Estatísticas da Wikcionário sérvio

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist

Metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.
See also metrics definitions


 
Monthly counts & Quarterly rankings: dezembro 2015
 
DataWikcionaristasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
dez 2015+12%   0%   +158%      0%
nov 20150%   0%   -97%      +2%
out 2015+2%   +43%0%  +57%      0%
set 2015+1%   +71%   +3367%      0%
ago 20150%   0%   -83%      0%
jul 2015+1%   0%   +555%      0%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
dez 20151191319 45 k33,4 2,2 k      2,2 k
nov 2015106 2 45 k 3,4 845      2,2 k
out 201510625 45 k4383,3 29 k      2,1 k
set 201510413132 k4383,9 18 k      2,1 k
ago 2015103 6 18 k15,6 527      2,1 k
jul 201510314 18 k15,6 3,0 k      2,1 k
jun 2015102915 18 k45,5 465      2,1 k
mai 201593510218 k75,5 737      2,1 k
abr 201588117 18 k75,5 762      2,1 k
mar 201587217 18 k35,552880325 Mb1,4 M35 k86 k1731242,1 k
fev 201585312118 k35,552351925 Mb1,4 M34 k85 k1731242,1 k
jan 201582312 18 k25,551745324 Mb1,3 M33 k85 k1731242,1 k
dez 2014791325218 k55,55151,3 k24 Mb1,3 M33 k85 k1731082,1 k
nov 2014661425117 k75,550585924 Mb1,3 M31 k84 k172792,1 k
out 201452 1 17 k 5,54982223 Mb1,2 M30 k84 k172792,0 k
set 201452   17 k 5,5498523 Mb1,2 M30 k84 k172792,0 k
ago 201452   17 k 5,54984523 Mb1,2 M30 k84 k172792,0 k
jul 201452 4217 k15,54982,3 k23 Mb1,2 M30 k84 k172682,0 k
jun 201452 4217 k 5,450772923 Mb1,2 M28 k84 k171681,5 k
mai 201452 9417 k25,35081,3 k23 Mb1,2 M28 k84 k171681,5 k
abr 201452 9217 k55,350374923 Mb1,2 M26 k84 k171661,4 k
mar 20145229317 k35,34931,2 k22 Mb1,2 M24 k83 k166601,4 k
fev 20145029217 k 5,248671422 Mb1,2 M20 k83 k165601,4 k
jan 201448   17 k 5,248519822 Mb1,2 M19 k83 k165601,4 k
dez 201348 7117 k15,248578822 Mb1,2 M19 k82 k165601,4 k
nov 201348 5 17 k25,148320322 Mb1,2 M19 k81 k152601,4 k
out 20134816117 k45,148040722 Mb1,1 M19 k81 k124591,4 k
set 201347 6117 k55,247550521 Mb1,1 M19 k81 k98591,3 k
ago 201347 1 16 k 5,246815121 Mb1,1 M19 k81 k98591,3 k
jul 201347 2 16 k15,24679621 Mb1,1 M19 k81 k98591,3 k
jun 201347 5116 k15,246639821 Mb1,1 M19 k81 k98591,3 k
mai 201347 3 16 k15,24679121 Mb1,1 M19 k81 k98591,2 k
abr 201347 7116 k35,246643921 Mb1,1 M19 k80 k98591,2 k
mar 20134718216 k45,24631,4 k21 Mb1,1 M18 k80 k98591,2 k
fev 20134667 16 k25,145934120 Mb1,0 M18 k79 k96591,1 k
jan 201340   16 k 5,145688820 Mb1,0 M18 k79 k96591,1 k
dez 20124011 16 k 545622320 Mb1,0 M18 k78 k96591,1 k
nov 201239 1 16 k 545673220 Mb1,0 M18 k78 k96591,1 k
out 201239   16 k 545612020 Mb1,0 M18 k77 k95591,1 k
set 201239   16 k 545618320 Mb1,0 M18 k76 k95591,1 k
ago 201239   16 k 545659520 Mb1,0 M18 k76 k95501,1 k
jul 201239 1 16 k 4,945614120 Mb1,0 M18 k76 k95501,1 k
jun 201239 1 16 k 4,945613120 Mb1,0 M18 k75 k95501,1 k
mai 201239   16 k 4,945628320 Mb1,0 M18 k75 k95501,1 k
abr 201239 2 16 k 4,945632320 Mb1,0 M18 k75 k95501,1 k
mar 201239   16 k 4,945643520 Mb1,0 M18 k75 k95501,1 k
fev 20123911 16 k 4,945645720 Mb1,0 M18 k74 k95501,1 k
jan 201238 1 16 k 4,845677220 Mb1,0 M18 k74 k95501,1 k
dez 201138   16 k 4,84561,4 k20 Mb1,0 M18 k72 k95501,1 k
nov 201138   16 k 4,745617220 Mb1,0 M18 k70 k95501,1 k
out 201138 1 16 k 4,745628220 Mb1,0 M18 k70 k95501,1 k
set 201138 2 16 k14,745618120 Mb1,0 M18 k69 k95501,1 k
ago 20113811 16 k 4,745616620 Mb1,0 M18 k69 k95501,1 k
jul 201137   16 k 4,745615520 Mb1,0 M18 k68 k95501,1 k
jun 20113711 16 k 4,745687020 Mb1,0 M18 k68 k95501,1 k
mai 201136 2 16 k 4,645632720 Mb1,0 M18 k67 k95471,1 k
abr 20113611 16 k 4,645634220 Mb1,0 M18 k66 k95471,1 k
mar 201135 1 16 k 4,645727720 Mb1,0 M18 k66 k95471,0 k
fev 201135   16 k 4,545741220 Mb1,0 M18 k66 k95471,0 k
jan 201135   16 k 4,545724120 Mb1,0 M18 k65 k95471,0 k
dez 201035   16 k 4,545753720 Mb1,0 M18 k65 k95471,0 k
nov 20103523116 k 4,545729220 Mb1,0 M18 k64 k95471,0 k
out 201033 1116 k 4,545754520 Mb1,0 M18 k64 k94471,0 k
set 20103323116 k14,445747920 Mb1,0 M18 k63 k94471,0 k
ago 201031 2116 k 4,445740120 Mb1,0 M18 k63 k94471,0 k
jul 20103113116 k 4,445786420 Mb1,0 M18 k63 k94471,0 k
jun 201030 1116 k 4,346063720 Mb1,0 M18 k62 k94451,0 k
mai 201030 1116 k 4,346063220 Mb1,0 M18 k61 k94451,0 k
abr 201030 1116 k 4,246045220 Mb1,0 M18 k61 k94451,0 k
mar 201030 3116 k 4,246013 k20 Mb1,0 M18 k60 k94451,0 k
fev 201030 2116 k 3,446259821 Mb1,0 M18 k60 k94451,0 k
jan 201030 2116 k 3,346235121 Mb1,0 M17 k59 k94451,0 k
dez 20093012116 k 3,346241021 Mb1,0 M17 k59 k94441,0 k
nov 200929 1116 k 3,346250121 Mb1,0 M17 k58 k94431,0 k
out 200929 1116 k 3,346243321 Mb1,0 M17 k58 k94431,0 k
set 20092913116 k 3,246242321 Mb1,0 M17 k57 k94421,0 k
ago 200928 1116 k 3,246263321 Mb1,0 M17 k57 k94331,0 k
jul 20092813116 k 3,24622,4 k21 Mb1,0 M17 k56 k94331,0 k
jun 200927 2116 k 346438821 Mb1,0 M17 k56 k94321,0 k
mai 20092712116 k 346483221 Mb1,0 M17 k56 k94321,0 k
abr 200926 2116 k 2,94641,1 k21 Mb1,0 M17 k55 k94321,0 k
mar 20092612116 k 2,94632,9 k21 Mb1,0 M17 k54 k94321,0 k
fev 20092523216 k152,74611,8 k21 Mb1,0 M17 k50 k9432998
jan 20092322115 k22,643826819 Mb993 k16 k49 k9434661
dez 200821   15 k 2,643611619 Mb986 k15 k49 k9430659
nov 200821   15 k 2,643611819 Mb986 k15 k49 k9430657
out 200821   15 k 2,643617519 Mb986 k15 k49 k9430657
set 200821 2 15 k 2,643631319 Mb986 k15 k49 k9430657
ago 200821 1 15 k 2,643565319 Mb985 k15 k48 k9430657
jul 200821   15 k 2,643542919 Mb985 k15 k48 k9430657
jun 200821 1 15 k 2,54351,0 k19 Mb985 k15 k47 k9530657
mai 200821 2 15 k 2,54351,2 k19 Mb984 k15 k46 k9530657
abr 200821 1 15 k 2,443514019 Mb984 k15 k44 k9530657
mar 20082111 15 k 2,443517619 Mb984 k15 k44 k9530657
fev 200820 1 15 k 2,443423119 Mb981 k15 k44 k9529657
jan 200820 1 15 k 2,343445619 Mb981 k15 k44 k9529655
dez 200720   15 k 2,343415719 Mb981 k15 k43 k9526655
nov 20072011 15 k 2,34345619 Mb980 k15 k43 k9525654
out 200719   15 k 2,343412919 Mb980 k15 k43 k9525654
set 200719 1 15 k 2,34347719 Mb980 k15 k42 k9525654
ago 200719   15 k 2,34344819 Mb980 k15 k42 k9525654
jul 200719 1 15 k 2,343474519 Mb980 k15 k42 k9525654
jun 200719 1 15 k 2,24344019 Mb980 k15 k42 k9525654
mai 200719   15 k 2,24341,2 k19 Mb980 k15 k42 k9525654
abr 200719 2 15 k 2,243369019 Mb980 k15 k40 k9525654
mar 20071913 15 k 2,143332219 Mb980 k15 k40 k9525654
fev 200718 2 15 k 2,143350519 Mb979 k15 k39 k9525653
jan 200718 1 15 k 2,143375119 Mb978 k15 k39 k9525653
dez 20061812 15 k 24331,2 k19 Mb976 k15 k38 k9525648
nov 200617   15 k 1,943356619 Mb977 k15 k38 k9525647
out 200617 3115 k 1,94331,4 k19 Mb976 k15 k37 k9525647
set 200617   15 k 1,84331,0 k19 Mb976 k15 k36 k9523646
ago 200617 2 15 k 1,743355419 Mb976 k15 k35 k9522645
jul 200617 1115 k1451,74338,7 k19 Mb975 k15 k34 k922645
jun 200617 3111 k2311,64328,6 k14 Mb698 k11 k26 k922584
mai 2006171313,9 k82,35471,0 k8,3 Mb351 k3,5 k18 k923581
abr 2006161213,6 k522,25462,0 k8,0 Mb327 k3,1 k16 k922578
mar 2006152312,1 k402,85191,8 k4,5 Mb187 k2,6 k8,6 k922563
fev 20061316183424,83921,3 k1,2 Mb65 k2,4 k3,4 k119513
