Estatísticas da Wikcionário sérvio

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist

Metrics have been collected from a full archive dump, which contains all revisions of every article, meta data and raw content.
See also metrics definitions


 
Monthly counts & Quarterly rankings: março 2015
 
DataWikcionaristasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
mar 2015+2%   +1%   +54%+1%+2%+4%0%0%0% 
fev 2015+3%   0%   +15%+1%+2%+2%0%0%0% 
jan 2015+4%   +1%   -64%+1%+1%+2%0%0%+15% 
dez 2014+19% 0% +1%   +48%+2%+3%+4%+1%+1%+37% 
nov 2014+25%   +1%   +3805%+2%+3%+5%0%0%0% 
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
mar 201591218 20 k4552880325 Mb1,4 M35 k86 k173124 
fev 201589312120 k34,952352025 Mb1,4 M34 k85 k173124 
jan 201586312 20 k44,951745324 Mb1,3 M33 k85 k173124 
dez 2014831325220 k64,95151,3 k24 Mb1,3 M33 k85 k173108 
nov 2014701425119 k74,950585924 Mb1,3 M31 k84 k17279 
out 201456 1 19 k 4,94982223 Mb1,2 M30 k84 k17279 
set 201456   19 k 4,9498523 Mb1,2 M30 k84 k17279 
ago 201456   19 k 4,94984523 Mb1,2 M30 k84 k17279 
jul 201456 4319 k174,94982,3 k23 Mb1,2 M30 k84 k17268 
jun 201456 4319 k24,950772923 Mb1,2 M28 k84 k17168 
mai 201456 9419 k44,95081,3 k23 Mb1,2 M28 k84 k17168 
abr 201456 9218 k54,950374923 Mb1,2 M26 k84 k17166 
mar 20145629318 k44,94931,2 k22 Mb1,2 M24 k83 k16660 
fev 20145429218 k14,848671422 Mb1,2 M20 k83 k16560 
jan 201452   18 k 4,848519822 Mb1,2 M19 k83 k16560 
dez 201352 7118 k14,848578822 Mb1,2 M19 k82 k16560 
nov 201352 5 18 k24,848320322 Mb1,2 M19 k81 k15260 
out 20135216118 k64,848040722 Mb1,1 M19 k81 k12459 
set 201351 6118 k64,847550521 Mb1,1 M19 k81 k9859 
ago 201351 1 18 k 4,846815321 Mb1,1 M19 k81 k9859 
jul 201351 2 18 k14,84679621 Mb1,1 M19 k81 k9859 
jun 201351 5118 k34,846639821 Mb1,1 M19 k81 k9859 
mai 201351 3 18 k14,84679221 Mb1,1 M19 k81 k9859 
abr 201351 7218 k54,846643921 Mb1,1 M19 k80 k9859 
mar 20135118217 k74,84631,4 k21 Mb1,1 M18 k80 k9859 
fev 20135067 17 k24,845934120 Mb1,0 M18 k79 k9659 
jan 201344   17 k 4,845688820 Mb1,0 M18 k79 k9659 
dez 20124411 17 k 4,745622320 Mb1,0 M18 k78 k9659 
nov 201243 1 17 k 4,745673220 Mb1,0 M18 k78 k9659 
out 201243   17 k 4,745612020 Mb1,0 M18 k77 k9559 
set 201243   17 k 4,745618320 Mb1,0 M18 k76 k9559 
ago 201243   17 k 4,745659520 Mb1,0 M18 k76 k9550 
jul 201243 1 17 k 4,645614120 Mb1,0 M18 k76 k9550 
jun 201243 1 17 k 4,645613120 Mb1,0 M18 k75 k9550 
mai 201243   17 k 4,645628320 Mb1,0 M18 k75 k9550 
abr 201243 2 17 k 4,645632320 Mb1,0 M18 k75 k9550 
mar 201243   17 k 4,645643520 Mb1,0 M18 k75 k9550 
fev 20124311 17 k 4,645645720 Mb1,0 M18 k74 k9550 
jan 201242 1 17 k 4,545677220 Mb1,0 M18 k74 k9550 
dez 201142   17 k 4,54561,4 k20 Mb1,0 M18 k72 k9550 
nov 201142   17 k 4,445617220 Mb1,0 M18 k70 k9550 
out 201142 1 17 k 4,445628220 Mb1,0 M18 k70 k9550 
set 201142 2 17 k14,445618120 Mb1,0 M18 k69 k9550 
ago 20114211 17 k 4,445616620 Mb1,0 M18 k69 k9550 
jul 201141   17 k 4,445615520 Mb1,0 M18 k68 k9550 
jun 20114111 17 k 4,445687020 Mb1,0 M18 k68 k9550 
mai 201140 2 17 k 4,345632720 Mb1,0 M18 k67 k9547 
abr 20114011 17 k14,345634220 Mb1,0 M18 k66 k9547 
mar 201139 1 17 k 4,345727720 Mb1,0 M18 k66 k9547 
fev 201139   17 k 4,345741220 Mb1,0 M18 k66 k9547 
jan 201139   17 k 4,345724120 Mb1,0 M18 k65 k9547 
dez 20103911 17 k14,245753720 Mb1,0 M18 k65 k9547 
nov 20103823117 k 4,245729220 Mb1,0 M18 k64 k9547 
out 201036 1117 k 4,245754520 Mb1,0 M18 k64 k9447 
set 20103623117 k14,245747920 Mb1,0 M18 k63 k9447 
ago 201034 2117 k 4,145740120 Mb1,0 M18 k63 k9447 
jul 20103413117 k 4,145786420 Mb1,0 M18 k63 k9447 
jun 201033 1117 k 4,146063720 Mb1,0 M18 k62 k9445 
mai 201033 1117 k 446063220 Mb1,0 M18 k61 k9445 
abr 201033 1117 k 446045220 Mb1,0 M18 k61 k9445 
mar 201033 3117 k 446013 k20 Mb1,0 M18 k60 k9445 
fev 201033 2117 k 3,246259821 Mb1,0 M18 k60 k9445 
jan 201033 2117 k 3,146235121 Mb1,0 M17 k59 k9445 
dez 20093312117 k 3,146241021 Mb1,0 M17 k59 k9444 
nov 200932 1117 k 3,146250121 Mb1,0 M17 k58 k9443 
out 200932 2117 k 3,146243321 Mb1,0 M17 k58 k9443 
set 20093214117 k 346242321 Mb1,0 M17 k57 k9442 
ago 200931 1117 k 346263321 Mb1,0 M17 k57 k9433 
jul 20093113117 k 34622,4 k21 Mb1,0 M17 k56 k9433 
jun 200930 2117 k 2,846438821 Mb1,0 M17 k56 k9432 
mai 20093012117 k 2,846483221 Mb1,0 M17 k56 k9432 
abr 200929 2117 k 2,84641,1 k21 Mb1,0 M17 k55 k9432 
mar 20092913117 k12,74632,9 k21 Mb1,0 M17 k54 k9432 
fev 20092823217 k272,54611,8 k21 Mb1,0 M17 k50 k9432 
jan 20092612116 k22,543826819 Mb993 k16 k49 k9434 
dez 200825   16 k 2,543611619 Mb986 k15 k49 k9430 
nov 200825   16 k 2,543611819 Mb986 k15 k49 k9430 
out 200825   16 k 2,543617519 Mb986 k15 k49 k9430 
set 20082512 16 k 2,543631319 Mb986 k15 k49 k9430 
ago 200824 1 16 k 2,543565319 Mb985 k15 k48 k9430 
jul 200824   16 k 2,543542919 Mb985 k15 k48 k9430 
jun 200824 1 16 k 2,44351,0 k19 Mb985 k15 k47 k9530 
mai 200824 2 16 k 2,44351,2 k19 Mb984 k15 k46 k9530 
abr 200824 1 16 k 2,343514019 Mb984 k15 k44 k9530 
mar 20082411 16 k 2,343517619 Mb984 k15 k44 k9530 
fev 200823 1 16 k 2,343423119 Mb981 k15 k44 k9529 
jan 200823 1 16 k 2,343445619 Mb981 k15 k44 k9529 
dez 200723 2 16 k 2,243415719 Mb981 k15 k43 k9526 
nov 20072311 16 k 2,24345619 Mb980 k15 k43 k9525 
out 2007221  16 k 2,243412919 Mb980 k15 k43 k9525 
set 200721 1 16 k 2,24347719 Mb980 k15 k42 k9525 
ago 200721   16 k 2,24344819 Mb980 k15 k42 k9525 
jul 200721 1 16 k 2,243474519 Mb980 k15 k42 k9525 
jun 200721 1 16 k 2,24344019 Mb980 k15 k42 k9525 
mai 200721   16 k 2,14341,2 k19 Mb980 k15 k42 k9525 
abr 200721 2 16 k 2,143369019 Mb980 k15 k40 k9525 
mar 20072113 16 k 243332219 Mb980 k15 k40 k9525 
fev 200720 2 16 k 243350519 Mb979 k15 k39 k9525 
jan 200720 1 16 k 243375119 Mb978 k15 k39 k9525 
dez 20062012 16 k 1,94331,2 k19 Mb976 k15 k38 k9525 
nov 200619   16 k 1,943356619 Mb977 k15 k38 k9525 
out 200619 3216 k 1,84331,4 k19 Mb976 k15 k37 k9525 
set 200619 1 16 k 1,74331,0 k19 Mb976 k15 k36 k9523 
ago 200619 2 16 k 1,743355419 Mb976 k15 k35 k9522 
jul 200619 1116 k1471,64338,7 k19 Mb975 k15 k34 k922 
jun 200619 4111 k2311,54328,6 k14 Mb698 k11 k26 k922 
mai 2006191314,4 k825471,0 k8,3 Mb351 k3,5 k18 k923 
abr 200618 214,2 k531,95462,0 k8,0 Mb327 k3,1 k16 k922 
mar 2006183312,6 k412,25191,8 k4,5 Mb187 k2,6 k8,6 k922 
fev 2006151711,3 k1633921,3 k1,2 Mb65 k2,4 k3,4 k119 
jan 20061423 895135211971,1 Mb57 k1,4 k2,7 k112 
dez 20051224 863 2,95125051022 kb53 k1,3 k2,7 k19 
nov 200510 2 848 2,451148974 kb52 k1,1 k2,4 k 5 
out 200510 1 841 2,350851955 kb51 k1,1 k2,3 k 4 
set 200510111841 2,3507427954 kb51 k1,1 k2,3 k 4 
