Estatísticas da Wikcionário télugo

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist

Metrics have been collected from a full archive dump, which contains all revisions of every article, meta data and raw content.
See also metrics definitions


 
Monthly counts & Quarterly rankings: fevereiro 2015
 
DataWikcionaristasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
fev 2015+2%   0%   -87%0%0%0%0%0%0%0%
jan 20150%   +1%   -37%+1%+1%+1%+1%0%0%0%
dez 20140%   +2%+58%  +182%+2%+2%+4%+2%0%0%0%
nov 20140%   +1%+27%  -4%+1%+1%+3%+1%+1%+23%0%
out 20140%   +1%-52%  -34%+1%+1%+2%+1%+1%0%0%
set 20140%   +2%+108%  +60%+2%+2%+3%+2%+1%0%0%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
fev 20156214398 k85,2366766119 Mb4,4 M389 k1,6 M2,9 k1,0 k6,0 k
jan 201561 3298 k185,23665,7 k118 Mb4,4 M388 k1,6 M2,9 k1,0 k6,0 k
dez 201461 5397 k525,13659,1 k117 Mb4,4 M384 k1,6 M2,9 k1,0 k6,0 k
nov 201461 3296 k335,13623,2 k115 Mb4,3 M370 k1,5 M2,9 k1,0 k6,0 k
out 201461 2295 k265,23603,4 k113 Mb4,2 M360 k1,5 M2,9 k8276,0 k
set 201461 2294 k545,23595,1 k112 Mb4,2 M353 k1,5 M2,8 k8256,0 k
ago 201461 3292 k265,23553,2 k110 Mb4,1 M342 k1,5 M2,8 k8256,0 k
jul 201461 3291 k255,23532,5 k108 Mb4,0 M336 k1,5 M2,8 k8246,0 k
jun 201461 4291 k205,23523,9 k107 Mb4,0 M332 k1,5 M2,8 k8236,0 k
mai 201461 4290 k235,23514,3 k107 Mb3,9 M329 k1,5 M2,8 k8236,0 k
abr 20146115389 k85,23494,6 k105 Mb3,9 M322 k1,5 M2,7 k8196,0 k
mar 20146014289 k245,23485,7 k105 Mb3,9 M317 k1,4 M2,7 k8176,0 k
fev 20145928188 k285,13445,3 k103 Mb3,8 M308 k1,4 M2,7 k8166,1 k
jan 20145714288 k225,13399,3 k102 Mb3,7 M300 k1,4 M2,6 k8126,1 k
dez 201356 4387 k105,13389,8 k101 Mb3,7 M291 k1,4 M2,6 k8086,1 k
nov 201356 3387 k11533713 k100 Mb3,7 M286 k1,4 M2,6 k8066,1 k
out 201356 2186 k44,8335552100 Mb3,7 M275 k1,4 M2,5 k8066,1 k
set 201356 3186 k174,83351,5 k99 Mb3,7 M273 k1,4 M2,5 k8066,1 k
ago 201356 4286 k274,93347,7 k99 Mb3,6 M267 k1,4 M2,3 k8066,1 k
jul 20135624285 k184,83335,2 k97 Mb3,6 M261 k1,4 M2,2 k8056,1 k
jun 20135426284 k294,83295,0 k96 Mb3,5 M254 k1,4 M2,2 k8056,1 k
mai 201352 5483 k464,83274,5 k95 Mb3,5 M243 k1,4 M2,1 k8056,1 k
abr 20135217482 k524,83255,6 k93 Mb3,4 M233 k1,3 M2,1 k8056,1 k
mar 20135126480 k804,83226,5 k91 Mb3,3 M228 k1,3 M1,9 k7526,1 k
fev 20134916378 k1634,93188,1 k88 Mb3,2 M226 k1,3 M1,6 k7516,1 k
jan 20134817373 k1835,131218 k82 Mb3,0 M219 k1,2 M1,5 k7506,1 k
dez 20124717468 k1325,230010 k75 Mb2,7 M210 k1,1 M5937506,1 k
nov 201246 5464 k1615,429111 k70 Mb2,5 M198 k1,1 M5887496,1 k
out 201246 6459 k2225,727816 k64 Mb2,3 M183 k997 k5777486,1 k
set 201246 5352 k686,125614 k55 Mb1,9 M170 k900 k5757466,1 k
ago 201246 4250 k526,12504,0 k53 Mb1,8 M164 k863 k5677466,3 k
jul 201246 4248 k26,224475151 Mb1,8 M155 k841 k5527466,3 k
jun 201246 5448 k66,22441,5 k51 Mb1,8 M155 k840 k5467466,3 k
mai 20124616448 k126,22434,3 k51 Mb1,8 M154 k837 k5377466,3 k
abr 20124514448 k656,22409,5 k50 Mb1,7 M149 k812 k5037216,3 k
mar 20124415246 k476,22298,0 k46 Mb1,6 M125 k656 k4574356,0 k
fev 20124317644 k446,322111 k42 Mb1,5 M114 k519 k4503025,8 k
jan 20124227443 k106,22145,3 k40 Mb1,5 M110 k465 k4172975,3 k
dez 20114023343 k526,120318 k40 Mb1,4 M108 k457 k4002875,2 k
nov 201138 1 41 k 5,92082,1 k39 Mb1,4 M106 k427 k3912785,2 k
out 201138 2 41 k 5,92081,1 k39 Mb1,4 M106 k423 k3902785,2 k
set 201138 4 41 k15,920898539 Mb1,4 M106 k421 k3902785,2 k
ago 201138 1141 k65,82082,2 k39 Mb1,4 M106 k420 k3902785,2 k
