Estatísticas da Wikcionário sérvio

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist

Metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.
See also metrics definitions


 
Monthly counts & Quarterly rankings: junho 2015
 
DataWikcionaristasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
jun 2015+10%   +1%   -37%      0%
mai 2015+6%   +1%   -3%      0%
abr 2015+1%   +1%   -5%      0%
mar 2015+2%   +1%   +55%+1%+2%+4%0%0%0%+1%
fev 2015+4%   0%   +15%+1%+2%+2%0%0%0%0%
jan 2015+4%   0%   -64%+1%+1%+2%0%0%+15%+2%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
jun 2015102915 18 k45,5 466      2,1 k
mai 201593510218 k75,5 737      2,1 k
abr 201588117 18 k75,5 762      2,1 k
mar 201587217 18 k35,552880325 Mb1,4 M35 k86 k1731242,1 k
fev 201585312118 k35,552351925 Mb1,4 M34 k85 k1731242,1 k
jan 201582312 18 k25,551745324 Mb1,3 M33 k85 k1731242,1 k
dez 2014791325218 k55,55151,3 k24 Mb1,3 M33 k85 k1731082,1 k
nov 2014661425117 k65,550585924 Mb1,3 M31 k84 k172792,1 k
out 201452 1 17 k 5,54982223 Mb1,2 M30 k84 k172792,0 k
set 201452   17 k 5,5498523 Mb1,2 M30 k84 k172792,0 k
ago 201452   17 k 5,54984523 Mb1,2 M30 k84 k172792,0 k
jul 201452 4217 k15,54982,3 k23 Mb1,2 M30 k84 k172682,0 k
jun 201452 4217 k 5,450772923 Mb1,2 M28 k84 k171681,5 k
mai 201452 9417 k25,35081,3 k23 Mb1,2 M28 k84 k171681,5 k
abr 201452 9217 k55,350374923 Mb1,2 M26 k84 k171661,4 k
mar 20145229317 k35,34931,2 k22 Mb1,2 M24 k83 k166601,4 k
fev 20145029217 k 5,248671422 Mb1,2 M20 k83 k165601,4 k
jan 201448   17 k 5,248519822 Mb1,2 M19 k83 k165601,4 k
dez 201348 7117 k15,248578822 Mb1,2 M19 k82 k165601,4 k
nov 201348 5 17 k25,148320322 Mb1,2 M19 k81 k152601,4 k
out 20134816117 k45,148040722 Mb1,1 M19 k81 k124591,4 k
set 201347 6117 k55,247550521 Mb1,1 M19 k81 k98591,3 k
ago 201347 1 16 k 5,246815321 Mb1,1 M19 k81 k98591,3 k
jul 201347 2 16 k15,24679621 Mb1,1 M19 k81 k98591,3 k
jun 201347 5116 k15,246639821 Mb1,1 M19 k81 k98591,3 k
mai 201347 3 16 k15,24679221 Mb1,1 M19 k81 k98591,3 k
abr 201347 7116 k35,246643921 Mb1,1 M19 k80 k98591,3 k
mar 20134718216 k45,24631,4 k21 Mb1,1 M18 k80 k98591,2 k
fev 20134667 16 k25,145934120 Mb1,0 M18 k79 k96591,1 k
jan 201340   16 k 5,145688820 Mb1,0 M18 k79 k96591,1 k
dez 20124011 16 k 545622320 Mb1,0 M18 k78 k96591,1 k
nov 201239 1 16 k 545673220 Mb1,0 M18 k78 k96591,1 k
out 201239   16 k 545612020 Mb1,0 M18 k77 k95591,1 k
set 201239   16 k 545618320 Mb1,0 M18 k76 k95591,1 k
ago 201239   16 k 545659520 Mb1,0 M18 k76 k95501,1 k
jul 201239 1 16 k 4,945614120 Mb1,0 M18 k76 k95501,1 k
jun 201239 1 16 k 4,945613120 Mb1,0 M18 k75 k95501,1 k
mai 201239   16 k 4,945628320 Mb1,0 M18 k75 k95501,1 k
abr 201239 2 16 k 4,945632320 Mb1,0 M18 k75 k95501,1 k
mar 201239   16 k 4,945643520 Mb1,0 M18 k75 k95501,1 k
fev 20123911 16 k 4,945645720 Mb1,0 M18 k74 k95501,1 k
jan 201238 1 16 k 4,845677220 Mb1,0 M18 k74 k95501,1 k
dez 201138   16 k 4,84561,4 k20 Mb1,0 M18 k72 k95501,1 k
nov 201138   16 k 4,745617220 Mb1,0 M18 k70 k95501,1 k
out 201138 1 16 k 4,745628220 Mb1,0 M18 k70 k95501,1 k
set 201138 2 16 k14,745618120 Mb1,0 M18 k69 k95501,1 k
ago 20113811 16 k 4,745616620 Mb1,0 M18 k69 k95501,1 k
jul 201137   16 k 4,745615520 Mb1,0 M18 k68 k95501,1 k
jun 20113711 16 k 4,745687020 Mb1,0 M18 k68 k95501,1 k
mai 201136 2 16 k 4,645632720 Mb1,0 M18 k67 k95471,1 k
abr 20113611 16 k 4,645634220 Mb1,0 M18 k66 k95471,1 k
mar 201135 1 16 k 4,645727720 Mb1,0 M18 k66 k95471,0 k
fev 201135   16 k 4,545741220 Mb1,0 M18 k66 k95471,0 k
jan 201135   16 k 4,545724120 Mb1,0 M18 k65 k95471,0 k
dez 201035   16 k 4,545753720 Mb1,0 M18 k65 k95471,0 k
nov 20103523116 k 4,545729220 Mb1,0 M18 k64 k95471,0 k
out 201033 1116 k 4,545754520 Mb1,0 M18 k64 k94471,0 k
set 20103323116 k14,445747920 Mb1,0 M18 k63 k94471,0 k
ago 201031 2116 k 4,445740120 Mb1,0 M18 k63 k94471,0 k
jul 20103113116 k 4,445786420 Mb1,0 M18 k63 k94471,0 k
jun 201030 1116 k 4,346063720 Mb1,0 M18 k62 k94451,0 k
mai 201030 1116 k 4,346063220 Mb1,0 M18 k61 k94451,0 k
abr 201030 1116 k 4,246045220 Mb1,0 M18 k61 k94451,0 k
mar 201030 3116 k 4,246013 k20 Mb1,0 M18 k60 k94451,0 k
fev 201030 2116 k 3,446259821 Mb1,0 M18 k60 k94451,0 k
jan 201030 2116 k 3,346235121 Mb1,0 M17 k59 k94451,0 k
dez 20093012116 k 3,346241021 Mb1,0 M17 k59 k94441,0 k
nov 200929 1116 k 3,346250121 Mb1,0 M17 k58 k94431,0 k
out 200929 1116 k 3,346243321 Mb1,0 M17 k58 k94431,0 k
set 20092913116 k 3,246242321 Mb1,0 M17 k57 k94421,0 k
ago 200928 1116 k 3,246263321 Mb1,0 M17 k57 k94331,0 k
jul 20092813116 k 3,24622,4 k21 Mb1,0 M17 k56 k94331,0 k
jun 200927 2116 k 346438821 Mb1,0 M17 k56 k94321,0 k