ago 2005912 839 1,8506101944 kb51 k1,1 k2,3 k12 
jul 2005814 83721,6505132935 kb51 k1,0 k2,2 k12 
jun 2005712 789 1,646233793 kb44 k1,0 k1,6 k11 
mai 2005613 785 1,545765774 kb43 k9941,6 k11 
abr 2005512177721,5448168747 kb42 k9941,5 k11 
mar 20054 2 707 1,438843565 kb33 k96468711 
fev 20054121703111,3390463562 kb33 k95366911 
jan 20053231384121,2121452122 kb6,3 k3874311 
dez 20041   7 3,119634,4 kb179175 1 
nov 20041   7 2,719343,4 kb177165 1 
out 20041   6 2,5260 3,7 kb194145 1 
set 20041   6 2,526063,7 kb194145 1 
ago 20041   3 3444 2,5 kb165115 1 
jul 20041   3 344422,5 kb165115 1 
jun 20041   2 3,5183 775 5165   
mai 20041   2 3,5183 775 5165   
abr 20041   2 3,5183 775 5165   
mar 20041   2 3,51831775 5165   
fev 20041   2 3184 734 5164   
jan 20041   2 3184 734 5164   
dez 20031   2 31842734 5164   
nov 20031   1 4126 277 1823   
out 20031   1 41261277 1823   
set 20031   1 31281280 1823   
ago 20031   1 2128 214 182    
jul 20031   1 21281214 182    
jun 200311  1 11521264 25     
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
The following table ranks this project in relation to projects in other languages with 1000+ articles
jan 2015301315436338721464464962745755129
out 20144237644762606916101444862745760129
jul 2014423232196228651734444761705467129
abr 2014423320286135651641444765705468129
jan 2014424185495959661785434770705473129
out 2013423524405734651755414769705973129
jul 2013423954515660641894414769686271129
abr 2013413623265539631763404768676269129
jan 2013444580545567641761404867666068129
out 2012453375485459641592404766656067129
jul 2012435072525369621589404666636169129
abr 2012413855525266591574384466636069129
jan 2012423564505160591658374266636069129
out 2011403972485069571582364064595770129
jul 2011404379494765561578363964575770129
abr 2011403166444555601773333864575669129
jan 2011413578504561581871313664555464129
out 2010413692694261611864303362545363129
jul 2010414054763966621861293160525361129
abr 2010414586703958601869293158504962129
jan 2010413066673658681763273058504862129
out 2009413868663457681761272957484561129
jul 2009403752683459631635242952454461129
abr 2009415064663353661449212751444262129
jan 2009415561413145621456202550414161129
out 2008413672423061621255202549384159128
jul 2008413068443057621254192548363857128
abr 2008404264482862581261172344333655128
jan 2008394364512759591057151940323452128
out 200736337249246157963131737302852128
jul 2007354364432358571038121533282555128
abr 200730405445196054948111332282251128
jan 200727476343196450644111328272053128
out 200624394126185348633101028221949128
jul 200623405934156446147825183146128
abr 2006213838312483962271240222647128
jan 2006231930343640363640263343304045121
out 2005243244263135303047232640274056109
jul 2005242920252928262638202237222863104
abr 200532212420212320202316203019226693
jan 200539101618231015151524283343166281
out 200456232816422010105246504448115269
jul 200447182610371644383938343393951
abr 200419785155331413141275819
jan 200416443113221010101074916
out 200314332132221010101064614
jul 20031354312322101091074613
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100ediçõesbytes
 WikcionaristasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikcionaristas (usuários registrados)
A = Wikcionaristas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikcionaristas que editaram pelo menos dez vezes desde que chegaram
C = Wikcionaristas que contribuíram cinco vezes ou mais este mês
D = Wikcionaristas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  2500  5  10  100  1000  10000  1  3  5  10  25  5  10  100  1  3  5  10  25  100  5  10  100 
mar 2015272118169   22   4    111177531 11 
fev 20151814121091   11   41      135411 11 
jan 2015211612116   11   32      14552  111
dez 201436312521142   11   21      2410631 11 
nov 20144133251781        51      6328179411  
out 20143111    1    1       4211     
set 20142           3       51    11 
ago 201421     11   111     51    1  
jul 201412444433  211          42211    
jun 201411544431  111          7543     
mai 201411998641  11           108842    
abr 20141099982   11   1       149973    
mar 201411999931  11   2       138871    
fev 2014101097621  11   1       7111     
jan 201442     221  1       9211     
dez 2013887651   221  3       124322    
nov 201396543        1       188754    
out 2013866661        1       169873    
set 2013996641   11   32      1611875    
ago 20134111    221  1       211      
jul 201332221   11           6431     
jun 2013765421                10531     
mai 201394331   11   22   1  117321 1  
abr 20131087732   32   2       118633    
mar 2013988872   331  411     1210984111 
fev 201387764   221  3       11877     
jan 20131      441          3     11 
jan 2015211612116   11   32      14552  111
out 20143111    1    1       4211     
jul 201412444433  211          42211    
abr 20141099982   11   1       149973    
jan 201442     221  1       9211     
out 2013866661        1       169873    
jul 201332221   11           6431     
abr 20131087732   32   2       118633    
jan 20131      441          3     11 
out 201232     33           71    11 
jul 2012211     111          101    1  
abr 2012222     331  11      5331     
jan 2012311     442          2     31 
out 2011321     331  11      6     11 
jul 201152     111  2       31       
abr 201132111   221  2       62211    
jan 20113      221  1       61       
out 20105111111       11      6321     
jul 20103332211       2       2222     
abr 20104211111       1       62    11 
jan 20104322111       3       422211   
out 20096321111       21      411      
jul 20094333211  2111 1       5222  1  
abr 200974221111 1    1       421      
jan 2009732111   22   1       5321  11 
out 20082      221  1       422      
jul 20083      332  1       4        
abr 200811111   11   3       6        
jan 2008321     222  2       6        
out 20074      111  1111    31       
jul 2007321     111          221      
abr 20074321    111  1111    2111     
jan 200722111   111  1111    11111    
out 2006633332   111  3111    311      
jul 20065111111  2222 411     62111122 
abr 200611322111  111  411     53311    
jan 2006105333   22   43221   744221   
out 20058211         11               
jul 2005126411   11   1       2        
abr 2005622111        3221    42221    
jan 20055432211       3111    211111   
out 2004                             
jul 20041                            
abr 2004                             
jan 2004                             
out 2003                             
jul 2003                             