jan 20061212 76613,55211971,1 Mb57 k1,4 k2,7 k112138
dez 20051124 73613,45125051022 kb53 k1,3 k2,7 k19136
nov 2005912 718 2,851148974 kb52 k1,1 k2,4 k 5136
out 20058 1 713 2,750851955 kb51 k1,1 k2,3 k 4134
set 20058111713 2,7507426954 kb51 k1,1 k2,3 k 4134
ago 2005722 712 2,1506101944 kb51 k1,1 k2,3 k12134
jul 20055 4 70921,9505132935 kb51 k1,0 k2,2 k12133
jun 2005511 661 1,946233793 kb44 k1,0 k1,6 k11133
mai 2005413 658 1,845765774 kb43 k9941,6 k11132
abr 20053 2165321,8448168747 kb42 k9941,5 k11129
mar 20053 1 584 1,738843565 kb33 k96468711128
fev 20053 21581111,6390463562 kb33 k95366911127
jan 2005323127091,8121451122 kb6,3 k3874311118
dez 20041   5 4,419634,4 kb179175 14
nov 20041   4 4,819343,4 kb177165 14
out 20041   4 3,8260 3,7 kb194145 14
set 20041   4 3,826063,7 kb194145 14
ago 20041   2 4,5444 2,5 kb165115 11
jul 20041   2 4,544422,5 kb165115 11
jun 20041   1 7183 775 5165  1
mai 20041   1 7183 775 5165  1
abr 20041   1 7183 775 5165  1
mar 20041   1 71831775 5165  1
fev 20041   1 6184 734 5164  1
jan 20041   1 6184 734 5164  1
dez 20031   1 61842734 5164  1
nov 20031   1 4126 277 1823   
out 20031   1 41261277 1823   
set 20031   1 31281280 1823   
ago 20031   1 2128 214 182    
jul 20031   1 21281214 182    
jun 200311  1 11521264 25     
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
The following table ranks this project in relation to projects in other languages with 1000+ articles
out 2015271730 45297 9      136
jul 2015282632 685352 57      136
abr 2015313212 683855 66      136
jan 2015331315436844521464464963745756136
out 20144440564669615116102444863745661136
jul 2014433329256652491734444762705467136
abr 2014433320256534551641444766705467136
jan 2014444184496158581785434771705472136
out 2013432524316136571755414770705972136
jul 2013444047515953551894414770686270136
abr 2013423722365948551763404769676268136
jan 2013464582545867541761404868666067136
out 2012463680495563561694404767656066136
jul 2012464862535469541690404667636168136
abr 2012433950525465551674384467636068136
jan 2012443555505464551858374267636069136
out 2011413962485367531782364065595770136
jul 2011424381485069511776363965575670136
abr 2011422457454860551973333865575667136
jan 2011423579504761531971313665555363136
out 2010413581534460551964303363545362136
jul 2010422848554066561961293161525360136
abr 2010424674524057591969293159504961136
jan 2010423253473960651863273059504861136
out 2009424073503755611861272958484560136
jul 2009422849493659611735242953454461136
abr 2009435053463553621549212752444261136
jan 2009422550313345561556202551414160136
out 2008413674433263561355202550384158135
jul 2008413272453159581355192549363856135
abr 2008414257493064551362172345333654135
jan 2008414353512859571157151940323451135
out 200738407450266351964131737302851135
jul 2007364353442559531038121533282555134
abr 200731384147236151949111332282251134
jan 200730475044216649644111328272053134
out 200629393632195346633101028221950134
jul 200625404828166446147825183047134
abr 2006222636272773462271240222648134
jan 2006242736344040373740273343303648126
out 2005263341263336323247242640274159114
jul 2005353019253028292938212237222864109
abr 200542242218262420202317203019226697
jan 200539111614271316161525283445166085
out 200445252916452111115349534648115273
jul 200440192610411855374140363393855
abr 200418785195441413141265819
jan 200416443164331010101064916
out 200314332143221010101064614
jul 20031354313322101091074613
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100ediçõesbytes
 WikcionaristasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikcionaristas (usuários registrados)
A = Wikcionaristas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikcionaristas que editaram pelo menos dez vezes desde que chegaram
C = Wikcionaristas que contribuíram cinco vezes ou mais este mês
D = Wikcionaristas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  2500  5  10  100  1000  10000  1  3  5  10  25  5  10  100  1  3  5  10  25  100  5  10  100 
dez 2015272019124   2111 11      248311 11 
nov 201515421    111  1       10111  11 
out 201595521   333213       14631  21 
set 201584311111 332213       62211 11 
ago 2015138631   221  21      95411 11 
jul 2015126442   2211 1       84431 11 
jun 2015241915133   11           177632 111
mai 2015231610832   11           136542 11 
abr 2015231817107   22   2    2221813963122 
mar 2015272117169   22   4    111177531 11 
fev 20151814121091   11   41      135411 11 
jan 2015211612116   11   32      14552  111
dez 201436312521142   11   21      2310631 11 
nov 20144133251781        51      6328179411  
out 20143111    1            4211     
set 20142           3       51    11 
ago 201421     11   111     51    1  
jul 201412444422  111          42211    
jun 201411544421  111          7543     
mai 201411998641  11           108842    
abr 20141099982   11   1       149973    
mar 201411999931  11   2       138871    
fev 2014101097621  11   1       7111     
jan 201442     221  1       711      
out 201595521   333213       14631  21 
jul 2015126442   2211 1       84431 11 
abr 2015231817107   22   2    2221813963122 
jan 2015211612116   11   32      14552  111
out 20143111    1            4211     
jul 201412444422  111          42211    
abr 20141099982   11   1       149973    
jan 201442     221  1       711      
out 2013866661        1       169873    
jul 201332221   11           6331     
abr 20131087731   32   2       118633    
jan 20131      441          3     11 
out 201232     33           71    11 
jul 2012211     111          9     1  
abr 2012222     331  11      4331     
jan 2012311     442          2     21 
out 2011321     331  11      6     11 
jul 201152     111  2       31       
abr 201132111   221  2       62211    
jan 20111      221  1       6        
out 20105111111       11      6321     
jul 20103332211       2       2222     
abr 20104211111       1       62    11 
jan 20104322111       3       422211   
out 20096311111       21      411      
jul 20094333211  2111 1       5222  1  
abr 200974221111 1    1       421      
jan 2009732111   22   1       4321  11 
out 20082      221  1       422      
jul 20083      332  1       4        
abr 200811111   11   3       6        
jan 2008321     222  2       6        
out 20074      111  1111    31       
jul 2007321     111          221      
abr 20073321    111  1111    2111     
jan 200722111   111  1111    11111    
out 2006633331   111  3111    311      
jul 2006511111   2222 411     62111 11 
abr 200610322111  111  411     53211    
jan 200654222   22   43221   644221   
out 20056211         11               
jul 2005115411   11   1       2        
abr 2005322111        3221    42221    
jan 20055332211       3111    211111   
out 2004                             
jul 20041                            
abr 2004                             
jan 2004                             
out 2003                             
jul 2003                             

