Estatísticas da Wikcionário sérvio

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist

Metrics have been collected from a full archive dump, which contains all revisions of every article, meta data and raw content.
See also metrics definitions


 
Monthly counts & Quarterly rankings: junho 2014
 
DataWikcionaristasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
jun 20140%   0%   -46%0%0%+3%0%0%0%+4%
mai 20140%   0%   +79%+1%+1%+7%0%+4%+3%+5%
abr 20140%   +1%   -38%+2%+3%+8%+1%+11%+10%0%
mar 2014+4%   +1%   +68%+1%+2%+18%0%+10%0%+1%
fev 2014+4%   0%   +261%0%0%+6%0%+1%0%+1%
jan 20140%   0%   -75%0%0%0%0%0%0%0%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
jun 201455 4217 k 5,455172923 Mb1,2 M28 k84 k1,3 k681,5 k
mai 201455 9417 k25,35491,3 k23 Mb1,2 M27 k84 k1,3 k681,5 k
abr 201455 9217 k55,354274923 Mb1,2 M25 k83 k1,3 k661,4 k
mar 20145529317 k35,35321,2 k22 Mb1,2 M23 k83 k1,1 k601,4 k
fev 20145329217 k 5,352571422 Mb1,2 M20 k83 k1,0 k601,4 k
jan 201451   17 k 5,252419822 Mb1,2 M19 k83 k1,0 k601,4 k
dez 201351 7117 k15,252378822 Mb1,2 M19 k82 k1,0 k601,4 k
nov 201351 5 17 k25,252120622 Mb1,1 M18 k81 k994601,4 k
out 20135116117 k45,251840722 Mb1,1 M18 k81 k947591,4 k
set 201350 6117 k65,251150521 Mb1,1 M18 k81 k880591,3 k
ago 201350 1 16 k 5,250415321 Mb1,1 M18 k81 k867591,3 k
jul 201350 2 16 k15,25039621 Mb1,1 M18 k80 k860591,3 k
jun 201350 5116 k15,250239821 Mb1,1 M18 k80 k844591,3 k
mai 201350 3 16 k15,25019221 Mb1,1 M18 k80 k831591,2 k
abr 201350 7116 k35,249943921 Mb1,1 M18 k80 k814591,2 k
mar 20135018216 k45,24951,4 k21 Mb1,1 M18 k80 k733591,2 k
fev 20134967 16 k25,148934120 Mb1,0 M18 k79 k606591,1 k
jan 201343   16 k 5,148688820 Mb1,0 M18 k79 k538591,1 k
dez 20124311 16 k 5,148622320 Mb1,0 M18 k78 k538591,1 k
nov 201242 1 16 k 5,148673420 Mb1,0 M18 k77 k538591,1 k
out 201242   16 k 548612020 Mb1,0 M18 k76 k532591,1 k
set 201242   16 k 548618320 Mb1,0 M18 k76 k532591,1 k
ago 201242   16 k 548559520 Mb1,0 M18 k76 k532501,1 k
jul 201242 1 16 k 548514120 Mb1,0 M18 k75 k532501,1 k
jun 201242 1 16 k 548513120 Mb1,0 M18 k75 k529501,1 k
mai 201242   16 k 4,948528320 Mb1,0 M18 k75 k528501,1 k
abr 201242 2 16 k 4,948532320 Mb1,0 M18 k75 k527501,1 k
mar 201242   16 k 4,948543520 Mb1,0 M18 k74 k527501,1 k
fev 20124211 16 k 4,948545720 Mb1,0 M18 k74 k526501,1 k
jan 201241 1 16 k 4,948577320 Mb1,0 M18 k73 k521501,1 k
dez 201141   16 k 4,84851,4 k20 Mb1,0 M18 k72 k520501,1 k
nov 201141   16 k 4,748517220 Mb1,0 M18 k70 k520501,1 k
out 201141 1 16 k 4,748528220 Mb1,0 M18 k70 k520501,1 k
set 201141 2 16 k14,748518120 Mb1,0 M18 k69 k520501,1 k
ago 20114111 16 k 4,748516620 Mb1,0 M18 k69 k519501,1 k
jul 201140   16 k 4,748515520 Mb1,0 M18 k68 k519501,1 k
jun 20114011 16 k 4,748587020 Mb1,0 M18 k68 k517501,1 k
mai 201139 2 16 k 4,648532720 Mb1,0 M18 k67 k516471,1 k
abr 20113911 16 k 4,648534220 Mb1,0 M18 k66 k514471,1 k
mar 201138 1 16 k 4,648527720 Mb1,0 M18 k66 k514471,0 k
fev 201138   16 k 4,648541220 Mb1,0 M18 k66 k514471,0 k
jan 201138   16 k 4,548524120 Mb1,0 M18 k65 k513471,0 k
dez 201038   16 k 4,548553720 Mb1,0 M18 k65 k513471,0 k
nov 20103823116 k 4,548529220 Mb1,0 M18 k64 k513471,0 k
out 201036 1116 k 4,548554520 Mb1,0 M18 k64 k512471,0 k
set 20103623116 k14,448547920 Mb1,0 M18 k63 k512471,0 k
ago 201034 2116 k 4,448540120 Mb1,0 M18 k63 k512471,0 k
jul 20103413116 k 4,448586420 Mb1,0 M18 k62 k512471,0 k
jun 201033 1116 k 4,348863720 Mb1,0 M17 k62 k512451,0 k
mai 201033 1116 k 4,348863220 Mb1,0 M17 k61 k512451,0 k
abr 201033 1116 k 4,348845220 Mb1,0 M17 k61 k511451,0 k
mar 201033 3116 k 4,248813 k20 Mb1,0 M17 k60 k511451,0 k
fev 201033 2116 k 3,449059821 Mb1,0 M17 k59 k510451,0 k
jan 201033 2116 k 3,349035121 Mb1,0 M17 k59 k509451,0 k
dez 20093312116 k 3,349041021 Mb1,0 M17 k59 k509441,0 k
nov 200932 1116 k 3,349050121 Mb1,0 M17 k58 k509431,0 k
out 200932 1116 k 3,349043321 Mb1,0 M17 k58 k509431,0 k
set 20093213116 k 3,249042321 Mb1,0 M17 k57 k509421,0 k
ago 200931 1116 k 3,249063321 Mb1,0 M17 k57 k509331,0 k
jul 20093113116 k 3,24902,4 k21 Mb1,0 M17 k56 k509331,0 k
jun 200930 2116 k 349238821 Mb1,0 M17 k56 k507321,0 k
mai 20093012116 k 349283221 Mb1,0 M17 k55 k507321,0 k
abr 200929 2116 k 2,94921,1 k21 Mb1,0 M17 k55 k507321,0 k
mar 20092912116 k 2,94912,9 k21 Mb1,0 M17 k54 k507321,0 k