mai 20092712116 k 346483221 Mb1,0 M17 k56 k94321,0 k
abr 200926 2116 k 2,94641,1 k21 Mb1,0 M17 k55 k94321,0 k
mar 20092612116 k 2,94632,9 k21 Mb1,0 M17 k54 k94321,0 k
fev 20092523216 k152,74611,8 k21 Mb1,0 M17 k50 k94321,0 k
jan 20092322115 k22,743826819 Mb993 k16 k49 k9434663
dez 200821   15 k 2,643611619 Mb986 k15 k49 k9430661
nov 200821   15 k 2,643611819 Mb986 k15 k49 k9430659
out 200821   15 k 2,643617519 Mb986 k15 k49 k9430659
set 200821 2 15 k 2,643631319 Mb986 k15 k49 k9430659
ago 200821 1 15 k 2,643565319 Mb985 k15 k48 k9430659
jul 200821   15 k 2,643542919 Mb985 k15 k48 k9430659
jun 200821 1 15 k 2,54351,0 k19 Mb985 k15 k47 k9530659
mai 200821 2 15 k 2,54351,2 k19 Mb984 k15 k46 k9530659
abr 200821 1 15 k 2,443514019 Mb984 k15 k44 k9530659
mar 20082111 15 k 2,443517619 Mb984 k15 k44 k9530659
fev 200820 1 15 k 2,443423119 Mb981 k15 k44 k9529659
jan 200820 1 15 k 2,343445619 Mb981 k15 k44 k9529657
dez 200720   15 k 2,343415719 Mb981 k15 k43 k9526657
nov 20072011 15 k 2,34345619 Mb980 k15 k43 k9525656
out 200719   15 k 2,343412919 Mb980 k15 k43 k9525656
set 200719 1 15 k 2,34347719 Mb980 k15 k42 k9525656
ago 200719   15 k 2,34344819 Mb980 k15 k42 k9525656
jul 200719 1 15 k 2,343474519 Mb980 k15 k42 k9525656
jun 200719 1 15 k 2,24344019 Mb980 k15 k42 k9525656
mai 200719   15 k 2,24341,2 k19 Mb980 k15 k42 k9525656
abr 200719 2 15 k 2,243369019 Mb980 k15 k40 k9525656
mar 20071913 15 k 2,143332219 Mb980 k15 k40 k9525656
fev 200718 2 15 k 2,143350519 Mb979 k15 k39 k9525655
jan 200718 1 15 k 2,143375119 Mb978 k15 k39 k9525655
dez 20061812 15 k 24331,2 k19 Mb976 k15 k38 k9525650
nov 200617   15 k 1,943356619 Mb977 k15 k38 k9525649
out 200617 3115 k 1,94331,4 k19 Mb976 k15 k37 k9525649
set 200617   15 k 1,84331,0 k19 Mb976 k15 k36 k9523648
ago 200617 2 15 k 1,743355419 Mb976 k15 k35 k9522647
jul 200617 1115 k1451,74338,7 k19 Mb975 k15 k34 k922647
jun 200617 3111 k2311,64328,6 k14 Mb698 k11 k26 k922586
mai 2006171313,9 k82,35471,0 k8,3 Mb351 k3,5 k18 k923583
abr 2006161213,6 k522,25462,0 k8,0 Mb327 k3,1 k16 k922580
mar 2006152312,1 k402,85191,8 k4,5 Mb187 k2,6 k8,6 k922565
fev 20061316183424,83921,3 k1,2 Mb65 k2,4 k3,4 k119514
jan 20061212 76613,55211971,1 Mb57 k1,4 k2,7 k112139
dez 20051124 73613,45125051022 kb53 k1,3 k2,7 k19137
nov 2005912 718 2,851148974 kb52 k1,1 k2,4 k 5137
out 20058 1 713 2,750851955 kb51 k1,1 k2,3 k 4135
set 20058111713 2,7507427954 kb51 k1,1 k2,3 k 4135
ago 2005722 712 2,1506101944 kb51 k1,1 k2,3 k12135
jul 20055 4 71021,9505132935 kb51 k1,0 k2,2 k12133
jun 2005511 662 1,946233793 kb44 k1,0 k1,6 k11133
mai 2005413 659 1,845765774 kb43 k9941,6 k11132
abr 20053 2165421,8448168747 kb42 k9941,5 k11129
mar 20053 1 585 1,738843565 kb33 k96468711128
fev 20053 21582111,6390463562 kb33 k95366911127
jan 2005323127191,7121452122 kb6,3 k3874311118
dez 20041   5 4,419634,4 kb179175 14
nov 20041   4 4,819343,4 kb177165 14
out 20041   4 3,8260 3,7 kb194145 14
set 20041   4 3,826063,7 kb194145 14
ago 20041   2 4,5444 2,5 kb165115 11
jul 20041   2 4,544422,5 kb165115 11
jun 20041   1 7183 775 5165  1
mai 20041   1 7183 775 5165  1
abr 20041   1 7183 775 5165  1
mar 20041   1 71831775 5165  1
fev 20041   1 6184 734 5164  1
jan 20041   1 6184 734 5164  1
dez 20031   1 61842734 5164  1
nov 20031   1 4126 277 1823   
out 20031   1 41261277 1823   
set 20031   1 31281280 1823   
ago 20031   1 2128 214 182    
jul 20031   1 21281214 182    
jun 200311  1 11521264 25     
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
The following table ranks this project in relation to projects in other languages with 1000+ articles
abr 2015314312 693855 67      140
jan 2015331315436948521665475064745756140
out 20144438624669625218103444863745662140
jul 2014443331276655501934444762705469140
abr 2014433220286437551842444766705470140
jan 2014444387496159591985434771705475140
out 2013443424376137581955414770706075140
jul 2013444152515958562094414770686373140
abr 2013433623425949551963404769676371140
jan 2013474583545867551861404868666170140
out 2012473682495564571695404767656169140
jul 2012464968545470551691404667636271140
abr 2012443953525466561674384467636171140
jan 2012443563505464561858374267636171140
out 2011424071485368541782364065595872140
jul 2011424483495069521777363965575872140
abr 2011423064454861561973333865575770140
jan 2011423580504761541971313665555565140
out 2010423586634460551964303363545464140
jul 2010423853684066561961293161525462140
abr 2010424686674058591970293159505063140
jan 2010423362623961651864273059504963140
out 2009424077603756611861272958484562140
jul 2009423751633659611735242953454463140
abr 2009435058633553621549212752444263140