jul 201138 3141 k15,82071,5 k38 Mb1,4 M105 k417 k3692225,2 k
jun 201138 3141 k45,82056,0 k38 Mb1,4 M104 k415 k3632015,2 k
mai 201138 3 41 k 5,62042,2 k38 Mb1,4 M102 k406 k3611895,2 k
abr 20113812141 k 5,62044,2 k38 Mb1,4 M102 k403 k3611895,2 k
mar 201137 3241 k55,52043,9 k38 Mb1,4 M102 k398 k3601895,2 k
fev 20113714240 k185,42034,3 k37 Mb1,3 M99 k391 k3601895,2 k
jan 20113635340 k155,42015,1 k37 Mb1,3 M92 k380 k3601895,2 k
dez 201033 3239 k255,31986,8 k36 Mb1,3 M87 k369 k3611895,2 k
nov 201033 4439 k325,21925,0 k34 Mb1,2 M80 k353 k3421505,2 k
out 201033 5438 k885,218613 k33 Mb1,2 M73 k341 k26885,2 k
set 20103346335 k65,31818,4 k31 Mb1,1 M55 k315 k19885,2 k
ago 201029 4135 k 5,11825,2 k31 Mb1,1 M54 k307 k19375,2 k
jul 20102911135 k 4,91825,5 k31 Mb1,1 M54 k302 k19375,2 k
jun 201028 1135 k 4,71824,8 k31 Mb1,1 M54 k297 k19375,2 k
mai 201028 1135 k 4,61824,2 k31 Mb1,1 M54 k292 k19375,2 k
abr 201028 4135 k 4,51822,5 k31 Mb1,1 M54 k288 k19475,2 k
mar 201028 1135 k 4,41822,5 k31 Mb1,1 M54 k286 k19455,2 k
fev 201028 1135 k 4,31812,8 k31 Mb1,1 M54 k283 k19455,2 k
jan 201028 1135 k 4,31814,4 k31 Mb1,1 M54 k281 k19455,2 k
dez 200928 1135 k 4,11815,4 k31 Mb1,1 M54 k276 k19555,2 k
nov 20092812135 k 41815,4 k31 Mb1,1 M54 k271 k19655,2 k
out 200927 3235 k13,81815,2 k31 Mb1,1 M54 k266 k19655,2 k
set 200927 2235 k33,71813,5 k30 Mb1,1 M54 k261 k19655,2 k
ago 200927 1135 k 3,61813,9 k30 Mb1,1 M53 k258 k19555,2 k
jul 200927 1135 k 3,51812,1 k30 Mb1,1 M53 k254 k19555,2 k
jun 200927 1135 k 3,41812,4 k30 Mb1,1 M53 k252 k19555,2 k
mai 200927 2135 k 3,31815,5 k30 Mb1,1 M53 k250 k19555,2 k
abr 200927 1135 k 3,21816,3 k30 Mb1,1 M53 k245 k19555,2 k
mar 20092713235 k1318114 k31 Mb1,1 M48 k255 k19575,2 k
fev 200926 1135 k12,61818,5 k30 Mb1,1 M48 k222 k6375,2 k
jan 20092613135 k 2,318180429 Mb1,1 M48 k188 k6375,2 k
dez 200825 1 35 k82,318167929 Mb1,1 M48 k186 k6375,2 k
nov 200825 1 34 k 2,318051429 Mb1,1 M48 k184 k6365,2 k
out 200825 1134 k52,318093829 Mb1,1 M48 k182 k6365,2 k
set 200825 1134 k112,31791,6 k29 Mb1,1 M47 k179 k6365,2 k
ago 200825 1134 k42,317774628 Mb1,1 M44 k173 k6365,2 k
jul 20082512134 k22,317782628 Mb1,1 M43 k171 k6365,2 k
jun 200824 2134 k12,21762,2 k28 Mb1,1 M43 k168 k6365,2 k
mai 20082411 34 k 2,21765,4 k28 Mb1,1 M42 k161 k6345,2 k
abr 200823 3134 k2217662427 Mb1,1 M42 k138 k6345,2 k
mar 200823 3133 k221761,5 k27 Mb1,1 M42 k136 k6345,2 k
fev 20082324133 k221762,1 k27 Mb1,1 M41 k132 k6335,1 k
jan 20082113133 k11,91753,8 k27 Mb1,0 M40 k120 k6035,1 k
dez 200720 1133 k171,81752,2 k26 Mb1,0 M40 k82 k6035,1 k
nov 20072012233 k171,71741,6 k25 Mb1,0 M36 k69 k6035,1 k
out 200719 1132 k81,71732,5 k25 Mb1,0 M31 k63 k6025,1 k
set 20071914132 k4161,717218 k24 Mb995 k28 k44 k6025,1 k
ago 20071836320 k5321,817024 k14 Mb590 k19 k27 k6023,0 k
jul 2007153633,1 k323,82183,5 k2,7 Mb99 k14 k5,9 k58277
jun 2007121212,1 k93,92127681,8 Mb63 k7,8 k4,1 k10 35
mai 200711 111,8 k742019441,5 Mb52 k7,3 k3,0 k10 34
abr 200711 211,6 k83,91951,3 k1,3 Mb45 k6,7 k2,2 k8 28
mar 2007113611,4 k133,71871,8 k1,0 Mb37 k5,7 k1,2 k8 21
fev 2007812195293,3184784735 kb25 k3,6 k1,2 k8 5
jan 20077 11711113,41731,0 k565 kb18 k2,4 k3817 4
dez 20067 1138133,7214250414 kb12 k1,5 k1005 4
nov 2006712128654213371339 kb9,3 k1,0 k975 4
out 2006613113235,9205323210 kb4,1 k280945 4
set 2006512131 14,5272252138 kb1,2 k123833 2
ago 20064   22 92151076 kb70880771 1
jul 20064 1 21 92191374 kb67274471 1
