Estatísticas da Wikcionário siswati

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist

Metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.
See also metrics definitions


 
Monthly counts & Quarterly rankings: outubro 2012
 
DataWikcionaristasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
out 20127   594 2,8 13      14
set 20127   594 2,8 23      14
ago 20127   594 2,7 2      14
jul 20127   594 2,7 2      14
jun 20127   594 2,7 17      14
mai 20127   594 2,7 19      14
abr 20127   594 2,7 10      14
mar 20127   594 2,7 11      14
fev 20127   594 2,694788 kb4,6 k6701,4 k13714
jan 20127   594 2,6941688 kb4,6 k6701,3 k13714
dez 20117   594 2,6944988 kb4,6 k6701,3 k13714
nov 20117   594 2,5941487 kb4,6 k6701,3 k13714
out 20117   594 2,594487 kb4,6 k6701,2 k13714
set 20117   594 2,594387 kb4,6 k6701,2 k13714
ago 20117   594 2,594187 kb4,6 k6701,2 k13714
jul 20117   594 2,594 87 kb4,6 k6701,2 k13714
jun 20117   594 2,594987 kb4,6 k6701,2 k13714
mai 20117   594 2,594887 kb4,6 k6701,2 k13714
abr 20117   594 2,594587 kb4,6 k6701,2 k13714
mar 20117   594 2,4941687 kb4,6 k6701,2 k13714
fev 20117   594 2,494786 kb4,6 k6691,2 k13714
jan 20117   594 2,4941086 kb4,6 k6691,2 k13714
dez 20107   594 2,4941586 kb4,6 k6691,2 k13714
nov 20107 1 594 2,4941286 kb4,6 k6691,2 k13714
out 20107 1 591 2,4952386 kb4,6 k6661,1 k13714
set 20107 1 591 2,394685 kb4,6 k6641,1 k13714
ago 20107 1 591 2,3942185 kb4,6 k6641,1 k13714
jul 20107 1 591 2,3951885 kb4,6 k6641,1 k13714
jun 20107 1 591 2,2951085 kb4,6 k6641,1 k13714
mai 20107 1 591 2,2951685 kb4,6 k6641,1 k13714
abr 20107 1 591 2,2951484 kb4,6 k6641,1 k13714
mar 20107 2159172,29537484 kb4,6 k6641,1 k13714
fev 20107222370112,511264253 kb2,1 k1559001077
jan 20105   65 4,2184118 kb97799315572
dez 20095   65 4,2182 18 kb96497315572
nov 20095   65 4,2182218 kb96497315572
out 20095   65 4,1182 18 kb96497315572
set 20095   65 4,1182118 kb96497315572
ago 20095   65 4,1182 18 kb96497314572
jul 20095   65 4,1182118 kb96497314572
jun 20095   65 4,1182 18 kb96497313572
mai 20095   65 4,1182 18 kb96497313572
abr 20095   65 4,1182 18 kb96497313572
mar 20095   65 4,1182618 kb96497313572
fev 20095   65 4182 18 kb96497311572
jan 20095   65 4182118 kb96497311572
dez 20085   65 4182 18 kb96497311572
nov 20085   65 4182 18 kb96497311572
out 20085   65 4182 18 kb96497311572
set 20085   65 41821118 kb96497311572
ago 20085   65 3,8192117 kb91197301572
jul 20085   65 3,8192417 kb91197300572
jun 20085   64 3,8192317 kb91197280572
mai 20085   64 3,8193417 kb92798278572
abr 20085 1 64 3,71962017 kb90697272572
mar 20085   60 3,6209716 kb83286256571
fev 20085   5813,61973815 kb76973244571
jan 20085   30 5,7191212 kb70268234571
dez 20075 1 30 5,6176811 kb66271219571
nov 20075   30 5,4174910 kb63573215271
out 20075   29 5,2174110 kb63473215 71
set 20075 1 2915,21745410 kb63473215 71
ago 20075 1 10 9,7333195,2 kb24920152 71
jul 2007533 10 7,8176624,4 kb236 132 71
jun 20072   7 2,3405 2,3 kb53 127 91
mai 20072   7 2,3405 2,3 kb53 127 91
abr 20072   7 2,3405 2,3 kb53 127 91
mar 20072   7 2,3405 2,3 kb53 127 91
fev 2007211 7 2,3405112,3 kb53 127 91
jan 20071   1 541 1,4 kb4 127  1
dez 20061   1 541 1,4 kb4 127  1
nov 20061   1 541 1,4 kb4 127  1
out 20061   1 541 1,4 kb4 127  1
set 20061   1 541 1,4 kb4 127  1
ago 20061   1 541 1,4 kb4 127  1
jul 20061   1 54121,4 kb4 127  1
jun 20061   1 341 1,3 kb4 127   
mai 20061   1 341 1,3 kb4 127   
abr 20061   1 341 1,3 kb4 127   
mar 20061   1 341 1,3 kb4 127   
fev 20061   1 34111,3 kb4 127   
jan 20061   1 24111,3 kb4 127   
dez 200511  1 1111,3 kb  127   
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
 WikcionaristasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikcionaristas (usuários registrados)
A = Wikcionaristas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikcionaristas que editaram pelo menos dez vezes desde que chegaram
C = Wikcionaristas que contribuíram cinco vezes ou mais este mês
D = Wikcionaristas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  5  10  1  3  5  1  3  5  10  25  5  10 
out 2012     111   41     
set 2012     11    221    
ago 2012       3   611    
jul 2012           61     
jun 2012     11    311    
mai 20121    211   42     
abr 2012     1 11  4111   
mar 2012     112   311    
fev 2012     1 1   2211   
jan 2012     11    31   21
dez 2011     221   421  1 
nov 2011     1131  7211   
out 20111          51   11
set 2011           21     
ago 2011       1   7      
jul 2011       1   411    
jun 2011     1 1   31   11
mai 2011     1     411    
abr 2011           1111   
mar 20111    11           
fev 2011     1     211    
jan 2011     11    3      
dez 2010     11    51     
nov 2010111     1   311    
out 20102111        2      
set 2010111     1   42     
ago 20101111    3   5221   
jul 20101111               
jun 20101111        4111 1 
mai 20101111    1   11     
abr 20101111        621    
mar 20102222211  1   41111  
fev 20102222221  2   211    
jan 20101      1   1111   
out 2012     111   41     
jul 2012           61     
abr 2012     1 11  4111   
jan 2012     11    31   21
out 20111          51   11
jul 2011       1   411    
abr 2011           1111   
jan 2011     11    3      
out 20102111        2      
jul 20101111               
abr 20101111        621    
jan 20101      1   1111   
out 2009           2      
jul 20091          1      
abr 2009           211    
jan 20091          311  11
out 2008       1   322    
jul 2008       1   411    
abr 2008211     2   211    
jan 20081      1   3111   
out 20071      31  5321   
jul 200744331   1   53222  
abr 2007                  
jan 2007           3      
out 2006           2      
jul 20061          3      
abr 2006           2      
jan 20061      1   42     