jan 2009422759403349561556202551414162140
out 2008423674433263561355202550384160139
jul 2008413272453159581355192549363858139
abr 2008414263493064561362172345333656139
jan 2008414361512859581157151940323453139
out 200740397550266353964131737302853139
jul 2007374461442558541038121533282557138
abr 200733395447236151949111332282253138
jan 200731485944216649644111328272054138
out 200630394037195346633101028221950138
jul 200625405631166446147825183047138
abr 2006223237302773562271240222649138
jan 2006243040344040373740273343303949131
out 2005283341263336323247242640274161118
jul 2005353020253028292938212237222866113
abr 2005452423202624202023172030192269100
jan 200541111617271316161525283445166487
out 200454253016462111115450544749115674
jul 200445192610411855394140363394055
abr 200419785195441413141265819
jan 200416443164331010101064916
out 200314332143221010101064614
jul 20031354313322101091074613
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100ediçõesbytes
 WikcionaristasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikcionaristas (usuários registrados)
A = Wikcionaristas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikcionaristas que editaram pelo menos dez vezes desde que chegaram
C = Wikcionaristas que contribuíram cinco vezes ou mais este mês
D = Wikcionaristas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  2500  5  10  100  1000  10000  1  3  5  10  25  5  10  100  1  3  5  10  25  100  5  10  100 
jun 2015241915133   11   1       177632 111
mai 2015231610832   11           136542 11 
abr 2015231817107   22   2    2221813963122 
mar 2015272117169   22   4    111177531 11 
fev 20151814121091   11   41      135411 11 
jan 2015211612116   11   32      14552  111
dez 201436312521142   11   21      2410631 11 
nov 20144133251781        51      6328179411  
out 20143111    1    1       4211     
set 20142           3       51    11 
ago 201421     11   111     51    1  
jul 201412444422  111          42211    
jun 201411544421  111          7543     
mai 201411998641  11           108842    
abr 20141099982   11   1       149973    
mar 201411999931  11   2       138871    
fev 2014101097621  11   1       7111     
jan 201442     221  1       911      
dez 2013877651   221  3       114322    
nov 201396543        1       188754    
out 2013866661        1       169873    
set 2013996641   11   32      1611875    
ago 20134111    221  1       211      
jul 201332221   11           6431     
jun 2013765411                10531     
mai 201394331   11   22   1  117321 1  
abr 20131087731   32   2       118633    
mar 2013988872   331  411     1210984111 
fev 201387764   221  3       11877     
jan 20131      441          3     11 
abr 2015231817107   22   2    2221813963122 
jan 2015211612116   11   32      14552  111
out 20143111    1    1       4211     
jul 201412444422  111          42211    
abr 20141099982   11   1       149973    
jan 201442     221  1       911      
out 2013866661        1       169873    
jul 201332221   11           6431     
abr 20131087731   32   2       118633    
jan 20131      441          3     11 
out 201232     33           71    11 
jul 2012211     111          10     1  
abr 2012222     331  11      5331     
jan 2012311     442          2     31 
out 2011321     331  11      6     11 
jul 201152     111  2       31       
abr 201132111   221  2       62211    
jan 20111      221  1       61       
out 20105111111       11      6321     
jul 20103332211       2       2222     
abr 20104211111       1       62    11 
jan 20104322111       3       422211   
out 20096311111       21      411      
jul 20094333211  2111 1       5222  1  
abr 200974221111 1    1       421      
jan 2009732111   22   1       4321  11 
out 20082      221  1       422      
jul 20083      332  1       4        
abr 200811111   11   3       6        
jan 2008321     222  2       6        
out 20074      111  1111    31       
jul 2007321     111          221      
abr 20073321    111  1111    2111     
jan 200722111   111  1111    11111    
out 2006633331   111  3111    311      
jul 2006511111   2222 411     62111122 
abr 200610322111  111  411     53311    
jan 200654222   22   43221   644221   
out 20056211         11               
jul 2005115411   11   1       2        
abr 2005322111        3221    42221    
jan 20055332211       3111    211111   
out 2004                             
jul 20041                            
abr 2004                             
jan 2004                             
out 2003                             
jul 2003                             