 

Distribuição de edições de artigos por wikcionaristas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikcionaristasEdições total
1322100.0%38,602100.0%
317153.1%38,35399.4%
1012237.9%38,07698.6%
326821.1%37,11496.1%
1003711.5%35,53592.1%
316165.0%31,94582.8%
1000103.1%28,98175.1%
316210.3%13,57935.2%
1000010.3%13,57935.2%

 

27 wikcionaristas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions
agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
Mickey MystiqueUC3 02,58610179641fev 15, 2013104819621622
Aleksandra DrobnjakUC42+261706931nov 27, 201533761-
Teodora JovanovicUC43+97696443nov 27, 20153354--
CommonsDelinkerUC49-151116-set 02, 20073041----
Milana KevresanUC74...282811dez 07, 2015231515--
ČolićIvanaUC76+105272431nov 27, 201533651-
SandrAleksendricUC80+221222153nov 27, 201533651-
Tijana RadojkovićUC81+221222142nov 27, 201533761-
Stakic4nUC103...151522dez 01, 20152944--
Teodora ĐurićUC107+197131244nov 27, 20153332--
J.NedićUC112...121211dez 16, 20151422--
SandraxiaoyuUC113...121211dez 21, 20159----
М.Шево94UC118...111111dez 16, 20151422--
DraganaKnezevicUC120+10110831nov 27, 201533321-
TeodoraMUC121+18410964nov 27, 201533651-
LullumayUC125...9944dez 07, 20152355--
Minaaa 007UC134...7711dez 16, 20151411--
Ana Mil94UC141...66--dez 14, 20151655--
KiraMitrovicUC142...66--dez 15, 20151566--
B.MilekićUC157...5511dez 16, 20151422--
JAn DudíkUC168+5142535jun 08, 2015205--38-
Nikolaz94UC199...33--dez 24, 2015633--
S.MilivojevicUC238...2211dez 16, 20151411--
IvanScrooge98UC239...22--dez 23, 20157----
JelenagledicUC319...11--dez 14, 201516----
Amada44UC320...11--dez 20, 201510----
Ivana ElfUC321...1111dez 23, 2015711--