fev 20092823216 k102,74891,8 k21 Mb1,0 M16 k50 k50732998
jan 20092612116 k22,645226819 Mb992 k15 k49 k50734527
dez 200825   15 k 2,645011619 Mb985 k15 k49 k50730527
nov 200825   15 k 2,645011819 Mb985 k15 k49 k50730526
out 200825   15 k 2,645017519 Mb985 k15 k49 k50730526
set 20082512 15 k 2,645031319 Mb985 k15 k48 k50730526
ago 200824 1 15 k 2,644965319 Mb984 k15 k48 k50730526
jul 200824   15 k 2,544942919 Mb984 k15 k48 k50730526
jun 200824 1 15 k 2,54491,0 k19 Mb984 k15 k47 k50830526
mai 200824 2 15 k 2,44491,2 k19 Mb984 k15 k46 k50830526
abr 200824 1 15 k 2,444914019 Mb983 k15 k44 k50830526
mar 20082411 15 k 2,444917619 Mb983 k15 k44 k50830526
fev 200823 1 15 k 2,344823119 Mb980 k15 k44 k50829526
jan 200823 1 15 k 2,344845619 Mb980 k15 k44 k50829524
dez 200723   15 k 2,344815719 Mb980 k15 k43 k50826524
nov 20072311 15 k 2,34485619 Mb979 k15 k43 k50825523
out 2007221  15 k 2,344812919 Mb979 k15 k43 k50825523
set 200721 1 15 k 2,34487719 Mb979 k15 k42 k50825523
ago 200721   15 k 2,34484819 Mb979 k15 k42 k50825523
jul 200721 1 15 k 2,344874519 Mb979 k15 k42 k50825523
jun 200721 1 15 k 2,24474019 Mb979 k15 k41 k50825523
mai 200721   15 k 2,24471,2 k19 Mb979 k15 k41 k50825523
abr 200721 2 15 k 2,144769019 Mb979 k15 k40 k50825523
mar 20072113 15 k 2,144732219 Mb979 k15 k40 k50825523
fev 200720 2 15 k 2,144750519 Mb978 k15 k39 k50825522
jan 200720 1 15 k 244775119 Mb977 k15 k39 k50825522
dez 20062012 15 k 24471,2 k19 Mb976 k15 k38 k50825521
nov 200619   15 k 1,944756619 Mb976 k15 k37 k50825518
out 200619 3215 k 1,94471,4 k19 Mb976 k15 k37 k50825518
set 200619   15 k 1,84471,0 k19 Mb975 k15 k36 k50823517
ago 200619 2 15 k 1,744755419 Mb975 k15 k35 k50822517
jul 200619 1115 k1451,74478,7 k19 Mb974 k15 k34 k49322517
jun 200619 4111 k2311,64508,6 k14 Mb697 k10 k26 k49322462
mai 2006191314,0 k82,26081,0 k8,3 Mb350 k3,2 k18 k49323459
abr 200618 213,7 k522,16102,0 k8,0 Mb327 k2,9 k16 k49322456
mar 2006183312,2 k402,76211,8 k4,5 Mb187 k2,3 k8,5 k49322444
fev 20061517194624,35471,3 k1,2 Mb64 k2,1 k3,4 k49119395
jan 20061423 88913,15261971,1 Mb57 k1,4 k2,7 k5128
dez 20051224 858 2,95165101,0 Mb54 k1,3 k2,7 k497
nov 200510 2 844 2,451648978 kb53 k1,1 k2,4 k256
out 200510 1 838 2,351251959 kb52 k1,1 k2,3 k245
set 200510111838 2,3512427958 kb52 k1,1 k2,3 k245
ago 2005912 836 1,8511101949 kb51 k1,1 k2,3 k125
jul 2005814 83421,7509132939 kb51 k1,0 k2,2 k125
jun 2005712 786 1,646633797 kb44 k1,0 k1,6 k115
mai 2005613 782 1,646166778 kb43 k9951,6 k115
abr 2005512177521,5452168752 kb42 k9951,5 k114
mar 20054 2 706 1,439243569 kb33 k965692113
fev 20054121702111,3393466566 kb33 k954674113
jan 20053231383121,2122452122 kb6,3 k38743111
dez 20041   7 3,119634,4 kb179175 1 
nov 20041   7 2,719343,4 kb177165 1 
out 20041   6 2,5260 3,7 kb194145 1 
set 20041   6 2,526063,7 kb194145 1 
ago 20041   3 3444 2,5 kb165115 1 
jul 20041   3 344422,5 kb165115 1 
jun 20041   2 3,5183 775 5165   
mai 20041   2 3,5183 775 5165   
abr 20041   2 3,5183 775 5165   
mar 20041   2 3,51831775 5165   
fev 20041   2 3184 734 5164   
jan 20041   2 3184 734 5164   
dez 20031   2 31842734 5164   
nov 20031   1 4126 277 1823   
out 20031   1 41261277 1823   
set 20031   1 31281280 1823   
ago 20031   1 2128 214 182    
jul 20031   1 21281214 182    
jun 200311  1 11521264 25     
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
The following table ranks this project in relation to projects in other languages with 1000+ articles
abr 2014423220286235621441444765703166116
jan 2014424385496057641585434873703670116
out 2013423424395838641555414771703670116
jul 2013423955515760621793414770683768116
abr 2013423623455751611863404769673766116
jan 2013454379545667621661404867664665116
out 2012453376485459611592404766654764116
jul 2012444570515264561585404666634565116
abr 2012424056525266581574384466634265116
jan 2012423564495260551558374266634165116
out 2011414072485170551482364064593965116
jul 2011414481494865541578363964573865116
abr 2011413165444759581773333864573764116
jan 2011413475504561541871313664553759116
out 2010413588684361571864303362543658116
jul 2010413954743964591861293160523456116
abr 2010414585703957611869293159503457116
jan 2010413166673859681564273058503457116
out 2009413879643657661461272957493256116
jul 2009403852663460621235242952453256116