 

Distribuição de edições de artigos por wikcionaristas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikcionaristasEdições total
1279100.0%34,967100.0%
313247.3%34,73299.3%
109032.3%34,49598.7%
325319.0%33,80296.7%
1003211.5%32,62693.3%
316145.0%29,49684.4%
100093.2%26,93077.0%
316210.4%13,57938.8%
1000010.4%13,57938.8%

 

26 wikcionaristas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions
agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
Bubbah63UC2 02,8563045525fev 15, 2013773322194-
Mickey MystiqueUC3 02,1929766621fev 15, 20137731,139251631
DungodungUC9 01,003186-mai 11, 2005361011-26-
FunakoshiUC15 027016702out 02, 20135448391-
NatalijaUC16 02631221nov 07, 201414310---
MilicaStajicUC19+3213634617nov 11, 20141393411--
Milica91UC20+6175631-fev 13, 20154572--
Nata.ilić93UC24+81325252nov 07, 20141431551-
M.kostic93UC25+21221142nov 07, 2014143131--
Maje1512UC28+5117422-nov 07, 2014143133--
Lola.andrejevicUC32-19612367nov 13, 2014137277--
Hello micyUC34+10794171nov 22, 2014128152--
Andjela.kanackiUC35+27610153nov 06, 2014144172--
Gaga.isaUC38 06812206nov 11, 2014139175--
Milica.djuricUC39+11567642-nov 30, 201412074--
Zaza993UC46-139281dez 09, 2014111121--
Anastojanovic93UC49+8134302-nov 07, 201414354--
CommonsDelinkerUC51+332516-set 02, 20072766----
Fara27UC55+25301872nov 11, 201413984--
Mia.dj92UC59+3276144nov 11, 2014139114--
Marijana.cvetuljskiUC60-126471nov 26, 201412461--
Vampy23UC80+11426-nov 11, 201413961--
BD2412UC92+1911-jan 09, 201580--1-
CadfaellUC156...33--mar 30, 2015 ----
PänikkäUC194+8021--jan 26, 201563----
Berthold WernerUC278...11--mar 06, 201524----