 

20 wikcionaristas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
InterwicketUC113,579jan 27, 20092528nov 08, 20101878
Bubbah63UC22,979fev 15, 20131048set 20, 2015101
KasterUC41,679jan 27, 20053989nov 15, 20121140
KadzoUC51,540jan 11, 20092544abr 03, 20092462
Crveni BaronUC61,522nov 19, 20053693jul 25, 20063445
Linos MimiUC71,466fev 15, 20131048jul 11, 2014537
Milos trifunovicUC81,439set 08, 2015113out 06, 201585
DungodungUC91,099mai 11, 20053885out 26, 201565
The Milica TomovicUC101,092fev 15, 20131048jul 14, 2014534
GolijaUC11436jan 19, 20053997ago 14, 20053790
ImperatorkAUC12415fev 18, 20131045out 10, 201581
SrBotUC13414set 09, 20053764out 04, 20053739
SashatoUC14396dez 19, 20053663dez 19, 20053663
MilicaStajicUC15385nov 11, 2014414ago 04, 2015148
Taychy2110UC16315dez 14, 2013746dez 28, 2014367
FunakoshiUC17273out 02, 2013819mai 21, 2015223
NatalijaUC18263nov 07, 2014418mar 20, 2015285
PoletanicaUC19241fev 15, 20131048set 28, 2013823
Саша СтефановићUC20235dez 24, 20053658jan 12, 20092543
ItjustkindofhappenedUC21226nov 06, 2014419abr 30, 2015244

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 5.029 edições foram feitas por usuários anônimos, de um total de 153.579 edições ( 3e %)
  


20 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
IglbotUC141,714set 04, 2015117out 11, 20158026,708-
СлоботUC214,670jul 14, 20092360mar 26, 20102105--
CrveniBaronBotUC313,761mar 04, 20063588jul 23, 2006344711,259-
RobotGMwiktUC413,721jul 21, 20053814jun 06, 20082763--
HydrizBotUC58,449jul 01, 2015182dez 31, 2015---
Luckas-botUC64,967mar 03, 20092493jan 27, 2014702--
KamikazeBotUC74,524dez 17, 20101839mar 07, 20131028--
VolkovBotUC82,574ago 20, 20073054abr 05, 2013999--
YS-BotUC91,666set 07, 20121209out 18, 201573--
SpaceBirdyBotUC101,324jun 23, 20082746dez 30, 20092191--
BodhisattvaBotUC111,216fev 02, 20082888ago 19, 20082689--
AvocatoBotUC12843out 27, 20111525ago 28, 2013854--
MonoBotUC13217jan 17, 20082904jun 14, 20082755--
Makecat-botUC1484nov 10, 20121145abr 05, 2013999--
FelixBotUC1562dez 16, 20053666jun 14, 20063486--
JAnDbotUC1646jun 10, 20121298dez 03, 201527--
CarsracBotUC1744dez 22, 20121103mai 21, 2013953--
AibotUC187mai 13, 20082787jun 13, 20082756--
GetoBot~srwiktionaryUC192fev 08, 20063612fev 08, 20063612--
EscarbotUC201set 02, 20063406set 02, 20063406--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110JpgOggPngSvg
dez 201547 k615951367362927512      3442
nov 201547 k611951367352927412      3442
out 201547 k603941367352927412      3442
set 201534 k602931367202927412      3442
ago 201521 k602931367202927412      3442
jul 201520 k601931367092927412      3442
jun 201520 k600931367012927312      3442
mai 201520 k598931367012923312      3442
abr 201520 k598931267002923312      3342
mar 201520 k596931267002923312     6033342
fev 201520 k595931267002923312     4753342
jan 201520 k590931267002923312     3873342
dez 201420 k585931267002923312     9933342
nov 201419 k585881266852923012     7433342
out 201419 k582621266442921912     153342
set 201419 k582621266442921912     23342
ago 201419 k578621266442921912     53342
jul 201419 k574621266442921912     20693342
jun 201419 k574621266442921912     5953342
mai 201419 k57462966392821912     13213 42
abr 201418 k57462966382221912     6833 42
mar 201418 k57161966322221912     11183 42
fev 201418 k56961966312221912     6473 42
jan 201418 k56361966312221912     93 42
dez 201318 k55761966312221912     3133 42
nov 201318 k55760966192221912     2003 42
out 201318 k55254966042121912     3923 42
set 201318 k54151866002121912     4063 41
ago 201318 k52349865962121912     133 41
jul 201318 k52049865962121812     593 41
jun 201318 k51749865962121812     3603 41
mai 201318 k51549865962121812     583 41
abr 201318 k51449865782121812     3853 41
mar 201317 k50249865772121812     6603 41
fev 201317 k48647765552021012     1803 4 
jan 201317 k48146765472020812     13 4 
dez 201217 k47946765472020812     143 4 
nov 201217 k47441765262020412     103 4 
out 201217 k47441765262020412     73 4 
set 201217 k46941765262020412     43 4 
ago 201217 k46641765262020412      3 4 
jul 201217 k46241765262020412     83 4 
jun 201217 k45541765262020412     113 4 
mai 201217 k44641765262020412     33 4 
abr 201217 k44241765252020412     103 4 
mar 201217 k43141765242020412     63 4 
fev 201217 k42841765242020312     243 4 
jan 201217 k42241765242020312     73 4 
dez 201117 k41841765242020312      3 4 
nov 201117 k41341765242020312     23 4 
out 201117 k40241765232020312     103 4 
set 201117 k39641765232020312     483 4 
ago 201117 k39141765232019912     163 4 
jul 201117 k38741765192019712     113 4 
jun 201117 k38041765192019712     183 4 
mai 201117 k37641765192019712     153 4 
abr 201117 k37041765172019712     733 4 
mar 201117 k36441765162018012     103 4 
fev 201117 k36341765142018012     33 4 
jan 201117 k35841765132018012     43 4 
dez 201017 k35241765132018012     293 4 
nov 201017 k34641765132018012     2833 4 
out 201017 k34240765122017912     5393 4 
set 201017 k33940765112017912     4773 4 
ago 201017 k33240765102017612     3793 4 
jul 201017 k31740765102017612     8533 4 
jun 201017 k31140765042017612     6303 4 
mai 201017 k30040765042017612     6253 4 
abr 201017 k29840765042017612     4453 4 
mar 201017 k29440765042017612     6413 4 
fev 201017 k29039765002017612     5813 4 
jan 201017 k28637764922014910     3473 4 
dez 200917 k25030764822014110     3963 4 
nov 200917 k24630764822014110     4953 4 
out 200917 k24530764822014110     4273 4 
set 200917 k24229764822013910     4233 4 
ago 200917 k23629764812013910     6323 4 
jul 200917 k23529764812013910     5333 4 
jun 200917 k22929764572013510     3843 4 
mai 200917 k22629764562013510     8223 4 
abr 200917 k22427764562013510     10343 4 
mar 200917 k21527764552013410     28763 4 
fev 200917 k21127764552013410     17563 4 
jan 200916 k20527764542013310     1283 4 
dez 200816 k2042776454201339     53 4 
nov 200816 k2042776454201339     13 4 
out 200816 k1932776454201339     43 4 
set 200816 k1832776454201339     203 4 
ago 200816 k1812776447201339     173 4 
jul 200816 k1762776447201339     43 4 
jun 200816 k1742776447201339     183 4 
mai 200816 k1712676447201339     193 4 
abr 200816 k1642676447201339     643 4 
mar 200816 k1592676447201339     363 4 
fev 200816 k1552676445201339     113 4 
jan 200816 k1542676444201339     143 4 
dez 200716 k1502676444201339     143 4 
nov 200716 k1472676444201329     123 4 
out 200716 k1452676444201329     63 4 
set 200716 k1422676444201329     103 4 
ago 200716 k1402676443201319     23 4 
jul 200716 k1382676443201319     93 4 
jun 200716 k1382676438201319     73 4 
mai 200716 k1362676433201319     33 4 
abr 200716 k1362676433201319     223 4 
mar 200716 k1362676433201309     813 4 
fev 200716 k130257642820859     653 4 
jan 200716 k127197638620739     743 4 
dez 200616 k127187637620719     783 4 
nov 200616 k126177637520699     43 4 
out 200616 k123177637520699     4323 4 
set 200616 k117177637520699     283 4 
ago 200616 k108167637320639     213 4 
jul 200616 k102157636920619     2943 4 
jun 200611 k97157636420609     1693 4 
mai 20064,4 k85157636220599     3113 4 
abr 20064,2 k79137632620529     5663 4 
mar 20062,6 k72137631020518     2393 4 
fev 20061,3 k64137529420508     11113 4 
jan 200689457125522617454     1423 2 
dez 200586224124513615364     912 2 
nov 20058441611441248224     302 2 
out 20058371410441098184     252 2 
set 20058371410441098184     4082 2 
ago 20058361410441078184     472 2 
jul 20058321210441078184     1062 2 
jun 20057841110441078184     252 2 
mai 2005780119431068184     512 2 
abr 2005772109431068174     1522 2 
mar 200570254231021104     39  2 
fev 2005698542399194     461  2 
jan 200537844 39616      451    
dez 2004933 3              
nov 2004833 1              
out 20048 2 1              
set 20048 1 1              
ago 20043 1 1              
jul 20043   1              
jun 20042   1              
mai 20042   1              
abr 20042   1              
mar 20042   1              
fev 20042   1              
jan 20042   1              
dez 20032   1              
nov 20031                  
out 20031                  
set 20031                  
ago 20031                  
jul 20031                  
jun 20031                  