abr 2009414760653351651249212751442957116
jan 2009415359413145611356202550412956116
out 2008413672423061591155202549382854115
jul 2008412967443056621254192548362752115
abr 2008404263482961571261172344332550115
jan 2008394262512758591057151941322447115
out 200736327248256056863131737302347115
jul 200735406043245457938121533281950115
abr 200729405546226054949111332281646115
jan 200727456243206250644111329271348115
out 200624364126185147633101028231044115
jul 20062338573315643614782518741115
abr 200621383831268375227124122643115
jan 2006231930343640363640263243303142108
out 200524324326313530304723264027385499
jul 200524292025292726263720223722365894
abr 200532222420212320202315203019325987
jan 200539101618231015151524283339245677
out 200456242816422010105245484345194966
jul 2004461826103716443739383432163850
abr 200419785155331413141277819
jan 200416443113221010101074916
out 200314332132221010101064614
jul 20031354312322101091074613
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100ediçõesbytes
 WikcionaristasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikcionaristas (usuários registrados)
A = Wikcionaristas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikcionaristas que editaram pelo menos dez vezes desde que chegaram
C = Wikcionaristas que contribuíram cinco vezes ou mais este mês
D = Wikcionaristas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  2500  5  10  100  1000  10000  1  3  5  10  25  5  1  3  5  10  25  100  5  10 
Monthly counts for recent history of wiki
jun 201411544421  111        7543    
mai 201411998641  11         108842   
abr 20141099982   11   1     169973   
mar 201411999931  11   2     148871   
fev 2014101097621  11   1     8211    
jan 201442     221  1     10211    
dez 2013877651   221  3     155322   
nov 2013107543        1     198754   
out 2013866661        1     179873   
set 2013996641   11   32    1711876   
ago 20134111    221  1     311     
jul 201332221   11         6431    
jun 2013765411              10531    
mai 201394331   11   22   1117321 1 
abr 20131087731   32   2     118633   
mar 2013988872   331  411   1210984111
fev 201387764   221  3     12887    
jan 20131      441        5     11
dez 20123111    33   2     73221   
nov 2012421     441        2     11
out 201232     33         71    11
set 201221     331        311     
ago 2012       221  3     611     
jul 2012211     111        101    1 
jun 2012311     44         211     
mai 20123      331  1     6       
abr 2012222     331  11    6332    
mar 20125      332  2     6221    
fev 20123111    221  1     6211    
jan 2012311     442        211   31
Quarterly counts for entire history of wiki
abr 20141099982   11   1     169973   
jan 201442     221  1     10211    
out 2013866661        1     179873   
jul 201332221   11         6431    
abr 20131087731   32   2     118633   
jan 20131      441        5     11
out 201232     33         71    11
jul 2012211     111        101    1 
abr 2012222     331  11    6332    
jan 2012311     442        211   31
out 2011321     331  11    611   11
jul 201152     111  2     411     
abr 201132111   221  2     62211   
jan 20111      221  1     61      
out 20105111111       11    7321    
jul 20103332211       2     2222    
abr 20104211111       1     731   11
jan 20104322111       3     422211  
out 20096311111       21    411     
jul 20094333211  2111 1     5222  1 
abr 200974221111 1    1     421     
jan 2009732111   22   1     5321  11
out 20082      221  1     422     
jul 20083      332  1     5       
abr 200811111   11   3     6       
jan 2008321     222  2     6       
out 20074      111  1111  31      
jul 2007321     111        221     
abr 20074321    111  1111  2111    
jan 200722111   111  1111  11111   
out 2006633332   111  3111  311     
jul 2006511111   2222 411   62111122
abr 200611322111  111  411   53311   
jan 2006105333   22   43221 744221  
out 20058211         11            
jul 2005126411   11   1     2       
abr 2005622111        3221  42221   
jan 20055332211       3111  211111  
out 2004                          
jul 20041                         
abr 2004                          
jan 2004                          
out 2003                          
jul 2003                          