 

20 wikcionaristas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
InterwicketUC113,579jan 27, 20092253nov 08, 20101603
KasterUC41,680jan 27, 20053714nov 15, 2012865
KadzoUC51,540jan 11, 20092269abr 03, 20092187
Crveni BaronUC61,522nov 19, 20053418jul 25, 20063170
Linos MimiUC71,466fev 15, 2013773jul 11, 2014262
The Milica TomovicUC81,092fev 15, 2013773jul 14, 2014259
GolijaUC10437jan 19, 20053722ago 14, 20053515
SrBotUC11415set 09, 20053489out 04, 20053464
ImperatorkAUC12400fev 18, 2013770dez 27, 201493
SashatoUC13396dez 19, 20053388set 12, 20063121
Taychy2110UC14315dez 14, 2013471dez 28, 201492
PoletanicaUC17241fev 15, 2013773set 28, 2013548
Саша СтефановићUC18235dez 24, 20053383jan 12, 20092268
MikaUC21165nov 06, 2014144dez 18, 2014102
GojkommUC22160mar 25, 20082561nov 12, 20111234
ItjustkindofhappenedUC23156nov 06, 2014144dez 18, 2014102
MinjceUC26121dez 13, 2014107jan 09, 201580
Bahar073UC27117fev 15, 2014408jul 10, 2014263
SmilingsammyUC29112fev 27, 2014396mai 19, 2014315
Mailer23UC30109dez 13, 2014107jan 13, 201576

 

usuários anônimos, ordenados por número de contribuições
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
84.167.135.1831469
84.167.149.251812
87.202.155.185171
147.91.1.4172
178.149.23.11355
178.148.34.20546
178.148.20.23543
109.245.113.19142
213.198.196.22929
109.92.39.10926

No total 3.855 edições foram feitas por usuários anônimos, de um total de 98.126 edições ( 3e %)
  