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

jun 2003: 1 1 MTA

set 2003: 1 1 MTA

dez 2003: 1 1 Аборигини

jul 2004: 1 1 Главна страна

set 2004: 1 1 Аверзија

nov 2004: 1 1 Аверзија

dez 2004: 1 1 Абак

jan 2005: 1 2 агора , 2 2 агонија , 3 2 агониста , 4 1 дифамија

fev 2005: 1 2 инструментализам , 2 1 ајгир

mar 2005: 1 1 аграрски

abr 2005: 1 2 Дисимилација , 2 2 Аранђел , 3 2 Авакум , 4 2 Горан , 5 2 среда , 6 1 дисјункција

mai 2005: 1 3 Виконт , 2 2 Виа факти , 3 1 дисјункција

jun 2005: 1 2 изотерма , 2 2 Капо , 3 1 интелигенција

jul 2005: 1 2 троугао , 2 2 столица , 3 1 ложа

ago 2005: 1 2 интелигенција , 2 2 Инкубатор , 3 2 јун , 4 1 дискант

set 2005: 1 3 агора , 2 2 Абукушу , 3 2 абаџија , 4 2 Андрија , 5 1 дифамија

out 2005: 1 2 инсигније , 2 1 дисоцијација

nov 2005: 1 2 беснило , 2 1 Инјектор

dez 2005: 1 3 Главна страна , 2 2 светлети , 3 2 Ваљево , 4 2 Broken/Градови у Црној Гори , 5 1 дисјункција

jan 2006: 1 3 нож , 2 3 авион , 3 2 Релација , 4 2 затварач , 5 2 nóż , 6 2 вечера , 7 2 господ , 8 2 живот , 9 1 терзија

fev 2006: 1 4 државе Европе/Енглески , 2 4 duae , 3 3 државе Европе/Азербејџански , 4 3 државе Европе/Албански , 5 3 meisie , 6 3 eins , 7 3 fast , 8 3 immer , 9 3 Öl , 10 3 Brot , 11 3 Butterbrot , 12 3 octo , 13 3 septem , 14 3 quinque , 15 3 quattuor , 16 3 tria , 17 3 tres , 18 2 државе Европе/Пољски , 19 1 адресанат

mar 2006: 1 3 Тренутни догађаји , 2 3 Бог , 3 3 Главна страна , 4 2 Капо , 5 2 аберација , 6 2 stupid , 7 2 један , 8 2 Боривој , 9 2 Авакум , 10 1 дисјункција

abr 2006: 1 2 дисоцијација , 2 2 Birne , 3 2 глава

mai 2006: 1 2 агониста , 2 2 безграничан , 3 2 бескорисност , 4 1 агонија

jun 2006: 1 2 дистрикт , 2 2 испорука , 3 2 Георгије , 4 1 дисоцијација

jul 2006: 1 2 интелигенција , 2 2 безболан

ago 2006: 1 2 агора , 2 2 Дисимилација

set 2006: 1 1 интервал

out 2006: 1 2 лежарина , 2 2 ave , 3 1 Ležarina

nov 2006: 1 1 Златибор

dez 2006: 1 3 талац , 2 3 престолонаследниковница , 3 2 март

jan 2007: 1 2 столица , 2 1 др.

