Estatísticas da Wikcionário sicilian

Zoom           
 
January 2014: Unfortunately monthly database dump generation is delayed for many wikis. Reports will appear later than usual. Our sincere apologies for any inconvenience caused.
Upd. March 2: Dump generation was restarted on February 12. All dumps are up to date now for December, some not for January, some days to go. This is an intermediate update.

Metrics have been collected from a full archive dump, which contains all revisions of every article, meta data and raw content.
See also metrics definitions


 
Monthly counts & Quarterly rankings: janeiro 2015
 
DataWikcionaristasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
jan 20150%   0%   -3%0%0%0%0%0%0%0%
dez 20140%   0%   +11%0%0%0%0%0%0%0%
nov 20140%   0%   +114%0%0%0%0%0%0%0%
out 20140%   0%   -4%0%0%0%0%0%0%+1%
set 20140%   0%   -64%0%0%0%0%0%0%0%
ago 20140%   0%   +28%0%0%0%0%+1%0%+1%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
jan 201520   17 k 6,650310111 Mb1,1 M168 k55 k1,9 k672,7 k
dez 201420 1 17 k 6,650310411 Mb1,1 M167 k55 k1,9 k672,7 k
nov 201420 1 17 k16,65039411 Mb1,1 M167 k55 k1,9 k672,7 k
out 201420 1 17 k 6,65034411 Mb1,1 M167 k55 k1,9 k672,7 k
set 201420 1 17 k 6,65024611 Mb1,1 M167 k55 k1,9 k672,6 k
ago 201420 1 17 k16,650212711 Mb1,1 M167 k55 k1,9 k672,6 k
jul 201420 1 17 k 6,65019911 Mb1,1 M167 k54 k1,9 k672,6 k
jun 201420 1 17 k 6,65019811 Mb1,1 M166 k54 k1,9 k672,6 k
mai 201420 1 17 k16,650017511 Mb1,1 M166 k54 k1,9 k672,6 k
abr 20142011 17 k 6,65004611 Mb1,1 M166 k54 k1,9 k672,5 k
mar 201419 1 17 k 6,65004611 Mb1,1 M166 k54 k1,9 k672,5 k
fev 201419   17 k 6,65004211 Mb1,1 M166 k54 k1,9 k672,5 k
jan 201419 1117 k 6,650046711 Mb1,1 M166 k54 k1,9 k672,5 k
dez 201319   17 k 6,64991,2 k11 Mb1,1 M166 k54 k1,9 k672,5 k
nov 201319   17 k 6,5499111 Mb1,1 M166 k52 k1,9 k672,5 k
out 201319   17 k 6,5499811 Mb1,1 M165 k52 k1,9 k642,5 k
set 201319   17 k 6,5499311 Mb1,1 M165 k52 k1,9 k642,5 k
ago 201319   17 k 6,549946211 Mb1,1 M165 k52 k1,9 k642,5 k
jul 201319   17 k 6,549926811 Mb1,1 M165 k52 k1,9 k642,5 k
jun 201319   17 k 6,549915711 Mb1,1 M165 k51 k1,9 k642,5 k
mai 201319 1 17 k 6,549942211 Mb1,1 M165 k51 k1,9 k642,5 k
abr 201319   17 k 6,449918011 Mb1,1 M165 k51 k1,9 k642,5 k
mar 201319   17 k 6,449913611 Mb1,1 M165 k51 k1,9 k642,5 k
fev 201319   17 k 6,449917011 Mb1,1 M165 k50 k1,9 k642,5 k
jan 201319   17 k 6,449933511 Mb1,1 M165 k50 k1,9 k642,5 k
dez 201219   17 k 6,449925611 Mb1,1 M165 k50 k1,9 k642,5 k
nov 201219   17 k 6,449923711 Mb1,1 M165 k50 k1,9 k642,5 k
out 201219 2 17 k 6,449940011 Mb1,1 M165 k49 k1,9 k642,5 k
set 20121912 17 k 6,449947611 Mb1,1 M165 k49 k1,9 k642,5 k
ago 201218   17 k 6,349933411 Mb1,1 M165 k49 k1,9 k632,5 k
jul 201218 1 17 k 6,349925511 Mb1,1 M165 k48 k1,9 k632,5 k
jun 201218 1117 k86,34991,1 k11 Mb1,1 M165 k48 k1,9 k632,5 k
mai 201218 1 17 k 6,350026811 Mb1,0 M163 k47 k1,9 k632,5 k
abr 201218   17 k 6,350032111 Mb1,0 M163 k46 k1,9 k632,5 k
mar 201218   17 k 6,350027111 Mb1,0 M163 k46 k1,9 k632,5 k
fev 201218 1117 k16,35001,2 k11 Mb1,0 M163 k46 k1,9 k632,5 k
jan 201218   17 k 6,249639111 Mb1,0 M163 k45 k1,9 k632,5 k
dez 201118   17 k 6,249676611 Mb1,0 M163 k45 k1,9 k632,5 k
nov 201118   17 k 6,149641011 Mb1,0 M163 k44 k1,9 k632,5 k
out 201118 1 17 k 6,14961,2 k11 Mb1,0 M163 k44 k1,9 k632,5 k
set 201118 1117 k1649630011 Mb1,0 M162 k42 k1,9 k632,5 k
ago 201118 1 17 k 649719711 Mb1,0 M162 k42 k1,9 k632,5 k
jul 201118   17 k 649620511 Mb1,0 M162 k42 k1,9 k632,5 k
jun 20111811 17 k 649618111 Mb1,0 M162 k41 k1,9 k632,5 k
mai 201117   17 k 649629411 Mb1,0 M162 k41 k1,9 k632,5 k
abr 201117   17 k 649652211 Mb1,0 M162 k41 k1,9 k632,5 k
mar 201117   17 k 649628011 Mb1,0 M162 k40 k1,9 k632,5 k
fev 20111712 17 k 5,949628611 Mb1,0 M162 k40 k1,9 k632,5 k
jan 201116   17 k 5,949529411 Mb1,0 M162 k40 k1,9 k632,5 k
dez 201016 2117 k15,949571811 Mb1,0 M162 k40 k1,9 k552,5 k
nov 201016 1117 k 5,949516711 Mb1,0 M162 k39 k1,9 k552,5 k
out 201016 2217 k 5,949562511 Mb1,0 M162 k39 k1,9 k552,5 k
set 201016 3217 k 5,849280811 Mb1,0 M161 k38 k1,9 k552,5 k
ago 20101613117 k25,849050511 Mb1,0 M162 k38 k1,9 k552,5 k
jul 201015 2217 k 5,849080711 Mb1,0 M161 k38 k1,9 k552,5 k
jun 201015 2217 k25,74874,8 k10 Mb1,0 M161 k37 k1,9 k552,5 k
mai 201015 3217 k15,44822,2 k10 Mb994 k159 k37 k1,9 k552,5 k
abr 20101513217 k235,34983,1 k10 Mb1,0 M163 k36 k1,9 k552,5 k
mar 201014 3216 k765,450412 k10 Mb993 k159 k32 k1,9 k552,4 k
fev 201014 4214 k135,448710 k8,2 Mb820 k128 k26 k1,7 k552,1 k