20 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
СлоботUC114,670jul 14, 20092085mar 26, 20101830--
CrveniBaronBotUC213,761mar 04, 20063313jul 23, 2006317211,260-
RobotGMwiktUC313,721jul 21, 20053539jun 06, 20082488--
Luckas-botUC44,967mar 03, 20092218jan 27, 2014427--
KamikazeBotUC54,524dez 17, 20101564mar 07, 2013753--
VolkovBotUC62,574ago 20, 20072779abr 05, 2013724--
SpaceBirdyBotUC71,324jun 23, 20082471dez 30, 20091916--
YS-BotUC81,237set 07, 2012934mar 31, 2015---
BodhisattvaBotUC91,216fev 02, 20082613ago 19, 20082414--
AvocatoBotUC10843out 27, 20111250ago 28, 2013579--
MonoBotUC11217jan 17, 20082629jun 14, 20082480--
Makecat-botUC1284nov 10, 2012870abr 05, 2013724--
FelixBotUC1362dez 16, 20053391jun 14, 20063211--
CarsracBotUC1444dez 22, 2012828mai 21, 2013678--
タチコマ robotUC1520dez 06, 20111210jan 05, 201584--
JAnDbotUC1619jun 10, 20121023mar 28, 20152--
JackBotUC1711ago 10, 20101693ago 10, 20101693--
AibotUC187mai 13, 20082512jun 13, 20082481--
GetoBotUC192fev 08, 20063337fev 08, 20063337--
EscarbotUC201set 02, 20063131set 02, 20063131--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110JpgOggPngSvg
mar 201520 k64393122537082924212     6033342
fev 201520 k64293122537082924212     4763342
jan 201520 k63793122537082924212     3873342
dez 201420 k63293122537082924212     9933342
nov 201419 k63188122536932923912     7433342
out 201419 k62862122536522922812     153342
set 201419 k62862122536522922812     23342
ago 201419 k62462122536522922812     53342
jul 201419 k62062122536522922812     20693342
jun 201419 k62062122536522922812     5953342
mai 201419 k6206292536472822812     13213 42
abr 201418 k6206292536462222812     6833 42
mar 201418 k6166192536402222812     11183 42
fev 201418 k6146192536392222812     6473 42
jan 201418 k6086192536392222812     93 42
dez 201318 k5986192536392222812     3133 42
nov 201318 k5966092526272222812     2003 42
out 201318 k5915492526122122812     3923 42
set 201318 k5805182526082122812     4063 41
ago 201318 k5594982526042122812     143 41
jul 201318 k5564982526042122712     593 41
jun 201318 k5524982526042122712     3603 41
mai 201318 k5504982526042122712     593 41
abr 201318 k5494982525862122712     3853 41
mar 201317 k5364982525852122712     6603 41
fev 201317 k5194772525632021812     1803 4 
jan 201317 k5144672525552021612     13 4 
dez 201217 k5124672525552021612     143 4 
nov 201217 k5074172525342021212     103 4 
out 201217 k5064172525342021212     73 4 
set 201217 k5014172525342021212     43 4 
ago 201217 k4974172525342021212      3 4 
jul 201217 k4914172525342021212     83 4 
jun 201217 k4824172525342021212     113 4 
mai 201217 k4734172525342021212     33 4 
abr 201217 k4684172525332021212     103 4 
mar 201217 k4534172525322021212     63 4 
fev 201217 k4484172525322021112     243 4 
jan 201217 k4404172525322021112     73 4 
dez 201117 k4364172525322021112      3 4 
nov 201117 k4314172525322021112     23 4 
out 201117 k4204172525312021112     103 4 
set 201117 k4144172525312021112     483 4 
ago 201117 k4094172525312020712     163 4 
jul 201117 k4044172525272020512     113 4 
jun 201117 k3974172525272020512     183 4 
mai 201117 k3934172525272020512     153 4 
abr 201117 k3874172525252020512     733 4 
mar 201117 k3784172525242018812     103 4 
fev 201117 k3774172525222018812     33 4 
jan 201117 k3694172525212018812     43 4 
dez 201017 k3624172525212018812     293 4 
nov 201017 k3554172525212018812     2833 4 
out 201017 k3514072525202018612     5393 4 
set 201017 k3484072525192018612     4773 4 
ago 201017 k3414072525182018312     3793 4 
jul 201017 k3264072525182018312     8533 4 
jun 201017 k3204072525122018312     6303 4 
mai 201017 k3074072525122018312     6253 4 
abr 201017 k3054072525122018312     4453 4 
mar 201017 k3014072525122018312     6413 4 
fev 201017 k2973972525082018312     5813 4 
jan 201017 k2933772525002015310     3473 4 
dez 200917 k2573072524902014510     3963 4 
nov 200917 k2533072524902014510     4953 4 
out 200917 k2523072524902014510     4273 4 
set 200917 k2492972524902014310     4233 4 
ago 200917 k2432972524892014310     6323 4 
jul 200917 k2422972524892014310     5333 4 
jun 200917 k2362972524652013910     3843 4 
mai 200917 k2332972524642013910     8223 4 
abr 200917 k2312772524642013910     10343 4 
mar 200917 k2212772524632013710     28763 4 
fev 200917 k2142772524632013710     17563 4 
jan 200916 k2082772524622013610     1283 4 
dez 200816 k207277252462201369     53 4 
nov 200816 k207277252462201369     13 4 
out 200816 k194277252462201369     43 4 
set 200816 k184277252462201369     203 4 
ago 200816 k182277252455201369     173 4 
jul 200816 k177277252455201369     43 4 
jun 200816 k175277252455201369     183 4 
mai 200816 k172267252455201369     193 4 
abr 200816 k165267252455201369     643 4 
mar 200816 k160267252455201369     363 4 
fev 200816 k156267252453201369     113 4 
jan 200816 k155267252452201369     143 4 
dez 200716 k151267252452201369     143 4 
nov 200716 k148267252452201359     123 4 
out 200716 k146267252452201359     63 4 
set 200716 k143267252452201359     103 4 
ago 200716 k141267252451201349     23 4 
jul 200716 k139267252451201349     93 4 
jun 200716 k139267252446201349     73 4 
mai 200716 k137267252441201349     33 4 
abr 200716 k137267252441201339     223 4 
mar 200716 k137267252441201329     813 4 
fev 200716 k13125725243620879     653 4 
jan 200716 k12819725238920759     743 4 
dez 200616 k12818725237920739     783 4 
nov 200616 k12717725237820719     43 4 
out 200616 k12417725137820719     4333 4 
set 200616 k11817725137820719     283 4 
ago 200616 k10916725137620659     213 4 
jul 200616 k10315725137220639     2943 4 
jun 200611 k9815718936720629     1693 4 
mai 20064,4 k8615718836520619     3113 4 
abr 20064,2 k8013718732820549     5663 4 
mar 20062,6 k7313716631020538     2393 4 
fev 20061,3 k6513714529420528     11113 4 
jan 20068955812513722617474     1423 2 
dez 20058632412413413615374     912 2 
nov 2005845161141081248224     302 2 
out 200583814104741098184     252 2 
set 200583814104741098184     4092 2 
ago 200583714104731078184     472 2 
jul 200583312104721078184     1062 2 
jun 200578511104721078184     252 2 
mai 20057811194711068184     512 2 
abr 20057731094711068174     1522 2 
mar 2005703542711021104     39  2 
fev 20056995427199194     461  2 
jan 200537944 719616      452    
dez 2004933 71              
nov 2004833 49              
out 20048 2 49              
set 20048 1 49              
ago 20043 1 49              
jul 20043   49              
jun 20042   49              
mai 20042   36              
abr 20042   36              
mar 20042   36              
fev 20042   36              
jan 20042   35              
dez 20032   31              
nov 20031                  
out 20031                  
set 20031                  
ago 20031                  
jul 20031                  
jun 20031                  

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

jun 2003: 1 1 MTA

set 2003: 1 1 MTA

dez 2003: 1 1 Аборигини

jul 2004: 1 1 Главна страна

set 2004: 1 1 Аверзија

nov 2004: 1 1 Аверзија

dez 2004: 1 1 Абак

jan 2005: 1 2 агора , 2 2 агонија , 3 2 агониста , 4 1 дифамија

fev 2005: 1 2 инструментализам , 2 1 ајгир

mar 2005: 1 1 аграрски

abr 2005: 1 2 Дисимилација , 2 2 Аранђел , 3 2 Авакум , 4 2 Горан , 5 2 среда , 6 1 дисјункција

mai 2005: 1 3 Виконт , 2 2 Виа факти , 3 1 дисјункција

jun 2005: 1 2 изотерма , 2 2 Капо , 3 1 интелигенција

jul 2005: 1 2 троугао , 2 2 столица , 3 1 ложа

ago 2005: 1 2 интелигенција , 2 2 Инкубатор , 3 2 јун , 4 1 дискант

set 2005: 1 3 агора , 2 2 Абукушу , 3 2 абаџија , 4 2 Андрија , 5 1 дифамија

out 2005: 1 2 инсигније , 2 1 дисоцијација

nov 2005: 1 2 беснило , 2 1 Инјектор

dez 2005: 1 3 Главна страна , 2 2 светлети , 3 2 Ваљево , 4 2 Broken/Градови у Црној Гори , 5 1 дисјункција

jan 2006: 1 3 нож , 2 3 авион , 3 2 Релација , 4 2 затварач , 5 2 nóż , 6 2 вечера , 7 2 господ , 8 2 живот , 9 1 терзија