fev 2007: 1 2 инсомнија , 2 1 фиг.

mar 2007: 1 2 Марко , 2 1 убрендити

abr 2007: 1 2 библиотека , 2 1 авилисантан

mai 2007: 1 1 абнорман

jun 2007: 1 1 indiferentnost

jul 2007: 1 1 Domicil

ago 2007: 1 1 Београд

set 2007: 1 2 Сотер , 2 2 аритметика

out 2007: 1 2 примаријус

nov 2007: 1 2 transparentnost

dez 2007: 1 2 мајстор , 2 2 ушур , 3 1 Мајстор

jan 2008: 1 2 Recesija

fev 2008: 1 3 ректор , 2 1 Ректор

mar 2008: 1 2 Рјечник архаизама

abr 2008: 1 1 Рјечник архаизама

mai 2008: 1 1 Рјечник архаизама

jun 2008: 1 1 Рјечник архаизама

jul 2008: 1 1 Рјечник архаизама

ago 2008: 1 1 Рјечник архаизама

set 2008: 1 1 Рјечник архаизама

out 2008: 1 1 diskinezije

nov 2008: 1 1 Рјечник архаизама

dez 2008: 1 1 Визионар

jan 2009: 1 2 волшебница , 2 2 жрец , 3 2 Мухамед , 4 2 свештеник , 5 1 фалетарица

fev 2009: 1 2 ст. , 2 2 абе , 3 2 двор , 4 2 абракадабра , 5 2 абака , 6 2 Авлија , 7 2 абдицирати , 8 2 universe , 9 2 имам , 10 2 вулкан , 11 1 аблујирати

mar 2009: 1 2 logistika , 2 2 абревијатура , 3 2 им. , 4 2 ж. , 5 2 абортус , 6 2 abnormalan

abr 2009: 1 3 аперцепција , 2 2 Словенија , 3 2 хаван

mai 2009: 1 2 експлоратер , 2 2 Amato , 3 2 Amando , 4 2 Abdieso , 5 2 губа , 6 1 Blaziran

jun 2009: 1 2 Acacio , 2 1 neko

jul 2009: 1 2 џивџан , 2 2 мачка , 3 2 бабине , 4 2 адмирал , 5 1 ахенија

ago 2009: 1 3 биотоп

set 2009: 1 3 морфем , 2 2 носилац

out 2009: 1 2 hakeri , 2 2 адреса

nov 2009: 1 1 морфема

dez 2009: 1 2 ορίστε , 2 1 egzegeza

jan 2010: 1 2 Рјечник архаизама , 2 1 војн.

fev 2010: 1 3 laberint , 2 3 милијарда , 3 2 јул , 4 2 судбина , 5 2 Рјечник архаизама , 6 2 Александра , 7 2 абулија , 8 1 септембар

mar 2010: 1 2 пијаца , 2 2 Naissus , 3 1 Yi+Ze

abr 2010: 1 2 црна , 2 2 кушати , 3 2 Meyer

mai 2010: 1 1 септембар

jun 2010: 1 2 један , 2 1 зидухија

jul 2010: 1 2 биол. , 2 2 ентузијазам , 3 2 в. , 4 2 January

ago 2010: 1 3 Нови Сад , 2 1 Словенија

set 2010: 1 2 Врање , 2 2 TCP , 3 2 CDP , 4 2 RIP , 5 2 EIGRP , 6 1 лажица

out 2010: 1 2 Hassan , 2 1 Варцарка

nov 2010: 1 2 Hassan , 2 2 среда , 3 1 nůž

dez 2010: 1 2 Кина , 2 1 Фјорд

jan 2011: 1 1 Насловна страна

fev 2011: 1 1 Бијоград

mar 2011: 1 1 тахилалија

abr 2011: 1 1 јелен

mai 2011: 1 2 Сребрница , 2 1 Сребреница

jun 2011: 1 2 Београд , 2 1 φαΐ

jul 2011: 1 2 dvanaest

ago 2011: 1 1 שלום

set 2011: 1 1 Ευγενία

out 2011: 1 1 битва

nov 2011: 1 1 Рјечник архаизама

jan 2012: 1 2 Вампир

fev 2012: 1 1 Централна Африка

mar 2012: 1 1 marijana

abr 2012: 1 1 курија

mai 2012: 1 1 Конавли

jun 2012: 1 1 Стрешељ

jul 2012: 1 1 аламан

set 2012: 1 1 Šarlin

out 2012: 1 1 аб

nov 2012: 1 2 Босна и Херцеговина , 2 1 абажур

dez 2012: 1 1 Додатак:Unicode/Арапски

jan 2013: 1 1 пророк

fev 2013: 1 3 نَهْرٌ , 2 3 سَلامٌ , 3 2 مَضِيقُ بَحْرِيٍّ , 4 2 شَعَرٌ , 5 2 حَاجِبٌ , 6 2 لِحْيَةٌ , 7 2 وَجْهٌ , 8 2 أَنْفٌ , 9 2 نِمْرٌ , 10 2 فَمٌ , 11 2 أُذُنٌ , 12 2 لِسَانٌ , 13 1 وادِي

mar 2013: 1 4 أَثَرٌ , 2 3 رِيحٌ , 3 3 أَسَدٌ , 4 3 غَزالَةٌ , 5 3 كَلْبٌ , 6 3 فِيلٌ , 7 3 جَبْهَةٌ , 8 3 عَظَمٌ , 9 3 فَمٌ , 10 3 أُذُنٌ , 11 3 مَسْرَحٌ , 12 3 ثَقَافَةٌ , 13 3 سَلامٌ , 14 3 إِنْسَانٌ , 15 2 شَرْقٌ , 16 2 نَسْرٌ , 17 2 هِلالٌ , 18 2 قَمَرٌ , 19 2 شَمْسٌ , 20 2 ثَدْيٌ , 21 2 صَدْرٌ , 22 2 رِجْلٌ , 23 2 ذِرَاعٌ , 24 1 مُطْرِبٌ