jan 201014 2213 k234,84702,0 k7,7 Mb765 k121 k23 k1,7 k552,0 k
dez 200914 1113 k 4,94681517,3 Mb722 k113 k23 k1,7 k552,0 k
nov 200914 2213 k 4,94687727,3 Mb722 k113 k22 k1,7 k552,0 k
out 200914 3213 k 4,94688567,3 Mb720 k113 k22 k1,7 k552,0 k
set 20091413213 k 4,84676007,2 Mb719 k113 k22 k1,7 k552,0 k
ago 200913 2213 k 4,74671,3 k7,2 Mb718 k113 k22 k1,7 k552,0 k
jul 200913 2213 k24,64668607,2 Mb715 k112 k22 k1,7 k552,0 k
jun 200913 3213 k14,64652,3 k7,2 Mb711 k112 k21 k1,7 k552,0 k
mai 200913 2213 k14,44581,5 k7,1 Mb697 k110 k21 k1,7 k552,0 k
abr 200913 2213 k54,34583,7 k7,0 Mb696 k109 k21 k1,7 k552,0 k
mar 200913 2212 k14,14459906,8 Mb672 k102 k20 k1,7 k562,0 k
fev 20091311112 k 44333346,6 Mb652 k99 k19 k1,7 k562,0 k
jan 200912 1 12 k 44331036,6 Mb652 k99 k19 k1,7 k562,0 k
dez 200812 1112 k 44332186,6 Mb652 k99 k19 k1,7 k562,0 k
nov 200812 1 12 k 3,94311176,6 Mb648 k98 k18 k1,7 k562,0 k
out 200812 2 12 k13,94311176,6 Mb647 k98 k18 k1,7 k562,0 k
set 200812 1112 k123,94301,9 k6,5 Mb645 k97 k18 k1,7 k562,0 k
ago 200812 2112 k223,94283,3 k6,3 Mb625 k94 k18 k1,7 k561,9 k
jul 200812 1111 k313,84253,2 k5,9 Mb587 k87 k17 k1,7 k561,6 k
jun 200812 1 10 k 3,94131515,3 Mb524 k76 k14 k1,7 k561,4 k
mai 20081212110 k123,94131,0 k5,3 Mb524 k76 k14 k1,7 k561,4 k
abr 200811 1110,0 k123,94051,5 k5,0 Mb494 k72 k13 k1,7 k561,3 k
mar 2008111319,6 k293,93852,8 k4,6 Mb447 k69 k12 k1,5 k561,3 k
fev 200810 218,7 k443489583,8 Mb367 k58 k9,2 k821561,2 k
jan 200810 118,6 k83,93261,7 k3,5 Mb340 k53 k8,4 k796581,2 k
dez 2007101218,4 k13,92761762,9 Mb278 k43 k7,7 k734581,1 k
nov 200791418,3 k263,82724,2 k2,9 Mb273 k43 k7,5 k723581,1 k
out 20078 227,6 k393,720311 k2,0 Mb180 k31 k6,9 k458788
set 20078 116,3 k42,71062,4 k927 kb65 k9,9 k6,8 k 6346
ago 20078 116,2 k 2,3103372847 kb61 k8,8 k6,7 k158128
jul 20078 116,2 k 2,3103831835 kb60 k8,6 k6,7 k158109
jun 20078 116,2 k 2,1103266816 kb60 k8,4 k6,7 k15872
mai 20078 1 6,2 k 2,1103126811 kb60 k8,4 k6,7 k1581
abr 2007811 6,2 k 2,110391809 kb60 k8,4 k6,6 k1581
mar 20077 1 6,2 k 2,110355808 kb60 k8,4 k6,5 k1581
fev 20077   6,2 k 2103122806 kb60 k8,4 k6,4 k1581
jan 20077 1 6,2 k 2103193805 kb60 k8,4 k6,3 k1581
dez 20067   6,2 k 210290798 kb59 k8,2 k6,2 k1581
nov 20067   6,2 k 2102102796 kb59 k8,2 k6,1 k1581
out 20067   6,2 k 2102143795 kb59 k8,2 k6,0 k1581
set 20067   6,2 k 1,910279794 kb59 k8,2 k5,8 k2581
ago 2006711 6,2 k 1,9102118793 kb59 k8,2 k5,8 k2581
jul 20066   6,2 k 1,9102132790 kb59 k8,2 k5,7 k1581
jun 20066   6,2 k 1,9102201788 kb59 k8,2 k5,5 k1581
mai 20066   6,2 k 1,910292785 kb59 k8,2 k5,3 k1581
abr 20066   6,2 k 1,910262783 kb59 k8,2 k5,2 k1581
mar 20066   6,2 k 1,8102266783 kb59 k8,2 k5,2 k1581
fev 2006611 6,2 k11,8102167780 kb59 k8,2 k5,0 k1581
jan 20065   6,2 k 1,8102104776 kb59 k8,2 k4,8 k1581
dez 20055 1 6,2 k 1,810216774 kb59 k8,2 k4,7 k1541
nov 20055   6,2 k 1,8102165773 kb59 k8,1 k4,7 k1541
out 20055   6,2 k 1,710250772 kb59 k8,1 k4,7 k1541
set 20055   6,2 k 1,710246771 kb59 k8,1 k4,6 k1541
ago 20055   6,2 k 1,71021,6 k771 kb59 k8,1 k4,6 k1541
jul 20055   6,2 k 1,5102509745 kb59 k8,1 k2,9 k1541
jun 20055   6,2 k 1,41021735 kb58 k8,1 k2,3 k1541
mai 20055 1 6,2 k 1,410210735 kb58 k8,1 k2,3 k1541
abr 20055   6,2 k 1,41022734 kb58 k8,1 k2,3 k1541
mar 20055 2 6,2 k11,41022,1 k734 kb58 k8,1 k2,3 k1541
fev 20055 2 6,1 k6711012,0 k693 kb58 k8,0 k2151541
jan 200554414,3 k13711104,3 k518 kb43 k5,6 k1151531
dez 20041   3 3112287,6 kb54618106 60 
nov 20041   1 1445 1,8 kb77 106 9 
out 200411  1 144511,8 kb77 106 9 
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
The following table ranks this project in relation to projects in other languages with 1000+ articles
Note: data for month(s) after Dec 2014 for one or more large projects are not yet known.
As a temporary approximation missing data for a project are substituted by the highest historic value for that project.
Once those missing data are available final rankings for recent months can shift one or more positions.
out 2014743661466560411593615432791968130
jul 2014743158486461381689595132781968130
abr 2014732964486256381788595132771966130
jan 2014744067406059411673575031771866130
out 20137443784658604316109575030771868130
jul 2013733981515764441575554929761866130
abr 2013703679515666431578554829751863130
jan 2013694582545467421483544629751762130
out 2012683451485359421375524429731661130
jul 2012695068535269421381504328711663130
abr 2012694078525367411375504326681663130
jan 2012693577505261411272494126671660130
out 2011664170485171391256473926651559130