 

Distribuição de edições de artigos por wikcionaristas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikcionaristasEdições total
1224100.0%29,687100.0%
39542.4%29,48299.3%
105524.6%29,25898.6%
323013.4%28,78697.0%
100229.8%28,36495.5%
316135.8%26,72090.0%
100083.6%24,15681.4%
316210.4%13,57945.7%
1000010.4%13,57945.7%

 

11 wikcionaristas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions
agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
Bubbah63UC2 02,168285301-fev 15, 2013499240-4-
Linos MimiUC6 01,37014932210fev 15, 201349915933-
Mickey MystiqueUC7+11,20011626021fev 15, 20134991244597
The Milica TomovicUC8-11,0904174-fev 15, 2013499162-2-
ImperatorkAUC12 0395311777fev 18, 201349662-4-
FunakoshiUC16 0224251-out 02, 201327062-1-
MikyMUC26 05121992ago 30, 201110347177-
CommonsDelinkerUC38+221216-set 02, 20072492----
Kolega2357UC113+1003211-abr 23, 2013432--2-
AKA MBGUC222...11--jun 02, 201427----
Скарлет О'ХараUC223...11--jun 24, 20145----

 

20 wikcionaristas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
InterwicketUC113,579jan 27, 20091979nov 08, 20101329
KasterUC31,687jan 27, 20053440nov 15, 2012591
KadzoUC41,540jan 11, 20091995abr 03, 20091913
Crveni BaronUC51,522nov 19, 20053144jul 25, 20062896
GolijaUC9437jan 19, 20053448ago 14, 20053241
SrBotUC10415set 09, 20053215out 04, 20053190
SashatoUC11397dez 19, 20053114dez 19, 20053114
Taychy2110UC13277dez 14, 2013197mai 24, 201436
PoletanicaUC14241fev 15, 2013499set 28, 2013274
Саша СтефановићUC15235dez 24, 20053109jan 12, 20091994
DungodungUC17172mai 11, 20053336set 19, 20101379
GojkommUC18160mar 25, 20082287nov 12, 2011960
Bahar073UC19115fev 15, 2014134mai 24, 201436
SmilingsammyUC20112fev 27, 2014122mai 19, 201441
TheStefan12345UC21108mar 17, 2013469mai 31, 2013394
Zarathushtra1111UC2273jul 12, 20101448ago 11, 20101418
BudelbergerUC2368abr 01, 20111185abr 02, 20111184
XoristzatzikiUC2466set 19, 20101379jan 17, 2013528
SmirnofLearyUC2552set 07, 20101391out 02, 20101366
RastkoUC2743dez 22, 20053111jan 15, 20063087

 

usuários anônimos, ordenados por número de contribuições
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
84.167.135.1831469
84.167.149.251812
87.202.155.185171
82.181.204.11626
109.92.39.10926
178.148.1.3725
109.93.174.8424
62.1.33.5924
147.251.242.16621
80.93.247.1420

No total 3.317 edições foram feitas por usuários anônimos, de um total de 91.915 edições ( 3e %)
  