abr 2013: 1 3 صَفٌّ , 2 3 نَشِيدٌ , 3 3 ذَهَبٌ , 4 3 شَرْقٌ , 5 2 إِقْلِيمٌ , 6 2 بَرْجَلٌ , 7 2 عَالَمٌ , 8 2 قُفّازٌ , 9 2 كَنيِسَةٌ , 10 2 مِحْفَظَةٌ , 11 2 لُغَةٌ , 12 2 بَيْتٌ , 13 2 شِهابٌ , 14 2 أَلماسٌ , 15 2 فَحْمٌ , 16 2 زُمُرُّدٌ , 17 2 قُطْبٌ , 18 2 جُغْرافِيا , 19 2 سَهْلٌ , 20 2 مَمْلَكَةٌ , 21 1 قَمِيصٌ

mai 2013: 1 2 كَتَبَ , 2 2 بُرْجٌ , 3 1 نَشِيطٌ

jun 2013: 1 2 بِدَايَةٌ , 2 2 وِكالَةٌ , 3 2 صَنْدُوقٌ , 4 2 شَرِكَةٌ , 5 2 هاتِفٌ , 6 2 حَضَارَةٌ , 7 2 مُحَاضَرَةٌ , 8 2 رَفٌّ , 9 2 وِزارَةٌ , 10 2 مَحْكَمَةٌ , 11 2 فِهْرِسٌ , 12 2 تِلمِيذٌ , 13 2 مَعْدِنٌ , 14 2 مُطْرِبٌ , 15 2 مَكْتَبٌ , 16 1 مَطْعَمٌ

jul 2013: 1 1 وَطَنٌ

ago 2013: 1 1 إِمْبَرَاطُورٌ

set 2013: 1 3 عَظِيمٌ , 2 3 ضَعِفٌ , 3 2 عَمِيقٌ , 4 2 عِمْلاقٌ , 5 2 حزين , 6 2 بَعيدٌ , 7 2 مُتَعَالٍ , 8 2 عَقْلانِيٌّ , 9 2 رَقِيقٌ , 10 2 عَادِلٌ , 11 2 كَسولٌ , 12 2 حَكِيمٌ , 13 1 حَزِينٌ

out 2013: 1 2 ضِفَّةٌ , 2 2 تَجْديدٌ , 3 2 إِيِجابِيٌ , 4 2 تاجِرٌ , 5 2 صَامِتٌ , 6 2 مَسافَةٌ , 7 2 شاعِرٌ , 8 1 وَقُورٌ

nov 2013: 1 2 مِينَاءُ , 2 2 رَقْصَةٌ , 3 1 طَاوِلَةٌ

dez 2013: 1 3 حافَةٌ , 2 2 جانِبٌ , 3 2 جامِعٌ , 4 2 دِينٌ , 5 2 جَنَّةٌ , 6 2 جُمْلَةٌ , 7 2 جَمالٌ , 8 2 جَدْوَلٌ , 9 2 جِدارٌ , 10 2 جارٌ , 11 2 تَمْرِينٌ , 12 2 جِدِّيٌّ , 13 2 تَقْويمٌ , 14 2 تَحْريرٌ , 15 2 تاريخٌ , 16 2 بَنْكٌ , 17 2 بابٌ , 18 2 حِذَاءٌ , 19 2 بَدْلَةٌ , 20 2 تِلمِيذٌ , 21 1 днсонирати

jan 2014: 1 1 حَجْمٌ

fev 2014: 1 3 سورٌ , 2 3 إِنْحِطاطٌ , 3 3 أُمَّةٌ , 4 3 أَهْلٌ , 5 3 إِجْتِمَاعٌ , 6 3 شاعِرٌ , 7 3 مُتَعاطِفٌ , 8 3 أَمْنٌ , 9 3 إِقتِصادٌ , 10 3 إِذَاعَةٌ , 11 3 أَدَبٌ , 12 2 سَلُّمٌ , 13 2 سيجارَةٌ , 14 2 بَطِيخَةٌ , 15 2 حَفْلَةٌ , 16 2 صورَةٌ , 17 2 سُؤالٌ , 18 2 شارِعٌ , 19 2 وَقُورٌ , 20 2 مُسْتَقِرٌّ , 21 2 خَاصٌّ , 22 2 شَيْخٌ , 23 2 رَئِيسٌ , 24 2 بَارِدٌ , 25 2 مُتَأَلِّقٌ

mar 2014: 1 3 لَفْظٌ , 2 3 غُرْفَةٌ , 3 3 صَلاةٌ , 4 3 صَديقٌ , 5 3 أَحْمَرُ , 6 3 جاهِلٌ , 7 3 نَارٌ , 8 2 عَمَلَ , 9 2 صَدَرَ , 10 2 بَلِدَ , 11 2 خَضِلَ , 12 2 سَلَخَ , 13 2 جَمُلَ , 14 2 رَسَمَ , 15 2 غَلَقَ , 16 2 نَظَرَ , 17 2 سَمِعَ , 18 2 فَتَحَ , 19 2 غَيْمٌ , 20 2 سَكَنَ , 21 2 جَلَبَ , 22 2 دَرَسَ , 23 2 لَوْنٌ , 24 2 قَرْنٌ , 25 2 سَلُّمٌ

abr 2014: 1 3 هَجَمَ , 2 2 رَحِمَ , 3 2 ي , 4 2 قَوْمٌ , 5 2 ذَبَحَ , 6 2 تَجَرَ , 7 2 حَذِقَ , 8 2 عَهِدَ , 9 2 مَزَقَ , 10 2 غَلَبَ , 11 2 شَرَعَ , 12 2 خَمَرَ , 13 2 دارٌ , 14 2 صَبَرَ , 15 2 شَغَلَ , 16 2 عَمَلَ , 17 2 صَلَحَ , 18 2 بَلِدَ , 19 2 خَضِلَ , 20 2 حَمَلَ , 21 2 جَمَعَ , 22 2 صَرَفَ , 23 2 خَرَجَ , 24 2 دَخَلَ , 25 2 شَرِبَ

mai 2014: 1 6 أَخْبَرَ , 2 4 شَرِكَ , 3 4 جَمُلَ , 4 4 حَصَدَ , 5 4 حَشَدَ , 6 4 حَسَبَ , 7 4 بَحَثَ , 8 4 حَرَمَ , 9 4 كَسَرَ , 10 4 سَجَدَ , 11 4 عَرَضَ , 12 4 نَظَرَ , 13 4 صَرَفَ , 14 4 بَلَغَ , 15 4 نَشَرَ , 16 4 نَهَضَ , 17 4 كَتَبَ , 18 3 ثَبَتَ , 19 3 بَسَطَ , 20 3 جَدَلَ , 21 3 نَتيجَةٌ , 22 3 سَرَدَ , 23 3 بَذَلَ , 24 3 حَصَلَ , 25 3 نَقَلَ