jul 2011644481494966391272463826651560130
abr 2011653480454662411366443725641358130
jan 2011663577504461401668413424631156130
out 2010653662434161431560413222621059130
jul 2010664465434065431663383020601157130
abr 2010663653384025461333373018571156130
jan 2010653161374220491537413423591156130
out 2009613954434258461454403522591155130
jul 2009623959384046451452393521571154130
abr 2009594959363940501432393321571052130
jan 200959586642355749146837322157948130
out 200856364842355248126135302155845129
jul 200854315738341648152536292155842129
abr 200854426041353142133436312256742129
jan 2008544361453334411935383124551041129
out 2007593948243114393010443825547536129
jul 2007584360403157565433555341519037129
abr 2007563861462961535077504936498338129
jan 2007564959452866494265494735457737129
out 2006513966432753453859454233436531129
jul 2006534068382552423756383931405928129
abr 2006493854351948383352353526314628129
jan 2006484559341641322744323122233827122
out 2005423249261435272448252320213423111
jul 2005353343251134242124222118212517106
abr 20053025412173019175716181514211693
jan 20052451317611413316171228151781
out 200452212916562010104953555521103169
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100ediçõesbytes
 WikcionaristasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikcionaristas (usuários registrados)
A = Wikcionaristas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikcionaristas que editaram pelo menos dez vezes desde que chegaram
C = Wikcionaristas que contribuíram cinco vezes ou mais este mês
D = Wikcionaristas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  2500  10000  5  10  100  1000  1  3  5  10  25  100  250  1  3  5  10  25  100  250  1000  5  10  100 
Monthly counts for recent history of wiki
jan 201541      22  31      211     111
dez 2014111      22          1       111
nov 201422111        52      42111   11 
out 20144111         2       3          
set 201421111        4       721     11 
ago 201431111    11          5211    11 
jul 20142111     11  41      2111       
jun 201421111    11  1       2          
mai 201441111    11  2       32111      
abr 20143211     11  2       11          
mar 2014411      11  4       3          
fev 201411      11  3       5          
jan 20141111111   221 1       7322       
dez 201321      11114       3          
nov 20131           61      8          
out 201311          5       41         
set 20131           42      5311       
ago 20131       111 4       41         
jul 2013        111 1       52         
jun 20133       111 41      31         
mai 2013211      221 1       6       1  
abr 20132       211 1       1          
mar 20131       331 2       221     11 
fev 20131       33  2       61      11 
jan 2013        431         2       11 
Quarterly counts for entire history of wiki
jan 201541      22  31      211     111
out 20144111         2       3          
jul 20142111     11  41      2111       
abr 20143211     11  2       11          
jan 20141111111   221 1       7322       
out 201311          5       41         
jul 2013        111 1       52         
abr 20132       211 1       1          
jan 2013        431         2       11 
out 2012222      321         621     11 
jul 2012411      421 2       8211    1  
abr 2012        54  11      422        
jan 20123       331 1       2       21 
out 20113211     332         6       11 
jul 20111       221 1       311        
abr 20112       332         211        
jan 201121      221 1       51         
out 20103222222       1       72221      
jul 20107322222       1       11111      
abr 201075322221      2111111 4321111 11 
jan 201022222211      4       3222       
out 20093332221       2       4          
jul 20093222222       1       411     11 
abr 2009332222211     311     522111     
jan 2009221      32  1       511     111
out 200822221    21  3       643        
jul 200841111111  221121      62         
abr 200811111111  22  311     611111  1  
jan 200821111111  221 411111  5111       
out 2007322222111111  332211  32221111   
jul 20071111111   11          111111     
abr 2007111      11  1       111        
jan 200752111    111         2          
out 20061       111         2          
jul 2006        111         2          
abr 2006        11          211        
jan 20061       111         2          
out 2005        11                     
jul 20052       111         1          
abr 20051                   11         
jan 2005444421    2222433     432221     
out 20041                              