fev 2006: 1 4 државе Европе/Енглески , 2 4 duae , 3 3 државе Европе/Азербејџански , 4 3 државе Европе/Албански , 5 3 meisie , 6 3 eins , 7 3 fast , 8 3 immer , 9 3 Öl , 10 3 Brot , 11 3 Butterbrot , 12 3 octo , 13 3 septem , 14 3 quinque , 15 3 quattuor , 16 3 tria , 17 3 tres , 18 2 државе Европе/Пољски , 19 1 адресанат

mar 2006: 1 3 Тренутни догађаји , 2 3 Бог , 3 3 Главна страна , 4 2 Капо , 5 2 аберација , 6 2 stupid , 7 2 један , 8 2 Боривој , 9 2 Авакум , 10 1 дисјункција

abr 2006: 1 2 дисоцијација , 2 2 Birne , 3 2 глава

mai 2006: 1 2 агониста , 2 2 безграничан , 3 2 бескорисност , 4 1 агонија

jun 2006: 1 2 дистрикт , 2 2 испорука , 3 2 Георгије , 4 1 дисоцијација

jul 2006: 1 2 интелигенција , 2 2 безболан

ago 2006: 1 2 агора , 2 2 Дисимилација

set 2006: 1 1 интервал

out 2006: 1 2 лежарина , 2 2 ave , 3 1 Ležarina

nov 2006: 1 1 Златибор

dez 2006: 1 3 талац , 2 3 престолонаследниковница , 3 2 март

jan 2007: 1 2 столица , 2 1 др.

fev 2007: 1 2 инсомнија , 2 1 фиг.

mar 2007: 1 2 Марко , 2 1 убрендити

abr 2007: 1 2 библиотека , 2 1 авилисантан

mai 2007: 1 1 абнорман

jun 2007: 1 1 indiferentnost

jul 2007: 1 1 Domicil

ago 2007: 1 1 Београд

set 2007: 1 2 Сотер , 2 2 аритметика

out 2007: 1 2 примаријус

nov 2007: 1 2 transparentnost

dez 2007: 1 2 мајстор , 2 2 ушур , 3 1 Мајстор

jan 2008: 1 2 Recesija

fev 2008: 1 3 ректор , 2 1 Ректор

mar 2008: 1 2 Рјечник архаизама

abr 2008: 1 1 Рјечник архаизама

mai 2008: 1 1 Рјечник архаизама

jun 2008: 1 1 Рјечник архаизама

jul 2008: 1 1 Рјечник архаизама

ago 2008: 1 1 Рјечник архаизама

set 2008: 1 1 Рјечник архаизама

out 2008: 1 1 diskinezije

nov 2008: 1 1 Рјечник архаизама

dez 2008: 1 1 Визионар

jan 2009: 1 2 волшебница , 2 2 жрец , 3 2 Мухамед , 4 2 свештеник , 5 1 фалетарица

fev 2009: 1 2 ст. , 2 2 абе , 3 2 двор , 4 2 абракадабра , 5 2 абака , 6 2 Авлија , 7 2 абдицирати , 8 2 universe , 9 2 имам , 10 2 вулкан , 11 1 аблујирати

mar 2009: 1 2 logistika , 2 2 абревијатура , 3 2 им. , 4 2 ж. , 5 2 абортус , 6 2 abnormalan

abr 2009: 1 3 аперцепција , 2 2 Словенија , 3 2 хаван

mai 2009: 1 2 експлоратер , 2 2 Amato , 3 2 Amando , 4 2 Abdieso , 5 2 губа , 6 1 Blaziran

jun 2009: 1 2 Acacio , 2 1 neko

jul 2009: 1 2 џивџан , 2 2 мачка , 3 2 бабине , 4 2 адмирал , 5 1 ахенија

ago 2009: 1 3 биотоп

set 2009: 1 3 морфем , 2 2 носилац

out 2009: 1 2 hakeri , 2 2 адреса

nov 2009: 1 1 морфема

dez 2009: 1 2 ορίστε , 2 1 egzegeza

jan 2010: 1 2 Рјечник архаизама , 2 1 војн.

fev 2010: 1 3 laberint , 2 3 милијарда , 3 2 јул , 4 2 судбина , 5 2 Рјечник архаизама , 6 2 Александра , 7 2 абулија , 8 1 септембар

mar 2010: 1 2 пијаца , 2 2 Naissus , 3 1 Yi+Ze

abr 2010: 1 2 црна , 2 2 кушати , 3 2 Meyer

mai 2010: 1 1 септембар

jun 2010: 1 2 један , 2 1 зидухија

jul 2010: 1 2 биол. , 2 2 ентузијазам , 3 2 в. , 4 2 January

ago 2010: 1 3 Нови Сад , 2 1 Словенија

set 2010: 1 2 Врање , 2 2 TCP , 3 2 CDP , 4 2 RIP , 5 2 EIGRP , 6 1 лажица

out 2010: 1 2 Hassan , 2 1 Варцарка

nov 2010: 1 2 Hassan , 2 2 среда , 3 1 nůž

dez 2010: 1 2 Кина , 2 1 Фјорд

jan 2011: 1 1 Насловна страна

fev 2011: 1 1 Бијоград

mar 2011: 1 1 тахилалија

abr 2011: 1 1 јелен

mai 2011: 1 2 Сребрница , 2 1 Сребреница

jun 2011: 1 2 Београд , 2 1 φαΐ

jul 2011: 1 2 dvanaest

ago 2011: 1 1 שלום

set 2011: 1 1 Ευγενία

out 2011: 1 1 битва

nov 2011: 1 1 Рјечник архаизама

jan 2012: 1 2 Вампир

fev 2012: 1 1 Централна Африка

mar 2012: 1 1 marijana

abr 2012: 1 1 курија

mai 2012: 1 1 Конавли

jun 2012: 1 1 Стрешељ

jul 2012: 1 1 аламан

set 2012: 1 1 Šarlin

out 2012: 1 1 аб

nov 2012: 1 2 Босна и Херцеговина , 2 1 абажур

dez 2012: 1 1 Додатак:Unicode/Арапски

jan 2013: 1 1 пророк

fev 2013: 1 3 نَهْرٌ , 2 3 سَلامٌ , 3 2 مَضِيقُ بَحْرِيٍّ , 4 2 شَعَرٌ , 5 2 حَاجِبٌ , 6 2 لِحْيَةٌ , 7 2 وَجْهٌ , 8 2 أَنْفٌ , 9 2 نِمْرٌ , 10 2 فَمٌ , 11 2 أُذُنٌ , 12 2 لِسَانٌ , 13 1 وادِي