 

Distribuição de edições de artigos por wikcionaristas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikcionaristasEdições total
1290100.0%36,190100.0%
314750.7%35,95699.4%
1010536.2%35,72398.7%
326422.1%34,99396.7%
1003612.4%33,64693.0%
316144.8%29,78882.3%
100093.1%27,21675.2%
316210.3%13,57937.5%
1000010.3%13,57937.5%

 

24 wikcionaristas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions
agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
Bubbah63UC2 02,9511567952fev 15, 201386433874-
Mickey MystiqueUC3 02,383117208fev 15, 201386418411571
MilicaStajicUC16 02704711nov 11, 2014230491--
Marija DabicUC25+11401672mai 21, 201539181--
Gaga.isaUC37 0824271nov 11, 201423023---
Sun wu kong93UC50+7540352415mai 30, 2015301713--
Jelenaaa93UC52+1839194-mai 23, 20153715---
Mmilica93UC54+20371921mai 23, 20153713---
TejkaUC55...373731jun 04, 2015251414--
MarijaS93UC63...32324-jun 05, 201524----
Branka93UC72-122252mai 27, 201533101--
Milena888UC76...202041jun 23, 201561010--
Zorica jankovicUC79...181877jun 04, 2015251717--
MajapandaUC82+1817931mai 27, 201533124--
Smiljana stojkovicUC83...171741jun 04, 2015251111--
Mirjana Sindjelic93UC84...17171412jun 04, 2015251414--
Jovana DubonjacUC91...15152-jun 03, 201526----
Dunja VasiljevicUC94...141433jun 05, 2015241212--
BD2412UC100-71211-jan 09, 2015171--1-
MilloshUC122+45113-jul 02, 200440141-5-
Okich93UC135+65531-mai 23, 20153753--
MefobicanUC146...44--jun 18, 20151111--
JAn DudíkUC210...224746jun 08, 201521--3838
PierpaoUC289...11--jun 20, 20159----

 

20 wikcionaristas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
InterwicketUC113,579jan 27, 20092344nov 08, 20101694
KasterUC41,680jan 27, 20053805nov 15, 2012956
KadzoUC51,540jan 11, 20092360abr 03, 20092278
Crveni BaronUC61,522nov 19, 20053509jul 25, 20063261
Linos MimiUC71,466fev 15, 2013864jul 11, 2014353
The Milica TomovicUC81,092fev 15, 2013864jul 14, 2014350
DungodungUC91,003mai 11, 20053701mar 22, 201599
GolijaUC10437jan 19, 20053813ago 14, 20053606
SrBotUC11415set 09, 20053580out 04, 20053555
ImperatorkAUC12406fev 18, 2013861abr 14, 201576
SashatoUC13396dez 19, 20053479dez 19, 20053479
Taychy2110UC14315dez 14, 2013562dez 28, 2014183
FunakoshiUC15273out 02, 2013635mai 21, 201539
NatalijaUC17263nov 07, 2014234mar 20, 2015101
PoletanicaUC18241fev 15, 2013864set 28, 2013639
Саша СтефановићUC19235dez 24, 20053474jan 12, 20092359
ItjustkindofhappenedUC20226nov 06, 2014235abr 30, 201560
Mika~srwiktionaryUC21223nov 06, 2014235mai 05, 201555
Milica91UC22183fev 13, 2015136abr 13, 201577
Hello micyUC23176nov 22, 2014219mai 09, 201551

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 4.438 edições foram feitas por usuários anônimos, de um total de 100.090 edições ( 4e %)
  


18 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
СлоботUC114,670jul 14, 20092176mar 26, 20101921--
CrveniBaronBotUC213,761mar 04, 20063404jul 23, 2006326311,259-
RobotGMwiktUC313,721jul 21, 20053630jun 06, 20082579--
Luckas-botUC44,967mar 03, 20092309jan 27, 2014518--
KamikazeBotUC54,524dez 17, 20101655mar 07, 2013844--
VolkovBotUC62,574ago 20, 20072870abr 05, 2013815--
YS-BotUC71,352set 07, 20121025jun 30, 2015---
SpaceBirdyBotUC81,324jun 23, 20082562dez 30, 20092007--
BodhisattvaBotUC91,216fev 02, 20082704ago 19, 20082505--
AvocatoBotUC10843out 27, 20111341ago 28, 2013670--
MonoBotUC11217jan 17, 20082720jun 14, 20082571--
Makecat-botUC1284nov 10, 2012961abr 05, 2013815--
FelixBotUC1362dez 16, 20053482jun 14, 20063302--
CarsracBotUC1444dez 22, 2012919mai 21, 2013769--
JAnDbotUC1537jun 10, 20121114abr 29, 201561--
AibotUC167mai 13, 20082603jun 13, 20082572--
GetoBot~srwiktionaryUC172fev 08, 20063428fev 08, 20063428--
EscarbotUC181set 02, 20063222set 02, 20063222--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110JpgOggPngSvg
jun 201520 k62993132527092928212      3442
mai 201520 k62793132527092924212      3442
abr 201520 k62793122527082924212      3342
mar 201520 k62593122527082924212     6033342
fev 201520 k62493122527082924212     4753342
jan 201520 k61993122527082924212     3873342
dez 201420 k61493122527082924212     9933342
nov 201419 k61388122526932923912     7433342
out 201419 k61062122526522922812     153342
set 201419 k61062122526522922812     23342
ago 201419 k60662122526522922812     53342
jul 201419 k60262122526522922812     20693342
jun 201419 k60262122526522922812     5953342
mai 201419 k6026292526472822812     13213 42
abr 201418 k6026292526462222812     6833 42
mar 201418 k5996192526402222812     11183 42
fev 201418 k5976192526392222812     6473 42
jan 201418 k5916192526392222812     93 42
dez 201318 k5836192526392222812     3133 42
nov 201318 k5826092516272222812     2003 42
out 201318 k5775492516122122812     3923 42
set 201318 k5665182516082122812     4063 41
ago 201318 k5454982516042122812     143 41
jul 201318 k5424982516042122712     593 41
jun 201318 k5384982516042122712     3603 41
mai 201318 k5364982516042122712     593 41
abr 201318 k5354982515862122712     3853 41
mar 201317 k5224982515852122712     6603 41
fev 201317 k5054772515632021812     1803 4 
jan 201317 k5004672515552021612     13 4 
dez 201217 k4984672515552021612     143 4 
nov 201217 k4934172515342021212     103 4 
out 201217 k4924172515342021212     73 4 
set 201217 k4874172515342021212     43 4 
ago 201217 k4834172515342021212      3 4 
jul 201217 k4774172515342021212     83 4 
jun 201217 k4694172515342021212     113 4 
mai 201217 k4604172515342021212     33 4 
abr 201217 k4554172515332021212     103 4 
mar 201217 k4434172515322021212     63 4 
fev 201217 k4384172515322021112     243 4 
jan 201217 k4304172515322021112     73 4 
dez 201117 k4264172515322021112      3 4 
nov 201117 k4214172515322021112     23 4 
out 201117 k4104172515312021112     103 4 
set 201117 k4044172515312021112     483 4 
ago 201117 k3994172515312020712     163 4 
jul 201117 k3954172515272020512     113 4 
jun 201117 k3884172515272020512     183 4 
mai 201117 k3844172515272020512     153 4 
abr 201117 k3784172515252020512     733 4 
mar 201117 k3704172515242018812     103 4 
fev 201117 k3694172515222018812     33 4 
jan 201117 k3644172515212018812     43 4 
dez 201017 k3574172515212018812     293 4 
nov 201017 k3514172515212018812     2833 4 
out 201017 k3474072515202018612     5393 4 
set 201017 k3444072515192018612     4773 4 
ago 201017 k3374072515182018312     3793 4 
jul 201017 k3224072515182018312     8533 4 
jun 201017 k3164072515122018312     6303 4 
mai 201017 k3034072515122018312     6253 4 
abr 201017 k3014072515122018312     4453 4 
mar 201017 k2974072515122018312     6413 4 
fev 201017 k2933972515082018312     5813 4 
jan 201017 k2893772515002015310     3473 4 
dez 200917 k2533072514902014510     3963 4 
nov 200917 k2493072514902014510     4953 4 
out 200917 k2483072514902014510     4273 4 
set 200917 k2452972514902014310     4233 4 
ago 200917 k2392972514892014310     6323 4 
jul 200917 k2382972514892014310     5333 4 
jun 200917 k2322972514652013910     3843 4 
mai 200917 k2292972514642013910     8223 4 
abr 200917 k2272772514642013910     10343 4 
mar 200917 k2172772514632013710     28763 4 
fev 200917 k2112772514632013710     17563 4 
jan 200916 k2052772514622013610     1283 4 
dez 200816 k204277251462201369     53 4 
nov 200816 k204277251462201369     13 4 
out 200816 k193277251462201369     43 4 
set 200816 k183277251462201369     203 4 
ago 200816 k181277251455201369     173 4 
jul 200816 k176277251455201369     43 4 
jun 200816 k174277251455201369     183 4 
mai 200816 k171267251455201369     193 4 
abr 200816 k164267251455201369     643 4 
mar 200816 k159267251455201369     363 4 
fev 200816 k155267251453201369     113 4 
jan 200816 k154267251452201369     143 4 
dez 200716 k150267251452201369     143 4 
nov 200716 k147267251452201359     123 4 
out 200716 k145267251452201359     63 4 
set 200716 k142267251452201359     103 4 
ago 200716 k140267251451201349     23 4 
jul 200716 k138267251451201349     93 4 
jun 200716 k138267251446201349     73 4 
mai 200716 k136267251441201349     33 4 
abr 200716 k136267251441201339     223 4 
mar 200716 k136267251441201329     813 4 
fev 200716 k13025725143620879     653 4 
jan 200716 k12719725138920759     743 4 
dez 200616 k12718725137920739     783 4 
nov 200616 k12617725137820719     43 4 
out 200616 k12317725037820719     4333 4 
set 200616 k11717725037820719     283 4 
ago 200616 k10816725037620659     213 4 
jul 200616 k10215725037220639     2943 4 
jun 200611 k9715718836720629     1693 4 
mai 20064,4 k8515718736520619     3113 4 
abr 20064,2 k7913718632820549     5663 4 
mar 20062,6 k7213716531020538     2393 4 
fev 20061,3 k6413714429420528     11113 4 
jan 20068955712513622617474     1423 2 
dez 20058632412413313615374     912 2 
nov 2005845161141081248224     302 2 
out 200583814104741098184     252 2 
set 200583814104741098184     4092 2 
ago 200583714104731078184     472 2 
jul 200583312104721078184     1062 2 
jun 200578511104721078184     252 2 
mai 20057811194711068184     512 2 
abr 20057731094711068174     1522 2 
mar 2005703542711021104     39  2 
fev 20056995427199194     461  2 
jan 200537944 719616      452    
dez 2004933 71              
nov 2004833 49              
out 20048 2 49              
set 20048 1 49              
ago 20043 1 49              
jul 20043   49              
jun 20042   49              
mai 20042   36              
abr 20042   36              
mar 20042   36              
fev 20042   36              
jan 20042   35              
dez 20032   31              
nov 20031                  
out 20031                  
set 20031                  
ago 20031                  
jul 20031                  
jun 20031                  