 

Distribuição de edições de artigos por wikcionaristas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikcionaristasEdições total
1120100.0%86,696100.0%
33831.7%86,58199.9%
101915.8%86,47099.7%
32119.2%86,32899.6%
10065.0%86,01899.2%
31643.3%85,65898.8%
100021.7%84,80697.8%
316221.7%84,80697.8%
1000010.8%75,38987.0%
3162310.8%75,38987.0%

 

4 wikcionaristas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions
agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
PeppepzUC3 050621282abr 29, 2014276153136-
Accarjemicu ra canigghiaUC9+15848-fev 03, 201018223531-
CalqUC43+1831--mar 29, 2013672----
Stas000DUC120...11--jan 19, 201511----

 

20 wikcionaristas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
SarvaturiUC175,389mai 09, 20063188jul 26, 2014188
InterwicketUC29,417jan 29, 20092192nov 08, 20101544
Pippu d'AngeloUC4346jan 13, 20053669mai 14, 20082452
SabineCretellaUC5234jan 11, 20053671set 13, 20101600
CommonsDelinkerUC6126jan 16, 20082571dez 12, 201449
StrabbismuUC790fev 09, 20063277jan 25, 20072927
Hégésippe CormierUC870dez 22, 20053326nov 28, 20091889
RederUC1058ago 31, 20101613set 01, 20101612
Scorpios90UC1134fev 04, 20111456set 26, 2012856
Klone123UC1227set 04, 20091974out 22, 20091926
EsbarduUC1321nov 08, 20072640jun 03, 2012971
MelosUC1421fev 03, 20082553mar 21, 20082506
SergioUpload-scUC1520jan 25, 20053657jan 25, 20053657
GerardMUC1618jan 11, 20053671jul 09, 20053492
CraudiuUC1714ago 05, 20063100ago 05, 20063100
.sEdivadUC1811abr 03, 20111398mar 03, 2014333
ZuCarruUC1910jun 02, 20111338jun 02, 20111338
EsseTiUC209mai 13, 20072819mai 13, 20072819
Wim bUC219mar 09, 20082518mar 09, 20082518
Angelo.romanoUC228jul 05, 20053496nov 25, 20091892