mar 2013: 1 4 أَثَرٌ , 2 3 رِيحٌ , 3 3 أَسَدٌ , 4 3 غَزالَةٌ , 5 3 كَلْبٌ , 6 3 فِيلٌ , 7 3 جَبْهَةٌ , 8 3 عَظَمٌ , 9 3 فَمٌ , 10 3 أُذُنٌ , 11 3 مَسْرَحٌ , 12 3 ثَقَافَةٌ , 13 3 سَلامٌ , 14 3 إِنْسَانٌ , 15 2 شَرْقٌ , 16 2 نَسْرٌ , 17 2 هِلالٌ , 18 2 قَمَرٌ , 19 2 شَمْسٌ , 20 2 ثَدْيٌ , 21 2 صَدْرٌ , 22 2 رِجْلٌ , 23 2 ذِرَاعٌ , 24 1 مُطْرِبٌ

abr 2013: 1 3 صَفٌّ , 2 3 نَشِيدٌ , 3 3 ذَهَبٌ , 4 3 شَرْقٌ , 5 2 إِقْلِيمٌ , 6 2 بَرْجَلٌ , 7 2 عَالَمٌ , 8 2 قُفّازٌ , 9 2 كَنيِسَةٌ , 10 2 مِحْفَظَةٌ , 11 2 لُغَةٌ , 12 2 بَيْتٌ , 13 2 شِهابٌ , 14 2 أَلماسٌ , 15 2 فَحْمٌ , 16 2 زُمُرُّدٌ , 17 2 قُطْبٌ , 18 2 جُغْرافِيا , 19 2 سَهْلٌ , 20 2 مَمْلَكَةٌ , 21 1 قَمِيصٌ

mai 2013: 1 2 كَتَبَ , 2 2 بُرْجٌ , 3 1 نَشِيطٌ

jun 2013: 1 2 بِدَايَةٌ , 2 2 وِكالَةٌ , 3 2 صَنْدُوقٌ , 4 2 شَرِكَةٌ , 5 2 هاتِفٌ , 6 2 حَضَارَةٌ , 7 2 مُحَاضَرَةٌ , 8 2 رَفٌّ , 9 2 وِزارَةٌ , 10 2 مَحْكَمَةٌ , 11 2 فِهْرِسٌ , 12 2 تِلمِيذٌ , 13 2 مَعْدِنٌ , 14 2 مُطْرِبٌ , 15 2 مَكْتَبٌ , 16 1 مَطْعَمٌ

jul 2013: 1 1 وَطَنٌ

ago 2013: 1 1 Нови Пазар

set 2013: 1 3 عَظِيمٌ , 2 3 ضَعِفٌ , 3 2 عَمِيقٌ , 4 2 عِمْلاقٌ , 5 2 حزين , 6 2 بَعيدٌ , 7 2 مُتَعَالٍ , 8 2 عَقْلانِيٌّ , 9 2 رَقِيقٌ , 10 2 عَادِلٌ , 11 2 كَسولٌ , 12 2 حَكِيمٌ , 13 1 حَزِينٌ

out 2013: 1 2 ضِفَّةٌ , 2 2 تَجْديدٌ , 3 2 إِيِجابِيٌ , 4 2 تاجِرٌ , 5 2 صَامِتٌ , 6 2 مَسافَةٌ , 7 2 شاعِرٌ , 8 1 وَقُورٌ

nov 2013: 1 2 مِينَاءُ , 2 2 رَقْصَةٌ , 3 1 طَاوِلَةٌ

dez 2013: 1 3 حافَةٌ , 2 2 جانِبٌ , 3 2 جامِعٌ , 4 2 دِينٌ , 5 2 جَنَّةٌ , 6 2 جُمْلَةٌ , 7 2 جَمالٌ , 8 2 جَدْوَلٌ , 9 2 جِدارٌ , 10 2 جارٌ , 11 2 تَمْرِينٌ , 12 2 جِدِّيٌّ , 13 2 تَقْويمٌ , 14 2 تَحْريرٌ , 15 2 تاريخٌ , 16 2 بَنْكٌ , 17 2 بابٌ , 18 2 حِذَاءٌ , 19 2 بَدْلَةٌ , 20 2 تِلمِيذٌ , 21 1 днсонирати

jan 2014: 1 1 حَجْمٌ

fev 2014: 1 3 سورٌ , 2 3 إِنْحِطاطٌ , 3 3 أُمَّةٌ , 4 3 أَهْلٌ , 5 3 إِجْتِمَاعٌ , 6 3 شاعِرٌ , 7 3 مُتَعاطِفٌ , 8 3 أَمْنٌ , 9 3 إِقتِصادٌ , 10 3 إِذَاعَةٌ , 11 3 أَدَبٌ , 12 2 سَلُّمٌ , 13 2 سيجارَةٌ , 14 2 بَطِيخَةٌ , 15 2 حَفْلَةٌ , 16 2 صورَةٌ , 17 2 سُؤالٌ , 18 2 شارِعٌ , 19 2 وَقُورٌ , 20 2 مُسْتَقِرٌّ , 21 2 خَاصٌّ , 22 2 شَيْخٌ , 23 2 رَئِيسٌ , 24 2 بَارِدٌ , 25 2 مُتَأَلِّقٌ

mar 2014: 1 3 لَفْظٌ , 2 3 غُرْفَةٌ , 3 3 صَلاةٌ , 4 3 صَديقٌ , 5 3 أَحْمَرُ , 6 3 جاهِلٌ , 7 3 نَارٌ , 8 2 عَمَلَ , 9 2 صَدَرَ , 10 2 بَلِدَ , 11 2 خَضِلَ , 12 2 سَلَخَ , 13 2 جَمُلَ , 14 2 رَسَمَ , 15 2 غَلَقَ , 16 2 نَظَرَ , 17 2 سَمِعَ , 18 2 فَتَحَ , 19 2 غَيْمٌ , 20 2 سَكَنَ , 21 2 جَلَبَ , 22 2 دَرَسَ , 23 2 لَوْنٌ , 24 2 قَرْنٌ , 25 2 سَلُّمٌ