 

Distribuição de edições de artigos por wikcionaristas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikcionaristasEdições total
118100.0%1,307100.0%
3738.9%1,29398.9%
10633.3%1,28798.5%
32316.7%1,24995.6%
100316.7%1,24995.6%
316211.1%1,13186.5%

 

17 wikcionaristas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
SibandeUC1718jan 05, 20101029mar 30, 2010945
InterwicketUC2413mar 20, 20091320nov 07, 2010723
JatrobatUC3118jul 15, 20071934out 09, 2010752
OoswesthoesbesUC418jul 23, 20071926jul 24, 20071925
Jakoli4UC510fev 15, 20072084fev 15, 20072084
Kanon6917UC610jul 21, 20071928jul 23, 20071926
MF-WarburgUC76jul 14, 20071935nov 22, 20071804
KoavfUC82jul 31, 20062283jul 31, 20062283
MadudulaUC92abr 18, 20081656mai 29, 20081615
ManieUC102mar 09, 20091331mar 09, 20091331
GangleriUC111jan 05, 20062490jan 05, 20062490
Az1568UC121fev 14, 20072085fev 14, 20072085
JorunnUC131nov 22, 20071804nov 22, 20071804
RowenaUC141nov 04, 20091091nov 04, 20091091
MalafayaUC151mar 04, 2011606mar 04, 2011606
John VandenbergUC161out 26, 2011370out 26, 2011370
Piet-cUC171mai 22, 2012161mai 22, 2012161

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 89 edições foram feitas por usuários anônimos, de um total de 1668 edições ( 5e %)
  