 

usuários anônimos, ordenados por número de contribuições
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
82.228.198.161271
82.238.78.17729
83.24.209.3820
151.83.14.1012

No total 731 edições foram feitas por usuários anônimos, de um total de 115718 edições ( 0e %)
  


16 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
RobotGMwiktUC18,399jan 26, 20053656jun 06, 200824291,685-
Luckas-botUC24,762mar 06, 20092156jan 27, 2014368--
HydrizBotUC34,759mar 18, 20111414jan 22, 20158--
RobotSCwiktUC44,264jan 26, 20053656fev 02, 200536494,211-
SpaceBirdyBotUC52,183mar 30, 20082497jan 02, 20101854--
KamikazeBotUC61,972out 18, 20111200mar 06, 2013695--
VolkovBotUC71,034ago 20, 20072720mar 21, 2013680--
YS-BotUC8429set 13, 2012869jan 29, 20151--
AvocatoBotUC9342nov 01, 20111186ago 08, 2013540--
SzajciBotUC1055set 09, 20082334jan 12, 20092209--
CarsracBotUC1135nov 17, 2012804mai 30, 2013610--
MonoBotUC1224jan 18, 20082569jun 14, 20082421--
Makecat-botUC1320nov 10, 2012811abr 05, 2013665--
JackBotUC146ago 10, 20101634ago 10, 20101634--
JAnDbotUC152jun 10, 2012964jun 26, 2012948--
タチコマ robotUC162mai 04, 2014271nov 11, 201480--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110JpgPng
jan 201520 k47937244697963407      81410
dez 201420 k47737244697963407      81410
nov 201420 k47637244697963407      931410
out 201420 k47237244697763406      391410
set 201420 k47137244697733406      371410
ago 201420 k46637244697703406      901410
jul 201420 k46237244697693405      431410
jun 201420 k46137244697693405      671410
mai 201420 k46137244697693405      1381410
abr 201420 k45937244697673405      191410
mar 201420 k45437244697673405      111410
fev 201420 k45137244697673405      31410
jan 201420 k44637244697673405      3301410
dez 201320 k43537244697673400      41410
nov 201320 k43437244697673400      11410
out 201320 k42737244697673400      41410
set 201320 k42337244697673400      11410
ago 201320 k40737244697673400      11410
jul 201320 k40436244697673400       1410
jun 201320 k40136244697673400      41410
mai 201320 k39936244697673400      71410
abr 201320 k39736234697673400      21310
mar 201320 k39436234697673400      11310
fev 201320 k38836234697673400      21310
jan 201320 k38336234697673400       1310
dez 201220 k38136234697673400      41310
nov 201220 k37436234697673400      51310
out 201220 k37336234697673400      141310
set 201220 k36936234697673397      311310
ago 201220 k36436234697673397      41310
jul 201220 k35836234697673397      131310
jun 201220 k35136234697673397      7531310
mai 201220 k34236234697653378      121310
abr 201220 k33536234697643377       1310
mar 201220 k32636234697643377      21310
fev 201220 k32336234697643377      9481310
jan 201220 k31136234697603373      41310
dez 201120 k30836234697603373      11310
nov 201120 k30336234697603373      31310
out 201120 k29236234697593373      271310
set 201120 k28636234697593373      1711310
ago 201120 k28336234697593369      891310
jul 201120 k27536234697593369      11310
jun 201119 k26336234697593369      111310
mai 201119 k26036234697593369       1310
abr 201119 k25436234697593369      21310
mar 201119 k24636234697593369      21310
fev 201119 k24536234697593369      991310
jan 201119 k23636234697593369      61310
dez 201019 k22936234697593369      1451310
nov 201019 k22736234697593369      1581310
out 201019 k22436234687593369      6231310
set 201019 k22136234687593369      8031310
ago 201019 k21636234687593368      4931310
jul 201019 k19936234687583361      8051310
jun 201019 k19936234687583361      48371310
mai 201019 k18236234687563361      21951310
abr 201019 k18136234687533334      30921310
mar 201019 k17736224687413274      115371210
fev 201016 k16336154687073201      10266105
jan 201015 k15835154686973192      2021105
dez 200915 k14435154686973183      144105
nov 200915 k14235154686973183      771105
out 200915 k14035154686973183      848105
set 200915 k13735154686973183      600105
ago 200915 k13235144686973183      1324104
jul 200915 k13135144686973183      858104
jun 200915 k12935144686953183      2306104
mai 200915 k12735144676943182      1481104
abr 200915 k12635144676933181      3725104
mar 200914 k11735144676923175      949104
fev 200914 k11235144676912173      267104
jan 200914 k10735144676912173      11104
dez 200814 k10635144676912173      110104
nov 200814 k10535144676912173      10104
out 200814 k8934144676912173      86104
set 200814 k8034144676901173      1839104
ago 200814 k7734144676861172      3243104
jul 200813 k7434144676861163      1449104
jun 200812 k7134144666861163      18104
mai 200812 k6832144666861163      780104
abr 200811 k6232144666841159      1384104
mar 200811 k5931124666691106      269693
fev 20089,9 k573011462663186      82183
jan 20089,8 k53299460658184      159872
dez 20079,4 k49299460655179      14172
nov 20079,4 k47299460655179      412172
out 20078,3 k46295460654174      1076032
set 20076,7 k33222455119 49      23452 
ago 20076,4 k29222455101 38      3672 
jul 20076,3 k28222455100 37      8042 
jun 20076,3 k2622228898 35      2522 
mai 20076,2 k242227288 4      92 
abr 20076,2 k232227288 4      92 
mar 20076,2 k232227287 4      52 
fev 20076,2 k231927287 4       2 
jan 20076,2 k221927287 3      732 
dez 20066,2 k221927287 3      12 
nov 20066,2 k221927287 3       2 
out 20066,2 k211927287 3      22 
set 20066,2 k191927287 3       2 
ago 20066,2 k191927287 3      152 
jul 20066,2 k181927287 3       2 
jun 20066,2 k171927287 3      12 
mai 20066,2 k161927287 3      32 
abr 20066,2 k151727287 3       2 
mar 20066,2 k141727287 3       2 
fev 20066,2 k141727287 3      262 
jan 20066,2 k141727287 3      22 
dez 20056,2 k121727287 3      52 
nov 20056,2 k71727271 3       2 
out 20056,2 k71727271 3       2 
set 20056,2 k71727271 3      12 
ago 20056,2 k71727271 3      12 
jul 20056,2 k71727271 3      32 
jun 20056,2 k71727271 3      12 
mai 20056,2 k71727271 3      62 
abr 20056,2 k71727271 3      12 
mar 20056,2 k61727271 3      212 
fev 20056,1 k61727269 3      1292 
jan 20054,3 k61727269 3      1852 
dez 20043   72            
nov 20041                
out 20041                