18 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
СлоботUC114,672jul 14, 20091811mar 26, 20101556--
CrveniBaronBotUC213,762mar 04, 20063039jul 23, 2006289811,260-
RobotGMwiktUC313,721jul 21, 20053265jun 06, 20082214--
Luckas-botUC44,967mar 03, 20091944jan 27, 2014153--
KamikazeBotUC54,524dez 17, 20101290mar 07, 2013479--
VolkovBotUC62,574ago 20, 20072505abr 05, 2013450--
SpaceBirdyBotUC71,324jun 23, 20082197dez 30, 20091642--
BodhisattvaBotUC81,216fev 02, 20082339ago 19, 20082140--
YS-BotUC9864set 07, 2012660jun 29, 2014---
AvocatoBotUC10843out 27, 2011976ago 28, 2013305--
MonoBotUC11217jan 17, 20082355jun 14, 20082206--
Makecat-botUC1284nov 10, 2012596abr 05, 2013450--
FelixBotUC1362dez 16, 20053117jun 14, 20062937--
CarsracBotUC1444dez 22, 2012554mai 21, 2013404--
AibotUC157mai 13, 20082238jun 13, 20082207--
GetoBotUC162fev 08, 20063063fev 08, 20063063--
EscarbotUC171set 02, 20062857set 02, 20062857--
JAnDbotUC181jun 10, 2012749jun 10, 2012749--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110JpgOggPngSvg
jun 201419 k73062122536522922812     5953342
mai 201419 k7306292536472822812     13213 42
abr 201418 k7306292536462222812     6833 42
mar 201418 k7256192536402222812     11183 42
fev 201418 k7226192536392222812     6473 42
jan 201418 k7146192536392222812     93 42
dez 201318 k7016192536392222812     3133 42
nov 201318 k6966092526272222812     2033 42
out 201318 k6875492526122122812     3923 42
set 201318 k6735182526082122812     4063 41
ago 201318 k6434982526042122812     143 41
jul 201318 k6394982526042122712     593 41
jun 201318 k6354982526042122712     3603 41
mai 201318 k6324982526042122712     593 41
abr 201318 k6314982525862122712     3853 41
mar 201317 k6184982525852122712     6613 41
fev 201317 k6004772525632021812     1803 4 
jan 201317 k5924672525552021612     13 4 
dez 201217 k5874672525552021612     143 4 
nov 201217 k5814172525342021212     103 4 
out 201217 k5804172525342021212     73 4 
set 201217 k5754172525342021212     43 4 
ago 201217 k5704172525342021212      3 4 
jul 201217 k5594172525342021212     83 4 
jun 201217 k5504172525342021212     113 4 
mai 201217 k5394172525342021212     33 4 
abr 201217 k5334172525332021212     103 4 
mar 201217 k5164172525322021212     63 4 
fev 201217 k5094172525322021112     243 4 
jan 201217 k4944172525322021112     73 4 
dez 201117 k4874172525322021112      3 4 
nov 201117 k4824172525322021112     23 4 
out 201117 k4704172525312021112     103 4 
set 201117 k4614172525312021112     483 4 
ago 201117 k4554172525312020712     163 4 
jul 201117 k4484172525272020512     113 4 
jun 201117 k4364172525272020512     183 4 
mai 201117 k4314172525272020512     153 4 
abr 201117 k4214172525252020512     733 4 
mar 201117 k4114172525242018812     103 4 
fev 201117 k4104172525222018812     33 4 
jan 201117 k4014172525212018812     43 4 
dez 201017 k3934172525212018812     293 4 
nov 201017 k3864172525212018812     2833 4 
out 201017 k3804072525202018612     5393 4 
set 201017 k3764072525192018612     4773 4 
ago 201017 k3694072525182018312     3793 4 
jul 201017 k3534072525182018312     8533 4 
jun 201017 k3474072525122018312     6303 4 
mai 201017 k3254072525122018312     6253 4 
abr 201017 k3224072525122018312     4453 4 
mar 201017 k3144072525122018312     6413 4 
fev 201017 k3103972525082018312     5813 4 
jan 201017 k3063772525002015310     3473 4 
dez 200917 k2683072524902014510     3963 4 
nov 200917 k2643072524902014510     4953 4 
out 200917 k2633072524902014510     4273 4 
set 200917 k2592972524902014310     4233 4 
ago 200917 k2512972524892014310     6323 4 
jul 200917 k2502972524892014310     5333 4 
jun 200917 k2442972524652013910     3843 4 
mai 200917 k2412972524642013910     8223 4 
abr 200917 k2382772524642013910     10343 4 
mar 200917 k2272772524632013710     28763 4 
fev 200917 k2202772524632013710     17563 4 
jan 200916 k2142772524622013610     1283 4 
dez 200816 k213277252462201369     53 4 
nov 200816 k213277252462201369     13 4 
out 200816 k197277252462201369     43 4 
set 200816 k187277252462201369     203 4 
ago 200816 k185277252455201369     173 4 
jul 200816 k180277252455201369     43 4 
jun 200816 k177277252455201369     183 4 
mai 200816 k174267252455201369     193 4 
abr 200816 k167267252455201369     643 4 
mar 200816 k162267252455201369     363 4 
fev 200816 k157267252453201369     113 4 
jan 200816 k155267252452201369     143 4 
dez 200716 k151267252452201369     143 4 
nov 200716 k148267252452201359     123 4 
out 200716 k146267252452201359     63 4 
set 200716 k143267252452201359     103 4 
ago 200716 k141267252451201349     23 4 
jul 200716 k139267252451201349     93 4 
jun 200716 k139267252446201349     73 4 
mai 200716 k137267252441201349     33 4 
abr 200716 k137267252441201339     223 4 
mar 200716 k137267252441201329     813 4 
fev 200716 k13125725243620879     653 4 
jan 200716 k12819725238920759     743 4 
dez 200616 k12818725237920739     783 4 
nov 200616 k12717725237820719     43 4 
out 200616 k12417725137820719     4333 4 
set 200616 k11817725137820719     283 4 
ago 200616 k10916725137620659     213 4 
jul 200616 k10315725137220639     2943 4 
jun 200611 k9815718936720629     1693 4 
mai 20064,4 k8615718836520619     3113 4 
abr 20064,2 k8013718732820549     5663 4 
mar 20062,6 k7313716631020538     2393 4 
fev 20061,3 k6513714529420528     11133 4 
jan 20068975812513722617474     1423 2 
dez 20058652412413413615374     952 2 
nov 2005847161141081248224     302 2 
out 200584014104741098184     252 2 
set 200584014104741098184     4092 2 
ago 200583914104731078184     472 2 
jul 200583512104721078184     1062 2 
jun 200578711104721078184     252 2 
mai 20057831194711068184     512 2 
abr 20057751094711068174     1522 2 
mar 2005705542711021104     39  2 
fev 20057015427199194     464  2 
jan 200537944 719616      452    
dez 2004933 71              
nov 2004833 49              
out 20048 2 49              
set 20048 1 49              
ago 20043 1 49              
jul 20043   49              
jun 20042   49              
mai 20042   36              
abr 20042   36              
mar 20042   36              
fev 20042   36              
jan 20042   35              
dez 20032   31              
nov 20031                  
out 20031                  
set 20031                  
ago 20031                  
jul 20031                  
jun 20031                  