jun 2014: 1 3 حَيَوانٌ , 2 3 كَتَبَ , 3 2 إِلْزِمْ شُغُلَك , 4 2 رَوْحٌ , 5 2 الله , 6 2 حَياةٌ , 7 2 حائطٌ , 8 2 شَغَلَ , 9 2 سَلُّمٌ , 10 2 جارٌ , 11 2 إِنْحِطاطٌ , 12 2 إِمْتِحانٌ , 13 2 إِمْرَأَةٌ , 14 2 فَخورٌ , 15 1 نبي

jul 2014: 1 3 شَهْرٌ , 2 3 خَفَتَ , 3 3 جِهَةٌ , 4 3 وَقَفَ , 5 3 عَصْرِيٌّ , 6 3 فَحَصَ , 7 3 نَهَضَ , 8 3 نَافِذَةٌ , 9 3 شَعْبِيٌّ , 10 3 شَديدٌ , 11 3 تِلْقَائِيٌّ , 12 3 شَاعِرِيٌّ , 13 3 نَاقِدٌ , 14 3 بَارِدٌ , 15 3 مُتَأَلِّقٌ , 16 3 مُتَهَوِّسٌ , 17 3 سَاخِرٌ , 18 3 أُمَّةٌ , 19 3 مَوْضُوعِيٌّ , 20 3 مُتَوَتَّرٌ , 21 3 ذَوَّاقٌ , 22 3 عَصَبِيٌّ , 23 3 أَصْفَرُ , 24 3 أَسْوَدُ , 25 3 أَزْرَقُ

ago 2014: 1 1 Ogos

set 2014: 1 1 Оџаци

out 2014: 1 1 إِسْمٌ

nov 2014: 1 4 ord , 2 4 bord , 3 4 huvud , 4 3 mann , 5 3 dricka , 6 3 ansikte , 7 3 dörr , 8 3 bror , 9 3 مُتَرْجِمٌ , 10 3 قَهْوَةٌ , 11 3 äpple , 12 3 vatten , 13 3 fågel , 14 3 rum , 15 3 hus , 16 3 fråga , 17 3 hund , 18 2 مُدَّةٌ , 19 2 دَائِرَةٌ , 20 2 أُسْبُوعٌ , 21 2 dum , 22 2 kvinne , 23 2 kone , 24 2 søster , 25 2 gutt

dez 2014: 1 4 läsa , 2 3 ulica , 3 3 leva , 4 3 bröd , 5 3 sol , 6 3 fönster , 7 2 výborný , 8 2 česať , 9 2 أَرْمَلَةٌ , 10 2 byť , 11 2 modrý , 12 2 dobrý , 13 2 d´akovať , 14 2 dom , 15 2 dážď , 16 2 slovensko , 17 2 إِخْلَاصٌ , 18 2 súčasný , 19 2 око , 20 2 hrdina , 21 2 môcť , 22 2 bažant , 23 2 stroj , 24 2 حِكَايَةٌ , 25 2 آخِرَةٌ

jan 2015: 1 2 arbeid , 2 2 forfatter , 3 2 Slovenka , 4 2 slovák , 5 2 slovenčina , 6 2 izba , 7 2 počítač , 8 2 pivnica , 9 2 nedeľa , 10 1 щастя

fev 2015: 1 2 море , 2 1 сорочка

mar 2015: 1 2 حَالَةٌ , 2 2 شَخْصٌ , 3 2 حَبِيسٌ , 4 2 حِفْظٌ , 5 2 بَكِيمٌ , 6 2 بَيْضَةٌ , 7 2 مَحْفُوظٌ , 8 2 ثَابِتٌ , 9 2 ظُفْرٌ , 10 2 حَاسِدٌ , 11 2 plånbok , 12 2 sked , 13 2 förälder , 14 2 heta , 15 2 bokstav , 16 2 بَاسِلٌ

abr 2015: 1 3 سَعِيدٌ , 2 3 حَنَّانٌ , 3 3 تَاجٌ , 4 2 klänning , 5 2 järn , 6 2 nyckelpiga , 7 2 kylskåp , 8 2 handduk , 9 2 vinbär , 10 2 blåbär , 11 2 حَقِيقَةٌ , 12 2 مَرِيضٌ , 13 2 غَلِيظٌ , 14 2 خَالِصٌ , 15 2 مُمْتِعٌ , 16 2 حَرَمٌ , 17 2 تَحْلِيلٌ , 18 2 ظُفْرٌ , 19 2 حَاسِدٌ , 20 2 بَأْسٌ , 21 2 تَيْسٌ , 22 2 تَزَوُّجٌ , 23 2 ألَمٌ , 24 2 رَجْعٌ , 25 2 أَكْلٌ

mai 2015: 1 2 , 2 2 , 3 2 , 4 2 , 5 2 , 6 2 , 7 2 并且 , 8 2 表达 , 9 2 , 10 2 , 11 2 , 12 2 , 13 2 , 14 2 , 15 2 , 16 1

jun 2015: 1 2 إِشْتَجَرَ , 2 2 أَخَذَ , 3 2 أَجِلَ , 4 1 إِكْتَشَفَ

jul 2015: 1 2 بَادَ , 2 2 تَأَخَّرَ , 3 1 أَفْسَدَ

ago 2015: 1 1 حَسِبَ

set 2015: 1 2 видовчица , 2 2 дивља паприка , 3 2 кајсија , 4 2 и , 5 1 шобот

out 2015: 1 2 وَجَدَ , 2 1 είμαι

nov 2015: 1 2 مُرُورٌ , 2 2 صَوْتٌ , 3 1 مدة

dez 2015: 1 3 robota , 2 2 طَابِقٌ , 3 2 مُرْسِلٌ , 4 2 tučný , 5 2 robotnícky , 6 2 literárny , 7 2 celý , 8 2 مُخْتَلِفٌ , 9 2 іграшка , 10 2 обіцянка , 11 2 أُسْطُورَةٌ , 12 2 سَمَكَةٌ , 13 2 طَبَقٌ , 14 2 خَيْمَةٌ , 15 2 hosť , 16 2 bystrý , 17 2 pochod , 18 2 bylina , 19 1 马其顿

Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Quinta-feira, 21 de janeiro 2016 20:37

Dump file srwiktionary-20160111-stub-meta-history.xml.gz (edits only), size 9.0 Mb as gz -> 76 Mb
Dump processed till Dec 31, 2015, on server stat1002, ready at Tue-12/01/2016-11:38 after 1 min, 29 sec.

Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.