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

out 2004: 1 1 Pàggina principali

dez 2004: 1 1 Pàggina principali

jan 2005: 1 3 etimoluggìa , 2 3 Pàggina principali , 3 2 filoluggìa , 4 2 abbanniari , 5 2 abbentu , 6 2 abbaffari , 7 2 Utente:SabineCretella/lista/D , 8 2 giappunisi , 9 1 етимология

fev 2005: 1 2 abbummatu , 2 2 abbullari , 3 2 accattari , 4 2 accabbari , 5 1 Synonym

mar 2005: 1 2 acciuncari , 2 2 acchianari , 3 1 Saturnu

abr 2005: 1 1 accucchiari

mai 2005: 1 1 ajutu

jun 2005: 1 1 lìttira

jul 2005: 1 1 maritàrisi

ago 2005: 1 1 pillari

set 2005: 1 1 mafia

dez 2005: 1 1 canciamentu

jan 2006: 1 1 pirsuna

fev 2006: 1 2 ottugrafìa , 2 1 cicala

mai 2006: 1 1 Wikizziunariu

jun 2006: 1 1 ciuciu

ago 2006: 1 1 buttana

out 2006: 1 1 strèusu

dez 2006: 1 1 nilvia

jan 2007: 1 1 ntisa

mar 2007: 1 1 ncazzàrisi

abr 2007: 1 1 cafè

mai 2007: 1 1 taliata

jun 2007: 1 1 abbirintu

jul 2007: 1 1 buhhiularu

ago 2007: 1 1 cascjarizzu

set 2007: 1 1 UTC

out 2007: 1 2 ddi , 2 2 chidda , 3 2 chiddi , 4 2 chiddu , 5 2 chista , 6 2 chissi , 7 2 chissa , 8 2 luordu , 9 2 agrestu , 10 2 fallaci , 11 2 magru , 12 2 medianu , 13 2 midianu , 14 2 mansu , 15 2 mancarusu , 16 2 malacriatu , 17 2 malcriatu , 18 2 largu , 19 2 làricu , 20 2 lurdu , 21 2 linnu , 22 2 gàutu , 23 2 irbusu , 24 2 jàuru , 25 2 àjiru

nov 2007: 1 2 pàggina , 2 2 tiatru , 3 2 austu , 4 2 agneddu , 5 2 accusari , 6 2 allegru , 7 2 purtughisi , 8 2 dizziunariu , 9 2 coniugali , 10 2 sustantivu , 11 2 lazzu , 12 2 gaddutu , 13 2 furricu , 14 2 furdìcula , 15 2 fràggili , 16 2 firricu , 17 2 firranti , 18 2 filàutu , 19 2 oceddu , 20 2 babbu , 21 2 auceddu , 22 2 ddazzu , 23 2 armalu , 24 2 ardìcula , 25 2 aneddu

dez 2007: 1 2 arà , 2 1 conxunción

jan 2008: 1 1 ipericu

fev 2008: 1 2 catananna , 2 1 pena

mar 2008: 1 2 vinu , 2 2 armali , 3 2 banniari , 4 2 vanniari , 5 2 cristianu , 6 2 abbummatu , 7 2 abbullari , 8 2 abbadari , 9 2 pitanza , 10 2 bannizzari , 11 2 abbanniari , 12 2 abbiari , 13 2 abbentu , 14 2 acchianari , 15 1 signa