abr 2014: 1 3 هَجَمَ , 2 2 رَحِمَ , 3 2 ي , 4 2 قَوْمٌ , 5 2 ذَبَحَ , 6 2 تَجَرَ , 7 2 حَذِقَ , 8 2 عَهِدَ , 9 2 مَزَقَ , 10 2 غَلَبَ , 11 2 شَرَعَ , 12 2 خَمَرَ , 13 2 دارٌ , 14 2 صَبَرَ , 15 2 شَغَلَ , 16 2 عَمَلَ , 17 2 صَلَحَ , 18 2 بَلِدَ , 19 2 خَضِلَ , 20 2 حَمَلَ , 21 2 جَمَعَ , 22 2 صَرَفَ , 23 2 خَرَجَ , 24 2 دَخَلَ , 25 2 شَرِبَ

mai 2014: 1 6 أَخْبَرَ , 2 4 شَرِكَ , 3 4 جَمُلَ , 4 4 حَصَدَ , 5 4 حَشَدَ , 6 4 حَسَبَ , 7 4 بَحَثَ , 8 4 حَرَمَ , 9 4 كَسَرَ , 10 4 سَجَدَ , 11 4 عَرَضَ , 12 4 نَظَرَ , 13 4 صَرَفَ , 14 4 بَلَغَ , 15 4 نَشَرَ , 16 4 نَهَضَ , 17 4 كَتَبَ , 18 3 ثَبَتَ , 19 3 بَسَطَ , 20 3 جَدَلَ , 21 3 نَتيجَةٌ , 22 3 سَرَدَ , 23 3 بَذَلَ , 24 3 حَصَلَ , 25 3 نَقَلَ

jun 2014: 1 3 حَيَوانٌ , 2 3 كَتَبَ , 3 2 إِلْزِمْ شُغُلَك , 4 2 رَوْحٌ , 5 2 الله , 6 2 حَياةٌ , 7 2 حائطٌ , 8 2 شَغَلَ , 9 2 سَلُّمٌ , 10 2 جارٌ , 11 2 إِنْحِطاطٌ , 12 2 إِمْتِحانٌ , 13 2 إِمْرَأَةٌ , 14 2 فَخورٌ , 15 1 نبي

jul 2014: 1 3 شَهْرٌ , 2 3 خَفَتَ , 3 3 جِهَةٌ , 4 3 وَقَفَ , 5 3 عَصْرِيٌّ , 6 3 فَحَصَ , 7 3 نَهَضَ , 8 3 نَافِذَةٌ , 9 3 شَعْبِيٌّ , 10 3 شَديدٌ , 11 3 تِلْقَائِيٌّ , 12 3 شَاعِرِيٌّ , 13 3 نَاقِدٌ , 14 3 بَارِدٌ , 15 3 مُتَأَلِّقٌ , 16 3 مُتَهَوِّسٌ , 17 3 سَاخِرٌ , 18 3 أُمَّةٌ , 19 3 مَوْضُوعِيٌّ , 20 3 مُتَوَتَّرٌ , 21 3 ذَوَّاقٌ , 22 3 عَصَبِيٌّ , 23 3 أَصْفَرُ , 24 3 أَسْوَدُ , 25 3 أَزْرَقُ

ago 2014: 1 1 Ogos

set 2014: 1 1 Оџаци

out 2014: 1 1 إِسْمٌ

nov 2014: 1 4 ord , 2 4 bord , 3 4 huvud , 4 3 mann , 5 3 dricka , 6 3 ansikte , 7 3 dörr , 8 3 bror , 9 3 مُتَرْجِمٌ , 10 3 قَهْوَةٌ , 11 3 äpple , 12 3 vatten , 13 3 fågel , 14 3 rum , 15 3 hus , 16 3 fråga , 17 3 hund , 18 2 مُدَّةٌ , 19 2 دَائِرَةٌ , 20 2 أُسْبُوعٌ , 21 2 dum , 22 2 kvinne , 23 2 kone , 24 2 søster , 25 2 gutt

dez 2014: 1 4 läsa , 2 3 ulica , 3 3 leva , 4 3 bröd , 5 3 sol , 6 3 fönster , 7 2 výborný , 8 2 česať , 9 2 أَرْمَلَةٌ , 10 2 byť , 11 2 modrý , 12 2 dobrý , 13 2 d´akovať , 14 2 dom , 15 2 dážď , 16 2 slovensko , 17 2 إِخْلَاصٌ , 18 2 súčasný , 19 2 око , 20 2 hrdina , 21 2 môcť , 22 2 bažant , 23 2 stroj , 24 2 حِكَايَةٌ , 25 2 آخِرَةٌ

jan 2015: 1 2 arbeid , 2 2 forfatter , 3 2 Slovenka , 4 2 slovák , 5 2 slovenčina , 6 2 izba , 7 2 počítač , 8 2 pivnica , 9 2 nedeľa , 10 1 щастя

fev 2015: 1 2 море , 2 1 сорочка

mar 2015: 1 2 حَالَةٌ , 2 2 شَخْصٌ , 3 2 حَبِيسٌ , 4 2 حِفْظٌ , 5 2 بَكِيمٌ , 6 2 بَيْضَةٌ , 7 2 مَحْفُوظٌ , 8 2 ثَابِتٌ , 9 2 ظُفْرٌ , 10 2 حَاسِدٌ , 11 2 plånbok , 12 2 sked , 13 2 förälder , 14 2 heta , 15 2 bokstav , 16 2 بَاسِلٌ

No data on this page have been normalized to 30 day months (as WMF does on certain traffic reports).
Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Quinta-feira, 7 de maio 2015 18:46

Dump file srwiktionary-20150410-pages-meta-history.xml.7z (full dump), size 7.8 Mb as 7z -> 238 Mb
Dump processed till Mar 31, 2015, on server stat1002, ready at Sat-11/04/2015-00:18 after 1 min, 57 sec.

Versão do script:2.6
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.