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

jun 2003: 1 1 MTA

set 2003: 1 1 MTA

dez 2003: 1 1 Аборигини

jul 2004: 1 1 Главна страна

set 2004: 1 1 Аверзија

nov 2004: 1 1 Аверзија

dez 2004: 1 1 Абак

jan 2005: 1 2 агора , 2 2 агонија , 3 2 агониста , 4 1 дифамија

fev 2005: 1 2 инструментализам , 2 1 ајгир

mar 2005: 1 1 аграрски

abr 2005: 1 2 Дисимилација , 2 2 Аранђел , 3 2 Авакум , 4 2 Горан , 5 2 среда , 6 1 дисјункција

mai 2005: 1 3 Виконт , 2 2 Виа факти , 3 1 дисјункција

jun 2005: 1 2 изотерма , 2 2 Капо , 3 1 интелигенција

jul 2005: 1 2 троугао , 2 2 столица , 3 1 ложа

ago 2005: 1 2 интелигенција , 2 2 Инкубатор , 3 2 јун , 4 1 дискант

set 2005: 1 3 агора , 2 2 Абукушу , 3 2 абаџија , 4 2 Андрија , 5 1 дифамија

out 2005: 1 2 инсигније , 2 1 дисоцијација

nov 2005: 1 2 беснило , 2 1 Инјектор

dez 2005: 1 3 Главна страна , 2 2 светлети , 3 2 Ваљево , 4 2 Broken/Градови у Црној Гори , 5 1 дисјункција

jan 2006: 1 3 нож , 2 3 авион , 3 2 Релација , 4 2 затварач , 5 2 nóż , 6 2 вечера , 7 2 господ , 8 2 живот , 9 1 терзија

fev 2006: 1 4 државе Европе/Енглески , 2 4 duae , 3 3 државе Европе/Азербејџански , 4 3 државе Европе/Албански , 5 3 meisie , 6 3 eins , 7 3 fast , 8 3 immer , 9 3 Öl , 10 3 Brot , 11 3 Butterbrot , 12 3 octo , 13 3 septem , 14 3 quinque , 15 3 quattuor , 16 3 tria , 17 3 tres , 18 2 државе Европе/Пољски , 19 1 адресанат

mar 2006: 1 3 Тренутни догађаји , 2 3 Бог , 3 3 Главна страна , 4 2 Капо , 5 2 аберација , 6 2 stupid , 7 2 један , 8 2 Боривој , 9 2 Авакум , 10 1 дисјункција

abr 2006: 1 2 дисоцијација , 2 2 Birne , 3 2 глава

mai 2006: 1 2 агониста , 2 2 безграничан , 3 2 бескорисност , 4 1 агонија

jun 2006: 1 2 дистрикт , 2 2 испорука , 3 2 Георгије , 4 1 дисоцијација

jul 2006: 1 2 интелигенција , 2 2 безболан

ago 2006: 1 2 агора , 2 2 Дисимилација

set 2006: 1 1 интервал

out 2006: 1 2 лежарина , 2 2 ave , 3 1 Ležarina

nov 2006: 1 1 Златибор

dez 2006: 1 3 талац , 2 3 престолонаследниковница , 3 2 март

jan 2007: 1 2 столица , 2 1 др.

fev 2007: 1 2 инсомнија , 2 1 фиг.

mar 2007: 1 2 Марко , 2 1 убрендити

abr 2007: 1 2 библиотека , 2 1 авилисантан

mai 2007: 1 1 абнорман

jun 2007: 1 1 indiferentnost

jul 2007: 1 1 Domicil

ago 2007: 1 1 Београд

set 2007: 1 2 Сотер , 2 2 аритметика

out 2007: 1 2 примаријус

nov 2007: 1 2 transparentnost

dez 2007: 1 2 мајстор , 2 2 ушур , 3 1 Мајстор

jan 2008: 1 2 Recesija

fev 2008: 1 3 ректор , 2 1 Ректор

mar 2008: 1 2 Рјечник архаизама

abr 2008: 1 1 Рјечник архаизама

mai 2008: 1 1 Рјечник архаизама

jun 2008: 1 1 Рјечник архаизама

jul 2008: 1 1 Рјечник архаизама

ago 2008: 1 1 Рјечник архаизама

set 2008: 1 1 Рјечник архаизама

out 2008: 1 1 diskinezije

nov 2008: 1 1 Рјечник архаизама

dez 2008: 1 1 Визионар

jan 2009: 1 2 волшебница , 2 2 жрец , 3 2 Мухамед , 4 2 свештеник , 5 1 фалетарица

fev 2009: 1 2 ст. , 2 2 абе , 3 2 двор , 4 2 абракадабра , 5 2 абака , 6 2 Авлија , 7 2 абдицирати , 8 2 universe , 9 2 имам , 10 2 вулкан , 11 1 аблујирати

mar 2009: 1 2 logistika , 2 2 абревијатура , 3 2 им. , 4 2 ж. , 5 2 абортус , 6 2 abnormalan

abr 2009: 1 3 аперцепција , 2 2 Словенија , 3 2 хаван

mai 2009: 1 2 експлоратер , 2 2 Amato , 3 2 Amando , 4 2 Abdieso , 5 2 губа , 6 1 Blaziran

jun 2009: 1 2 Acacio , 2 1 neko

jul 2009: 1 2 џивџан , 2 2 мачка , 3 2 бабине , 4 2 адмирал , 5 1 ахенија

ago 2009: 1 3 биотоп

set 2009: 1 3 морфем , 2 2 носилац

out 2009: 1 2 hakeri , 2 2 адреса

nov 2009: 1 1 морфема

dez 2009: 1 2 ορίστε , 2 1 egzegeza

jan 2010: 1 2 Рјечник архаизама , 2 1 војн.