jun 2006423121 8,321511673 kb6577347  1
mai 20062   13 4,5220 9,1 kb3595747   
abr 20062   13 4,522099,1 kb3595747   
mar 20062   9 5,625296,9 kb283427   
fev 20062   6 6,815242,1 kb111142   
jan 20062   6 6,215242,1 kb111142   
dez 20052   6 5,515262,1 kb111142   
nov 20052   6 4,5152 2,1 kb111142   
out 20052   6 4,5152 2,1 kb111142   
set 20052   6 4,5152 2,1 kb111142   
ago 2005211 6 4,5152232,1 kb111142   
jul 20051   1 426 71 31    
jun 200511  1 426471 31    
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
The following table ranks this project in relation to projects in other languages with 1000+ articles
jan 201544384331372661272716272611928126
out 201441375128362162283217262511929126
jul 201441304028362359293118262711928126
abr 201440283017362960292118262711927126
jan 201441353526351661281517232411927126
out 2013413948373439642851162325111227126
jul 2013401935293325632723162125111525126
abr 2013402823143314623021162325111525126
jan 201341342320338583018172425121726126
out 201241342014346523616192927142625126
jul 2012404938253557434263233229162624126
abr 201239333812359414218233229152523126
jan 2012421624203632404829253531263030126
out 2011424059483571424958243331263029126
jul 2011424249423459424839223031263133126
abr 2011423054403362454833222932262932126
jan 2011421434173325445024212832262731126
out 2010423638183313475220213033253084126
jul 2010443689683263505430212937243683126
abr 2010444647663157575236202936243583126
jan 2010433078613059565028192935243483126
out 2009433955442754605026192833233483126
jul 2009433980622660584838172631223383126
abr 2009434881602552614723162529203181126
jan 2009415244392456664644132328214581126
out 2008413662382335664531132327204780125
jul 2008402846362445664544122228204579125
abr 2008414240412249644245122027214380125
jan 2008414041451957633924111825214181125
out 2007403857471831623624111626253685125
jul 2007401721164216382618364334553285125
abr 2007453953385229393036445142625395125
jan 2007534460355823535338526152784890125
out 2006573640376639494949607173994688125
jul 20066438553786494545706386801005788125
abr 2006903652348446414166889277925187125
jan 20067444563486413636799897841074283119
out 2005693350267935303076919082923977107
jul 2005813242258534262672979483922874102
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100ediçõesbytes
 WikcionaristasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikcionaristas (usuários registrados)
A = Wikcionaristas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikcionaristas que editaram pelo menos dez vezes desde que chegaram
C = Wikcionaristas que contribuíram cinco vezes ou mais este mês
D = Wikcionaristas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  2500  10000  5  10  100  1000  10000  1  3  5  10  25  100  250  1000  5  10  1  3  5  10  25  100  250  5  10  100 
Monthly counts for recent history of wiki
fev 20156443331   11   92111     91     11 
jan 201573332221  3321 62111     43321  111
dez 2014555443311 2221 21111     62211  11 
nov 201483333221       5211      41        
out 2014522222211      21111     3         
set 2014532222221      31        51        
ago 2014113332222  111  3         832       
jul 201484322211  111  31        2         
jun 2014864322211 111  211       51        
mai 2014644442211 111  2         21        
abr 20141055543221 111  4311      1011       
mar 2014944442221 111  411       9322      