abr 2008: 1 1 filtru

mai 2008: 1 2 fazzulettu , 2 2 muccaturi , 3 1 Durlindana

jun 2008: 1 1 cità

jul 2008: 1 2 pìritu , 2 1 aceddu dû malutempu

ago 2008: 1 2 motherboard , 2 1 carraja

set 2008: 1 1 zifulà

out 2008: 1 1 capillutu

nov 2008: 1 1 ghiurnali

dez 2008: 1 1 gaddorfu

jan 2009: 1 1 mali

fev 2009: 1 2 esperantu , 2 1 fini

mar 2009: 1 2 rouge , 2 2 lutu , 3 2 liara , 4 2 drittu , 5 2 luta , 6 2 lissa , 7 2 lippu , 8 2 disa , 9 2 mù ccà , 10 1 brìndisi

abr 2009: 1 3 acqua , 2 2 vindita , 3 2 altru , 4 2 oy , 5 2 pir , 6 2 territoriu , 7 2 sou , 8 2 , 9 2 et , 10 2 principali , 11 2 càmmara , 12 2 tirruri , 13 2 sternu , 14 2 esternu , 15 2 nnipinnenza , 16 2 mustu , 17 2 arruri , 18 2 erruri , 19 2 cosmoluggìa , 20 2 chìmica , 21 2 furchetta , 22 2 dannu , 23 2 lardu , 24 2 lanza , 25 2 chianu

mai 2009: 1 2 transitivu , 2 2 fiata , 3 2 daga , 4 2 calessi , 5 2 guadagnari , 6 2 corra , 7 2 risposta , 8 2 riga , 9 2 pupa , 10 2 lugghiu , 11 2 carta , 12 2 birra , 13 2 anatomia , 14 2 cravatta , 15 2 giugnu , 16 2 furmaggiu , 17 2 stanza , 18 2 , 19 2 trumma , 20 2 alcol , 21 2 tunisinu , 22 2 ucràinu , 23 2 turcu , 24 2 sluvaccu , 25 2 macèduni

jun 2009: 1 2 demm , 2 2 ġemel , 3 2 sekonda , 4 2 singulari , 5 2 plurali , 6 2 aparu , 7 2 altru , 8 2 bedda , 9 2 stima , 10 2 passa , 11 2 lavari , 12 2 nascita , 13 2 barca , 14 2 um , 15 2 grazia , 16 2 volta , 17 2 visu , 18 2 terminale , 19 2 soma , 20 2 saliva , 21 2 roba , 22 2 questione , 23 2 patata , 24 2 papa , 25 2 pane

jul 2009: 1 2 termini relatati , 2 2 ras , 3 2 qalb , 4 2 pronunzji , 5 2 popolazzjoni , 6 2 nazzjon , 7 2 navigazzjoni , 8 2 lessiku , 9 2 kwotazzjonijiet , 10 2 kwotazzjoni , 11 2 koordinazzjoni , 12 2 konġunzjoni , 13 2 kollezzjoni , 14 1 francupruvinzali

ago 2009: 1 2 ogni , 2 2 malu , 3 2 normali , 4 2 riccu , 5 2 fàcili , 6 2 scienza , 7 2 scemu , 8 2 agghiu , 9 2 malacunnutta , 10 2 lintu , 11 2 làdiu , 12 2 prena , 13 2 facceri , 14 2 azzanìa , 15 2 accia , 16 1 grara

set 2009: 1 3 taccia , 2 3 amenta , 3 2 ancuni , 4 2 verru , 5 2 ntonzi , 6 2 basilicò , 7 2 basi , 8 2 vardari , 9 2 uardari , 10 2 guardari , 11 2 esami , 12 2 babbaluci

out 2009: 1 2 sfardari , 2 2 battaglia , 3 2 brocca , 4 2 boi , 5 2 cafè , 6 2 galega , 7 2 bureddu , 8 1 stramichiatu

nov 2009: 1 2 celu , 2 2 ciumi , 3 2 cheyenne , 4 2 cherokee , 5 2 pedi , 6 1 spicchiu

dez 2009: 1 2 scaminari , 2 2 terra

jan 2010: 1 2 daga , 2 2 gula , 3 2 ladin , 4 2 lepru , 5 2 hindi , 6 2 luna , 7 2 deu , 8 1 armôna

fev 2010: 1 3 laberint , 2 2 alè , 3 2 palàura , 4 2 trita , 5 2 triti , 6 2 littori , 7 2 orra , 8 2 lantana , 9 2 angustia , 10 2 fraca , 11 2 navigazioni , 12 2 gufi , 13 2 scaliari , 14 2 nachitizzonna , 15 2 polirrimàtica , 16 2 accarièmicu , 17 2 agace , 18 2 scandiu , 19 2 tabbutu , 20 2 ànima , 21 2 ova , 22 2 sala , 23 2 ponti , 24 2 parola , 25 2 rìu