fev 2010: 1 3 laberint , 2 3 милијарда , 3 2 јул , 4 2 судбина , 5 2 Рјечник архаизама , 6 2 Александра , 7 2 абулија , 8 1 септембар

mar 2010: 1 2 пијаца , 2 2 Naissus , 3 1 Yi+Ze

abr 2010: 1 2 црна , 2 2 кушати , 3 2 Meyer

mai 2010: 1 1 септембар

jun 2010: 1 2 један , 2 1 зидухија

jul 2010: 1 2 биол. , 2 2 ентузијазам , 3 2 в. , 4 2 January

ago 2010: 1 3 Нови Сад , 2 1 Словенија

set 2010: 1 2 Врање , 2 2 TCP , 3 2 CDP , 4 2 RIP , 5 2 EIGRP , 6 1 лажица

out 2010: 1 2 Hassan , 2 1 Варцарка

nov 2010: 1 2 Hassan , 2 2 среда , 3 1 nůž

dez 2010: 1 2 Кина , 2 1 Фјорд

jan 2011: 1 1 Насловна страна

fev 2011: 1 1 Бијоград

mar 2011: 1 1 тахилалија

abr 2011: 1 1 јелен

mai 2011: 1 2 Сребрница , 2 1 Сребреница

jun 2011: 1 2 Београд , 2 1 φαΐ

jul 2011: 1 2 dvanaest

ago 2011: 1 1 שלום

set 2011: 1 1 Ευγενία

out 2011: 1 1 битва

nov 2011: 1 1 Рјечник архаизама

jan 2012: 1 2 Вампир

fev 2012: 1 1 Централна Африка

mar 2012: 1 1 marijana

abr 2012: 1 1 курија

mai 2012: 1 1 Конавли

jun 2012: 1 1 Стрешељ

jul 2012: 1 1 аламан

set 2012: 1 1 Šarlin

out 2012: 1 1 аб

nov 2012: 1 2 Босна и Херцеговина , 2 1 абажур

dez 2012: 1 1 Додатак:Unicode/Арапски

jan 2013: 1 1 пророк

fev 2013: 1 3 نَهْرٌ , 2 3 سَلامٌ , 3 2 مَضِيقُ بَحْرِيٍّ , 4 2 شَعَرٌ , 5 2 حَاجِبٌ , 6 2 لِحْيَةٌ , 7 2 وَجْهٌ , 8 2 أَنْفٌ , 9 2 نِمْرٌ , 10 2 فَمٌ , 11 2 أُذُنٌ , 12 2 لِسَانٌ , 13 1 وادِي

mar 2013: 1 4 أَثَرٌ , 2 3 رِيحٌ , 3 3 أَسَدٌ , 4 3 غَزالَةٌ , 5 3 كَلْبٌ , 6 3 فِيلٌ , 7 3 جَبْهَةٌ , 8 3 عَظَمٌ , 9 3 فَمٌ , 10 3 أُذُنٌ , 11 3 مَسْرَحٌ , 12 3 ثَقَافَةٌ , 13 3 سَلامٌ , 14 3 إِنْسَانٌ , 15 2 شَرْقٌ , 16 2 نَسْرٌ , 17 2 هِلالٌ , 18 2 قَمَرٌ , 19 2 شَمْسٌ , 20 2 ثَدْيٌ , 21 2 صَدْرٌ , 22 2 رِجْلٌ , 23 2 ذِرَاعٌ , 24 1 مُطْرِبٌ

abr 2013: 1 3 صَفٌّ , 2 3 نَشِيدٌ , 3 3 ذَهَبٌ , 4 3 شَرْقٌ , 5 2 إِقْلِيمٌ , 6 2 بَرْجَلٌ , 7 2 عَالَمٌ , 8 2 قُفّازٌ , 9 2 كَنيِسَةٌ , 10 2 مِحْفَظَةٌ , 11 2 لُغَةٌ , 12 2 بَيْتٌ , 13 2 شِهابٌ , 14 2 أَلماسٌ , 15 2 فَحْمٌ , 16 2 زُمُرُّدٌ , 17 2 قُطْبٌ , 18 2 جُغْرافِيا , 19 2 سَهْلٌ , 20 2 مَمْلَكَةٌ , 21 1 قَمِيصٌ

mai 2013: 1 2 كَتَبَ , 2 2 بُرْجٌ , 3 1 نَشِيطٌ

jun 2013: 1 2 بِدَايَةٌ , 2 2 وِكالَةٌ , 3 2 صَنْدُوقٌ , 4 2 شَرِكَةٌ , 5 2 هاتِفٌ , 6 2 حَضَارَةٌ , 7 2 مُحَاضَرَةٌ , 8 2 رَفٌّ , 9 2 وِزارَةٌ , 10 2 مَحْكَمَةٌ , 11 2 فِهْرِسٌ , 12 2 تِلمِيذٌ , 13 2 مَعْدِنٌ , 14 2 مُطْرِبٌ , 15 2 مَكْتَبٌ , 16 1 مَطْعَمٌ

jul 2013: 1 1 وَطَنٌ

ago 2013: 1 1 Нови Пазар

set 2013: 1 3 عَظِيمٌ , 2 3 ضَعِفٌ , 3 2 عَمِيقٌ , 4 2 عِمْلاقٌ , 5 2 حزين , 6 2 بَعيدٌ , 7 2 مُتَعَالٍ , 8 2 عَقْلانِيٌّ , 9 2 رَقِيقٌ , 10 2 عَادِلٌ , 11 2 كَسولٌ , 12 2 حَكِيمٌ , 13 1 حَزِينٌ

out 2013: 1 2 ضِفَّةٌ , 2 2 تَجْديدٌ , 3 2 إِيِجابِيٌ , 4 2 تاجِرٌ , 5 2 صَامِتٌ , 6 2 مَسافَةٌ , 7 2 شاعِرٌ , 8 1 وَقُورٌ