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

jun 2003: 1 1 MTA

set 2003: 1 1 MTA

dez 2003: 1 1 Аборигини

jul 2004: 1 1 Главна страна

set 2004: 1 1 Аверзија

nov 2004: 1 1 Аверзија

dez 2004: 1 1 Абак

jan 2005: 1 2 агора , 2 2 агонија , 3 2 агониста , 4 1 дифамија

fev 2005: 1 2 инструментализам , 2 1 ајгир

mar 2005: 1 1 аграрски

abr 2005: 1 2 Дисимилација , 2 2 Аранђел , 3 2 Авакум , 4 2 Горан , 5 2 среда , 6 1 дисјункција

mai 2005: 1 3 Виконт , 2 2 Виа факти , 3 1 дисјункција

jun 2005: 1 2 изотерма , 2 2 Капо , 3 1 интелигенција

jul 2005: 1 2 троугао , 2 2 столица , 3 1 ложа

ago 2005: 1 2 интелигенција , 2 2 Инкубатор , 3 2 јун , 4 1 дискант

set 2005: 1 3 агора , 2 2 Абукушу , 3 2 абаџија , 4 2 Андрија , 5 1 дифамија

out 2005: 1 2 инсигније , 2 1 дисоцијација

nov 2005: 1 2 беснило , 2 1 Инјектор

dez 2005: 1 3 Главна страна , 2 2 светлети , 3 2 Ваљево , 4 2 Broken/Градови у Црној Гори , 5 1 дисјункција

jan 2006: 1 3 нож , 2 3 авион , 3 2 Релација , 4 2 затварач , 5 2 nóż , 6 2 вечера , 7 2 господ , 8 2 живот , 9 1 терзија

fev 2006: 1 4 државе Европе/Енглески , 2 4 duae , 3 3 државе Европе/Азербејџански , 4 3 државе Европе/Албански , 5 3 meisie , 6 3 eins , 7 3 fast , 8 3 immer , 9 3 Öl , 10 3 Brot , 11 3 Butterbrot , 12 3 octo , 13 3 septem , 14 3 quinque , 15 3 quattuor , 16 3 tria , 17 3 tres , 18 2 државе Европе/Пољски , 19 1 адресанат

mar 2006: 1 3 Тренутни догађаји , 2 3 Бог , 3 3 Главна страна , 4 2 Капо , 5 2 аберација , 6 2 stupid , 7 2 један , 8 2 Боривој , 9 2 Авакум , 10 1 дисјункција

abr 2006: 1 2 дисоцијација , 2 2 Birne , 3 2 глава

mai 2006: 1 2 агониста , 2 2 безграничан , 3 2 бескорисност , 4 1 агонија

jun 2006: 1 2 дистрикт , 2 2 испорука , 3 2 Георгије , 4 1 дисоцијација

jul 2006: 1 2 интелигенција , 2 2 безболан

ago 2006: 1 2 агора , 2 2 Дисимилација

set 2006: 1 1 интервал

out 2006: 1 2 лежарина , 2 2 ave , 3 1 Ležarina

nov 2006: 1 1 Златибор

dez 2006: 1 3 талац , 2 3 престолонаследниковница , 3 2 март

jan 2007: 1 2 столица , 2 1 др.