mar 2010: 1 3 глагол , 2 3 местоимение , 3 3 земля , 4 3 овёс , 5 3 kış , 6 2 azzurro , 7 2 privado , 8 2 privato , 9 2 privé , 10 2 private , 11 2 huitanta , 12 2 bana , 13 2 ilkbahar , 14 2 vircocu , 15 2 bèc , 16 2 argent , 17 2 aglon , 18 2 grafia , 19 2 abada , 20 2 abado , 21 2 pansa , 22 2 orto- , 23 2 iso- , 24 2 -ismu , 25 2 psico-

abr 2010: 1 3 tuvagghiuni , 2 3 moi , 3 2 action , 4 2 ila , 5 2 stecca , 6 2 binu , 7 2 beca , 8 2 ira , 9 2 ruma , 10 2 sonni , 11 2 blocchi , 12 2 frendi , 13 2 bega , 14 2 emma , 15 2 panti , 16 2 lova , 17 2 legga , 18 2 ghenga , 19 2 fessa , 20 2 buccia , 21 2 falò , 22 2 faia , 23 2 dora , 24 2 contri , 25 2 checca

mai 2010: 1 2 scujàttulu , 2 2 asarciziu , 3 2 cureanu , 4 2 águila , 5 2 fuerte , 6 2 cráneo , 7 2 bastante , 8 2 abuso , 9 2 adultu , 10 2 osso , 11 2 abelha , 12 2 abraço , 13 2 abuse , 14 2 USA , 15 2 abus , 16 2 action , 17 2 bore , 18 2 biology , 19 2 basque , 20 2 bailar , 21 2 asturiano , 22 2 aragonês , 23 2 arabe , 24 2 agosto , 25 2 vieillir

jun 2010: 1 3 cornu , 2 3 anciova , 3 2 cedda , 4 2 nsira , 5 2 August , 6 2 août , 7 2 olla , 8 2 cara , 9 2 èvèque , 10 2 libèrtât , 11 2 fagu , 12 2 crema , 13 2 casteddu , 14 2 caminu , 15 2 furesta , 16 2 blusa , 17 2 riparu , 18 2 gazza , 19 2 piriscia , 20 2 uttena , 21 2 manghjà , 22 2 insità , 23 2 incatarrì , 24 2 ira , 25 2 argent

jul 2010: 1 2 arcu , 2 2 ndivinari , 3 1 August

ago 2010: 1 2 accio , 2 2 acchiare , 3 2 accattare , 4 1 comparisce

set 2010: 1 2 dubitari , 2 2 arricampàrisi , 3 2 cuenzo , 4 2 cuculone , 5 2 cucuacia , 6 2 controra , 7 2 comparisce , 8 2 chiummo , 9 2 cazzare

out 2010: 1 2 jiri , 2 2 firmari , 3 1 appanzicàrisi

nov 2010: 1 1 cara

dez 2010: 1 2 sdurrubbari , 2 2 scunchiurutu , 3 1 scunchjurutu

jan 2011: 1 1 tabutu

fev 2011: 1 1 to ma

mar 2011: 1 1 papa

abr 2011: 1 1 a vanedda

jun 2011: 1 1 sbarrachiari

jul 2011: 1 1 palummu

ago 2011: 1 1 limaccia

set 2011: 1 1 sgangatello

out 2011: 1 1 violo

nov 2011: 1 1 visu

dez 2011: 1 1 éga

jan 2012: 1 1 musca

fev 2012: 1 1 razzina

mar 2012: 1 1 palummu

mai 2012: 1 1 camarata

jun 2012: 1 2 ترش , 2 2 گل , 3 1 irbicedda

jul 2012: 1 2 teccà , 2 1 tè ccà

ago 2012: 1 1 muffula

set 2012: 1 3 trazzera , 2 2 beni , 3 1 scògghiri

out 2012: 1 1 ebràicu

nov 2012: 1 1 prezzu

dez 2012: 1 1 cuttigghiu

fev 2013: 1 1 e

mar 2013: 1 1 tigri

abr 2013: 1 1 pìcciuli

mai 2013: 1 1 minutulu

jun 2013: 1 1 pasranu

ago 2013: 1 1 Taruni

set 2013: 1 1 sturneddu

out 2013: 1 1 fromâjo

nov 2013: 1 1 conoscente

dez 2013: 1 1 ddagghjusu

jan 2014: 1 1 cunsigghiari

fev 2014: 1 1 brocca

mar 2014: 1 1 trunzu

abr 2014: 1 1 dajuni

mai 2014: 1 1 nzittari

jun 2014: 1 1 giuvari

jul 2014: 1 1 taddariti

ago 2014: 1 1 curanedda mpiriali

set 2014: 1 1 Appinnici:Conjugazzioni/Sicilianu/nzittari

out 2014: 1 1 piccirìddu

nov 2014: 1 1 virrica

dez 2014: 1 1 giometrìa

jan 2015: 1 1 bistinu

No data on this page have been normalized to 30 day months (as WMF does on certain traffic reports).
Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Terça-feira, 3 de março 2015 04:04

Dump file scnwiktionary-20150225-pages-meta-history.xml.7z (full dump), size 8.7 Mb as 7z -> 180 Mb
Dump processed till Jan 31, 2015, on server stat1002, ready at Wed-25/02/2015-11:59 after 2 min, 12 sec.

Versão do script:2.6
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.