nov 2013: 1 2 مِينَاءُ , 2 2 رَقْصَةٌ , 3 1 طاوِلَةٌ

dez 2013: 1 3 حافَةٌ , 2 2 جانِبٌ , 3 2 جامِعٌ , 4 2 دِينٌ , 5 2 جَنَّةٌ , 6 2 جُمْلَةٌ , 7 2 جَمالٌ , 8 2 جَدْوَلٌ , 9 2 جِدارٌ , 10 2 جارٌ , 11 2 تَمْرينٌ , 12 2 جِدِّيٌّ , 13 2 تَقْويمٌ , 14 2 تَحْريرٌ , 15 2 تاريخٌ , 16 2 بَنْكٌ , 17 2 بابٌ , 18 2 حِذَاءٌ , 19 2 بَدْلَةٌ , 20 2 تِلمِيذٌ , 21 1 днсонирати

jan 2014: 1 1 حَجْمٌ

fev 2014: 1 3 سورٌ , 2 3 إِنْحِطاطٌ , 3 3 أُمَّةٌ , 4 3 أَهْلٌ , 5 3 إِجْتِمَاعٌ , 6 3 شاعِرٌ , 7 3 مُتَعاطِفٌ , 8 3 أَمْنٌ , 9 3 إِقتِصادٌ , 10 3 إِذَاعَةٌ , 11 3 أَدَبٌ , 12 2 سَلُّمٌ , 13 2 سيجارَةٌ , 14 2 بَطِيخَةٌ , 15 2 حَفْلَةٌ , 16 2 صورَةٌ , 17 2 سُؤالٌ , 18 2 شارِعٌ , 19 2 وَقُورٌ , 20 2 مُسْتَقِرٌّ , 21 2 خَاصٌّ , 22 2 شَيْخٌ , 23 2 رَئِيسٌ , 24 2 بَارِدٌ , 25 2 مُتَأَلِّقٌ

mar 2014: 1 3 لَفْظٌ , 2 3 غُرْفَةٌ , 3 3 صَلاةٌ , 4 3 صَديقٌ , 5 3 أَحْمَرُ , 6 3 جاهِلٌ , 7 3 نَارٌ , 8 2 عَمَلَ , 9 2 صَدَرَ , 10 2 بَلِدَ , 11 2 خَضِلَ , 12 2 سَلَخَ , 13 2 جَمُلَ , 14 2 رَسَمَ , 15 2 غَلَقَ , 16 2 نَظَرَ , 17 2 سَمِعَ , 18 2 فَتَحَ , 19 2 غَيْمٌ , 20 2 سَكَنَ , 21 2 جَلَبَ , 22 2 دَرَسَ , 23 2 لَوْنٌ , 24 2 قَرْنٌ , 25 2 سَلُّمٌ

abr 2014: 1 3 هَجَمَ , 2 2 رَحِمَ , 3 2 ي , 4 2 قَوْمٌ , 5 2 ذَبَحَ , 6 2 تَجَرَ , 7 2 حَذِقَ , 8 2 عَهِدَ , 9 2 مَزَقَ , 10 2 غَلَبَ , 11 2 شَرَعَ , 12 2 خَمَرَ , 13 2 دارٌ , 14 2 صَبَرَ , 15 2 شَغَلَ , 16 2 عَمَلَ , 17 2 صَلَحَ , 18 2 بَلِدَ , 19 2 خَضِلَ , 20 2 حَمَلَ , 21 2 جَمَعَ , 22 2 صَرَفَ , 23 2 خَرَجَ , 24 2 دَخَلَ , 25 2 شَرِبَ

mai 2014: 1 6 أَخْبَرَ , 2 4 شَرِكَ , 3 4 جَمُلَ , 4 4 حَصَدَ , 5 4 حَشَدَ , 6 4 حَسَبَ , 7 4 بَحَثَ , 8 4 حَرَمَ , 9 4 كَسَرَ , 10 4 سَجَدَ , 11 4 عَرَضَ , 12 4 نَظَرَ , 13 4 صَرَفَ , 14 4 بَلَغَ , 15 4 نَشَرَ , 16 4 نَهَضَ , 17 4 كَتَبَ , 18 3 ثَبَتَ , 19 3 بَسَطَ , 20 3 جَدَلَ , 21 3 نَتيجَةٌ , 22 3 سَرَدَ , 23 3 بَذَلَ , 24 3 حَصَلَ , 25 3 نَقَلَ

jun 2014: 1 3 حَيَوانٌ , 2 3 كَتَبَ , 3 2 إِلْزِمْ شُغُلَك , 4 2 رَوْحٌ , 5 2 الله , 6 2 حَياةٌ , 7 2 حائطٌ , 8 2 شَغَلَ , 9 2 سَلُّمٌ , 10 2 جارٌ , 11 2 إِنْحِطاطٌ , 12 2 إِمْتِحانٌ , 13 2 إِمْرَأَةٌ , 14 2 فَخورٌ , 15 1 نبي

No data on this page have been normalized to 30 day months (as WMF does on certain traffic reports).
Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Sábado, 2 de agosto 2014 20:19

Dump file srwiktionary-20140703-pages-meta-history.xml.7z (full dump), size 6.9 Mb as 7z -> 208 Mb
Dump processed till Jun 30, 2014, on server stat1002, ready at Sun-13/07/2014-11:27 after 2 min, 8 sec.

Versão do script:2.6
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.