fev 2007: 1 2 инсомнија , 2 1 фиг.

mar 2007: 1 2 Марко , 2 1 убрендити

abr 2007: 1 2 библиотека , 2 1 авилисантан

mai 2007: 1 1 абнорман

jun 2007: 1 1 indiferentnost

jul 2007: 1 1 Domicil

ago 2007: 1 1 Београд

set 2007: 1 2 Сотер , 2 2 аритметика

out 2007: 1 2 примаријус

nov 2007: 1 2 transparentnost

dez 2007: 1 2 мајстор , 2 2 ушур , 3 1 Мајстор

jan 2008: 1 2 Recesija

fev 2008: 1 3 ректор , 2 1 Ректор

mar 2008: 1 2 Рјечник архаизама

abr 2008: 1 1 Рјечник архаизама

mai 2008: 1 1 Рјечник архаизама

jun 2008: 1 1 Рјечник архаизама

jul 2008: 1 1 Рјечник архаизама

ago 2008: 1 1 Рјечник архаизама

set 2008: 1 1 Рјечник архаизама

out 2008: 1 1 diskinezije

nov 2008: 1 1 Рјечник архаизама

dez 2008: 1 1 Визионар

jan 2009: 1 2 волшебница , 2 2 жрец , 3 2 Мухамед , 4 2 свештеник , 5 1 фалетарица

fev 2009: 1 2 ст. , 2 2 абе , 3 2 двор , 4 2 абракадабра , 5 2 абака , 6 2 Авлија , 7 2 абдицирати , 8 2 universe , 9 2 имам , 10 2 вулкан , 11 1 аблујирати

mar 2009: 1 2 logistika , 2 2 абревијатура , 3 2 им. , 4 2 ж. , 5 2 абортус , 6 2 abnormalan

abr 2009: 1 3 аперцепција , 2 2 Словенија , 3 2 хаван

mai 2009: 1 2 експлоратер , 2 2 Amato , 3 2 Amando , 4 2 Abdieso , 5 2 губа , 6 1 Blaziran

jun 2009: 1 2 Acacio , 2 1 neko

jul 2009: 1 2 џивџан , 2 2 мачка , 3 2 бабине , 4 2 адмирал , 5 1 ахенија

ago 2009: 1 3 биотоп

set 2009: 1 3 морфем , 2 2 носилац

out 2009: 1 2 hakeri , 2 2 адреса

nov 2009: 1 1 морфема

dez 2009: 1 2 ορίστε , 2 1 egzegeza

jan 2010: 1 2 Рјечник архаизама , 2 1 војн.

fev 2010: 1 3 laberint , 2 3 милијарда , 3 2 јул , 4 2 судбина , 5 2 Рјечник архаизама , 6 2 Александра , 7 2 абулија , 8 1 септембар

mar 2010: 1 2 пијаца , 2 2 Naissus , 3 1 Yi+Ze

abr 2010: 1 2 црна , 2 2 кушати , 3 2 Meyer

mai 2010: 1 1 септембар

jun 2010: 1 2 један , 2 1 зидухија

jul 2010: 1 2 биол. , 2 2 ентузијазам , 3 2 в. , 4 2 January

ago 2010: 1 3 Нови Сад , 2 1 Словенија

set 2010: 1 2 Врање , 2 2 TCP , 3 2 CDP , 4 2 RIP , 5 2 EIGRP , 6 1 лажица

out 2010: 1 2 Hassan , 2 1 Варцарка

nov 2010: 1 2 Hassan , 2 2 среда , 3 1 nůž

dez 2010: 1 2 Кина , 2 1 Фјорд

jan 2011: 1 1 Насловна страна

fev 2011: 1 1 Бијоград

mar 2011: 1 1 тахилалија

abr 2011: 1 1 јелен

mai 2011: 1 2 Сребрница , 2 1 Сребреница

jun 2011: 1 2 Београд , 2 1 φαΐ

jul 2011: 1 2 dvanaest

ago 2011: 1 1 שלום

set 2011: 1 1 Ευγενία

out 2011: 1 1 битва

nov 2011: 1 1 Рјечник архаизама

jan 2012: 1 2 Вампир

fev 2012: 1 1 Централна Африка

mar 2012: 1 1 marijana

abr 2012: 1 1 курија

mai 2012: 1 1 Конавли

jun 2012: 1 1 Стрешељ

jul 2012: 1 1 аламан

set 2012: 1 1 Šarlin

out 2012: 1 1 аб

nov 2012: 1 2 Босна и Херцеговина , 2 1 абажур

dez 2012: 1 1 Додатак:Unicode/Арапски

jan 2013: 1 1 пророк

fev 2013: 1 3 نَهْرٌ , 2 3 سَلامٌ , 3 2 مَضِيقُ بَحْرِيٍّ , 4 2 شَعَرٌ , 5 2 حَاجِبٌ , 6 2 لِحْيَةٌ , 7 2 وَجْهٌ , 8 2 أَنْفٌ , 9 2 نِمْرٌ , 10 2 فَمٌ , 11 2 أُذُنٌ , 12 2 لِسَانٌ , 13 1 وادِي

mar 2013: 1 4 أَثَرٌ , 2 3 رِيحٌ , 3 3 أَسَدٌ , 4 3 غَزالَةٌ , 5 3 كَلْبٌ , 6 3 فِيلٌ , 7 3 جَبْهَةٌ , 8 3 عَظَمٌ , 9 3 فَمٌ , 10 3 أُذُنٌ , 11 3 مَسْرَحٌ , 12 3 ثَقَافَةٌ , 13 3 سَلامٌ , 14 3 إِنْسَانٌ , 15 2 شَرْقٌ , 16 2 نَسْرٌ , 17 2 هِلالٌ , 18 2 قَمَرٌ , 19 2 شَمْسٌ , 20 2 ثَدْيٌ , 21 2 صَدْرٌ , 22 2 رِجْلٌ , 23 2 ذِرَاعٌ , 24 1 مُطْرِبٌ