7 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
Luckas-botUC1146dez 17, 2010683mai 20, 2012163--
KamikazeBotUC249dez 04, 2011331ago 04, 201287--
HydrizBotUC333set 15, 201245out 31, 2012---
AvocatoBotUC423nov 18, 2011347out 30, 2012---
VolkovBotUC516set 15, 20081506out 28, 20122--
SpaceBirdyBotUC64jul 21, 20081562ago 06, 20081546--
RobotGMwiktUC71mai 17, 20081627mai 17, 20081627--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110
out 201260835610 4121140       
set 201260835210 4121140       
ago 201260834510 4121140       
jul 201260833410 4121140       
jun 201260832910 4121140       
mai 201260831810 4121140       
out 201260835610 4121140       
jul 201260833410 4121140       
abr 201260831110 4121140       
jan 201260827810 4121140       
out 201160825310 4120140      1
jul 201160823610 4120140       
abr 201160821110 4120140      1
jan 201160819310 4120140       
out 201060518110 3120140      22
jul 201060515710 3120140      18
abr 201060513210 3120140      14
jan 2010671169 3112131      1
out 200967999 3112131       
jul 200967899 3112131      1
abr 200967859 3111131       
jan 200967639 3111131      1
out 200867459 3111131       
jul 200867319 3110131       
abr 200866268 3110130      9
jan 200831207 3108130      2
out 200730147 2107119      1
jul 200711134 279 5      62
abr 200789   67         
jan 200728   67         
out 200627   65         
jul 200626   65         
abr 200615   62         
jan 200615   61         

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

jan 2006: 1 1 Likhasi Lelikhulu

fev 2006: 1 1 Likhasi Lelikhulu

jul 2006: 1 1 main Page

fev 2007: 1 2 Likhasi Lelikhulu , 2 1 yebo

jul 2007: 1 4 sawubona , 2 3 cha , 3 3 yebo , 4 1 likhefi

ago 2007: 1 1 likhefi

set 2007: 1 1 tíncwâdzi

out 2007: 1 1 Likhasi Lelikhulu

nov 2007: 1 3 Likhasi Lelikhulu

dez 2007: 1 1 sítfûnywa

jan 2008: 1 1 kuhúmusha

fev 2008: 1 1 kúkhólwa

mar 2008: 1 1 Bhimbídvwane

abr 2008: 1 1 Main Page

mai 2008: 1 1 siyinqaba

jun 2008: 1 1 siyinqaba

set 2008: 1 1 siSwati

jan 2009: 1 1 Likhasi Lelikhulu

mar 2009: 1 2 síNgísi , 2 2 înjá , 3 1 kune

jul 2009: 1 1 kune

set 2009: 1 1 kune

nov 2009: 1 2 ngikhona

jan 2010: 1 1 kubili

fev 2010: 1 2 Lisontfo , 2 2 magama , 3 2 ligama , 4 2 Wiktionary , 5 2 lima , 6 2 sala , 7 2 susa , 8 2 yaya , 9 2 faka , 10 2 hlaba , 11 2 tinja , 12 2 inja , 13 2 umchamo , 14 1 lipentjisi

mar 2010: 1 2 umbala , 2 2 imililo , 3 2 umlilo , 4 2 imilomo , 5 2 umlomo , 6 2 ummeli , 7 2 umndeni , 8 2 umnyango , 9 2 umoya , 10 2 umshini , 11 2 batali , 12 2 impala , 13 2 tinyoni , 14 2 sento , 15 2 zuba , 16 2 ingwe , 17 2 inyoka , 18 2 timvu , 19 2 imvu , 20 2 imbuti , 21 2 bafana , 22 2 umfana , 23 2 inkosi , 24 2 inkulungwane , 25 2 lishumi

abr 2010: 1 1 impala

mai 2010: 1 1 umlilo

jun 2010: 1 1 umgwaja

jul 2010: 1 1 umndeni

ago 2010: 1 1 umbala

set 2010: 1 1 ingwe

out 2010: 1 1 umlomo

nov 2010: 1 1 laba

mar 2011: 1 1 ingwe

abr 2011: 1 1 INgongoni

out 2011: 1 1 sawubona

mai 2012: 1 1 Likhasi Lelikhulu

Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Terça-feira, 27 de novembro 2012 17:45

Dump file sswiktionary-20121103-stub-meta-history.xml.gz (edits only), size 192 kb as gz -> 1.4 Mb
Dump processed till Oct 31, 2012, on server stat1, ready at Sun-04/11/2012-01:11 after 5 sec.

Versão do script:2.6
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.