

mar 2013: 1 1 tigri

abr 2013: 1 1 pìcciuli

mai 2013: 1 1 minutulu

jun 2013: 1 1 pasranu

ago 2013: 1 1 Taruni

set 2013: 1 1 sturneddu

out 2013: 1 1 fromâjo

nov 2013: 1 1 conoscente

dez 2013: 1 1 ddagghjusu

jan 2014: 1 1 cunsigghiari

fev 2014: 1 1 brocca

mar 2014: 1 1 trunzu

abr 2014: 1 1 dajuni

mai 2014: 1 1 nzittari

jun 2014: 1 1 Appinnici:Cugnugazzioni/Sicilianu/giuvàri

jul 2014: 1 1 taddariti

ago 2014: 1 1 curanedda mpiriali

set 2014: 1 1 Appinnici:Conjugazzioni/Sicilianu/nzittari

out 2014: 1 1 piccirìddu

nov 2014: 1 1 virrica

dez 2014: 1 1 giometrìa

jan 2015: 1 1 bistinu

fev 2015: 1 1 rizzu

mar 2015: 1 1 cità

abr 2015: 1 1 Wikizziunariu

jun 2015: 1 1 putru

jul 2015: 1 1 รู้จักมักคุ้น

ago 2015: 1 1 cirìmuli

set 2015: 1 1 kiosque

out 2015: 1 1 tatiyart

nov 2015: 1 1 furmaggiu

dez 2015: 1 1 jujusu

Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Quinta-feira, 21 de janeiro 2016 20:38

Dump file scnwiktionary-20160111-stub-meta-history.xml.gz (edits only), size 7.8 Mb as gz -> 61 Mb
Dump processed till Dec 31, 2015, on server stat1002, ready at Tue-12/01/2016-11:30 after 1 min, 22 sec.

Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.