abr 2013: 1 3 صَفٌّ , 2 3 نَشِيدٌ , 3 3 ذَهَبٌ , 4 3 شَرْقٌ , 5 2 إِقْلِيمٌ , 6 2 بَرْجَلٌ , 7 2 عَالَمٌ , 8 2 قُفّازٌ , 9 2 كَنيِسَةٌ , 10 2 مِحْفَظَةٌ , 11 2 لُغَةٌ , 12 2 بَيْتٌ , 13 2 شِهابٌ , 14 2 أَلماسٌ , 15 2 فَحْمٌ , 16 2 زُمُرُّدٌ , 17 2 قُطْبٌ , 18 2 جُغْرافِيا , 19 2 سَهْلٌ , 20 2 مَمْلَكَةٌ , 21 1 قَمِيصٌ

mai 2013: 1 2 كَتَبَ , 2 2 بُرْجٌ , 3 1 نَشِيطٌ

jun 2013: 1 2 بِدَايَةٌ , 2 2 وِكالَةٌ , 3 2 صَنْدُوقٌ , 4 2 شَرِكَةٌ , 5 2 هاتِفٌ , 6 2 حَضَارَةٌ , 7 2 مُحَاضَرَةٌ , 8 2 رَفٌّ , 9 2 وِزارَةٌ , 10 2 مَحْكَمَةٌ , 11 2 فِهْرِسٌ , 12 2 تِلمِيذٌ , 13 2 مَعْدِنٌ , 14 2 مُطْرِبٌ , 15 2 مَكْتَبٌ , 16 1 مَطْعَمٌ

jul 2013: 1 1 وَطَنٌ

ago 2013: 1 1 Нови Пазар

set 2013: 1 3 عَظِيمٌ , 2 3 ضَعِفٌ , 3 2 عَمِيقٌ , 4 2 عِمْلاقٌ , 5 2 حزين , 6 2 بَعيدٌ , 7 2 مُتَعَالٍ , 8 2 عَقْلانِيٌّ , 9 2 رَقِيقٌ , 10 2 عَادِلٌ , 11 2 كَسولٌ , 12 2 حَكِيمٌ , 13 1 حَزِينٌ

out 2013: 1 2 ضِفَّةٌ , 2 2 تَجْديدٌ , 3 2 إِيِجابِيٌ , 4 2 تاجِرٌ , 5 2 صَامِتٌ , 6 2 مَسافَةٌ , 7 2 شاعِرٌ , 8 1 وَقُورٌ

nov 2013: 1 2 مِينَاءُ , 2 2 رَقْصَةٌ , 3 1 طَاوِلَةٌ

dez 2013: 1 3 حافَةٌ , 2 2 جانِبٌ , 3 2 جامِعٌ , 4 2 دِينٌ , 5 2 جَنَّةٌ , 6 2 جُمْلَةٌ , 7 2 جَمالٌ , 8 2 جَدْوَلٌ , 9 2 جِدارٌ , 10 2 جارٌ , 11 2 تَمْرِينٌ , 12 2 جِدِّيٌّ , 13 2 تَقْويمٌ , 14 2 تَحْريرٌ , 15 2 تاريخٌ , 16 2 بَنْكٌ , 17 2 بابٌ , 18 2 حِذَاءٌ , 19 2 بَدْلَةٌ , 20 2 تِلمِيذٌ , 21 1 днсонирати

jan 2014: 1 1 حَجْمٌ

fev 2014: 1 3 سورٌ , 2 3 إِنْحِطاطٌ , 3 3 أُمَّةٌ , 4 3 أَهْلٌ , 5 3 إِجْتِمَاعٌ , 6 3 شاعِرٌ , 7 3 مُتَعاطِفٌ , 8 3 أَمْنٌ , 9 3 إِقتِصادٌ , 10 3 إِذَاعَةٌ , 11 3 أَدَبٌ , 12 2 سَلُّمٌ , 13 2 سيجارَةٌ , 14 2 بَطِيخَةٌ , 15 2 حَفْلَةٌ , 16 2 صورَةٌ , 17 2 سُؤالٌ , 18 2 شارِعٌ , 19 2 وَقُورٌ , 20 2 مُسْتَقِرٌّ , 21 2 خَاصٌّ , 22 2 شَيْخٌ , 23 2 رَئِيسٌ , 24 2 بَارِدٌ , 25 2 مُتَأَلِّقٌ

mar 2014: 1 3 لَفْظٌ , 2 3 غُرْفَةٌ , 3 3 صَلاةٌ , 4 3 صَديقٌ , 5 3 أَحْمَرُ , 6 3 جاهِلٌ , 7 3 نَارٌ , 8 2 عَمَلَ , 9 2 صَدَرَ , 10 2 بَلِدَ , 11 2 خَضِلَ , 12 2 سَلَخَ , 13 2 جَمُلَ , 14 2 رَسَمَ , 15 2 غَلَقَ , 16 2 نَظَرَ , 17 2 سَمِعَ , 18 2 فَتَحَ , 19 2 غَيْمٌ , 20 2 سَكَنَ , 21 2 جَلَبَ , 22 2 دَرَسَ , 23 2 لَوْنٌ , 24 2 قَرْنٌ , 25 2 سَلُّمٌ

abr 2014: 1 3 هَجَمَ , 2 2 رَحِمَ , 3 2 ي , 4 2 قَوْمٌ , 5 2 ذَبَحَ , 6 2 تَجَرَ , 7 2 حَذِقَ , 8 2 عَهِدَ , 9 2 مَزَقَ , 10 2 غَلَبَ , 11 2 شَرَعَ , 12 2 خَمَرَ , 13 2 دارٌ , 14 2 صَبَرَ , 15 2 شَغَلَ , 16 2 عَمَلَ , 17 2 صَلَحَ , 18 2 بَلِدَ , 19 2 خَضِلَ , 20 2 حَمَلَ , 21 2 جَمَعَ , 22 2 صَرَفَ , 23 2 خَرَجَ , 24 2 دَخَلَ , 25 2 شَرِبَ

mai 2014: 1 6 أَخْبَرَ , 2 4 شَرِكَ , 3 4 جَمُلَ , 4 4 حَصَدَ , 5 4 حَشَدَ , 6 4 حَسَبَ , 7 4 بَحَثَ , 8 4 حَرَمَ , 9 4 كَسَرَ , 10 4 سَجَدَ , 11 4 عَرَضَ , 12 4 نَظَرَ , 13 4 صَرَفَ , 14 4 بَلَغَ , 15 4 نَشَرَ , 16 4 نَهَضَ , 17 4 كَتَبَ , 18 3 ثَبَتَ , 19 3 بَسَطَ , 20 3 جَدَلَ , 21 3 نَتيجَةٌ , 22 3 سَرَدَ , 23 3 بَذَلَ , 24 3 حَصَلَ , 25 3 نَقَلَ

jun 2014: 1 3 حَيَوانٌ , 2 3 كَتَبَ , 3 2 إِلْزِمْ شُغُلَك , 4 2 رَوْحٌ , 5 2 الله , 6 2 حَياةٌ , 7 2 حائطٌ , 8 2 شَغَلَ , 9 2 سَلُّمٌ , 10 2 جارٌ , 11 2 إِنْحِطاطٌ , 12 2 إِمْتِحانٌ , 13 2 إِمْرَأَةٌ , 14 2 فَخورٌ , 15 1 نبي

jul 2014: 1 3 شَهْرٌ , 2 3 خَفَتَ , 3 3 جِهَةٌ , 4 3 وَقَفَ , 5 3 عَصْرِيٌّ , 6 3 فَحَصَ , 7 3 نَهَضَ , 8 3 نَافِذَةٌ , 9 3 شَعْبِيٌّ , 10 3 شَديدٌ , 11 3 تِلْقَائِيٌّ , 12 3 شَاعِرِيٌّ , 13 3 نَاقِدٌ , 14 3 بَارِدٌ , 15 3 مُتَأَلِّقٌ , 16 3 مُتَهَوِّسٌ , 17 3 سَاخِرٌ , 18 3 أُمَّةٌ , 19 3 مَوْضُوعِيٌّ , 20 3 مُتَوَتَّرٌ , 21 3 ذَوَّاقٌ , 22 3 عَصَبِيٌّ , 23 3 أَصْفَرُ , 24 3 أَسْوَدُ , 25 3 أَزْرَقُ

ago 2014: 1 1 Ogos

set 2014: 1 1 Оџаци

out 2014: 1 1 إِسْمٌ

nov 2014: 1 4 ord , 2 4 bord , 3 4 huvud , 4 3 mann , 5 3 dricka , 6 3 ansikte , 7 3 dörr , 8 3 bror , 9 3 مُتَرْجِمٌ , 10 3 قَهْوَةٌ , 11 3 äpple , 12 3 vatten , 13 3 fågel , 14 3 rum , 15 3 hus , 16 3 fråga , 17 3 hund , 18 2 مُدَّةٌ , 19 2 دَائِرَةٌ , 20 2 أُسْبُوعٌ , 21 2 dum , 22 2 kvinne , 23 2 kone , 24 2 søster , 25 2 gutt

dez 2014: 1 4 läsa , 2 3 ulica , 3 3 leva , 4 3 bröd , 5 3 sol , 6 3 fönster , 7 2 výborný , 8 2 česať , 9 2 أَرْمَلَةٌ , 10 2 byť , 11 2 modrý , 12 2 dobrý , 13 2 d´akovať , 14 2 dom , 15 2 dážď , 16 2 slovensko , 17 2 إِخْلَاصٌ , 18 2 súčasný , 19 2 око , 20 2 hrdina , 21 2 môcť , 22 2 bažant , 23 2 stroj , 24 2 حِكَايَةٌ , 25 2 آخِرَةٌ

jan 2015: 1 2 arbeid , 2 2 forfatter , 3 2 Slovenka , 4 2 slovák , 5 2 slovenčina , 6 2 izba , 7 2 počítač , 8 2 pivnica , 9 2 nedeľa , 10 1 щастя

fev 2015: 1 2 море , 2 1 сорочка

mar 2015: 1 2 حَالَةٌ , 2 2 شَخْصٌ , 3 2 حَبِيسٌ , 4 2 حِفْظٌ , 5 2 بَكِيمٌ , 6 2 بَيْضَةٌ , 7 2 مَحْفُوظٌ , 8 2 ثَابِتٌ , 9 2 ظُفْرٌ , 10 2 حَاسِدٌ , 11 2 plånbok , 12 2 sked , 13 2 förälder , 14 2 heta , 15 2 bokstav , 16 2 بَاسِلٌ

abr 2015: 1 3 سَعِيدٌ , 2 3 حَنَّانٌ , 3 3 تَاجٌ , 4 2 klänning , 5 2 järn , 6 2 nyckelpiga , 7 2 kylskåp , 8 2 handduk , 9 2 vinbär , 10 2 blåbär , 11 2 حَقِيقَةٌ , 12 2 مَرِيضٌ , 13 2 غَلِيظٌ , 14 2 خَالِصٌ , 15 2 مُمْتِعٌ , 16 2 حَرَمٌ , 17 2 تَحْلِيلٌ , 18 2 ظُفْرٌ , 19 2 حَاسِدٌ , 20 2 بَأْسٌ , 21 2 تَيْسٌ , 22 2 تَزَوُّجٌ , 23 2 ألَمٌ , 24 2 رَجْعٌ , 25 2 أَكْلٌ

mai 2015: 1 2 , 2 2 , 3 2 , 4 2 , 5 2 , 6 2 , 7 2 并且 , 8 2 表达 , 9 2 , 10 2 , 11 2 , 12 2 , 13 2 , 14 2 , 15 2 , 16 1

jun 2015: 1 2 إِشْتَجَرَ , 2 2 أَخَذَ , 3 2 أَجِلَ , 4 1 إِكْتَشَفَ

No data on this page have been normalized to 30 day months (as WMF does on certain traffic reports).
Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Quinta-feira, 30 de julho 2015 22:11

Dump file srwiktionary-20150702-stub-meta-history.xml.gz (edits only), size 6.0 Mb as gz -> 51 Mb
Dump processed till Jun 30, 2015, on server stat1002, ready at Sat-04/07/2015-21:44 after 58 sec.

Versão do script:2.6
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.