fev 201414108521111 111  2111      71        
jan 2014754442221 222  21111     10641      
dez 20131054333311 2211 73211     633111    
nov 201312333332111     8521      2065311    
out 20136322211        321       932       
set 2013104332111  1    221       7422      
ago 201384443222  1111 52221     42211     
jul 201385433222  1111 4211      6321      
jun 2013136655221  1111 211       75321     
mai 2013116555411  2211 8542      137731  1  
abr 2013147766433  5411 166531111  2287431    
mar 20131510664432  4411 621       11541   11 
fev 20131376443311 3331 71        105332     
jan 20131187543222 5511 51        115422  11 
Quarterly counts for entire history of wiki
jan 201573332221  3321 62111     43321  111
out 2014522222211      21111     3         
jul 201484322211  111  31        2         
abr 20141055543221 111  4311      1011       
jan 2014754442221 222  21111     10641      
out 20136322211        321       932       
jul 201385433222  1111 4211      6321      
abr 2013147766433  5411 166531111  2287431    
jan 20131187543222 5511 51        115422  11 
out 20121066544433 4421 421       1264431    
jul 2012874332    332  6221      105321     
abr 2012944444321 4422 621       1274221    
jan 201213874443   3321 422221    744431121 
out 20115221     332            4      11 
jul 2011433321    2111 11        63111     
abr 2011852211    2221 21        311       
jan 201110655432   2211 2         941       
out 2010555444322 11   3222      52211     
jul 2010611111111      1         1         
abr 201064421111  21   1         21        
jan 2010421111111 22   2         2111      
out 2009533222111 11   1         421       
jul 200932111111                 3         
abr 2009411111111 32   1         311       
jan 2009633321    111            421       
out 20085111111   111  2         422       
jul 20083222211   111  21        11        
abr 2008643221    111  2         3111      
jan 2008433321    2222 21        1         
out 20075211111   1111 1         1         
jul 200797653322  221  431       54441  1  
abr 200732222111  111  3         11111     
jan 20073111111   11   1         21111     
out 2006433221    1    3         52        
jul 2006211           1         4321      
abr 200641           631       84422  11 
jan 20061            2111      3         
out 2005                       1         
jul 2005                              11 

 

Distribuição de edições de artigos por wikcionaristas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikcionaristasEdições total
1232100.0%321,727100.0%
310344.4%321,53499.9%
106126.3%321,30799.9%
324218.1%321,00799.8%
1002611.2%320,07799.5%
316177.3%318,60799.0%
100083.4%313,20397.4%
316273.0%311,74896.9%
1000062.6%306,31395.2%
3162331.3%240,35274.7%
10000020.9%208,64364.9%

 

6 wikcionaristas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions
agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
BhaskaranaiduUC2 0101,080415685-abr 12, 2012105137,265142504-
NrgullapalliUC7 05,43513671jan 19, 2014404954162-
CommonsDelinkerUC25 0123110-mai 13, 20072847--1-
GokulellankiUC26...112112--fev 06, 2015215555--
శ్రీరామమూర్తిUC77...662-fev 03, 201524----
தகவலுழவன்UC231...1143fev 04, 201523--1-

 

20 wikcionaristas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
InterwicketUC1107,563jan 29, 20092220nov 08, 20101572
JVRKPRASADUC331,709set 20, 20101621jan 26, 201532
Rajasekhar1961UC430,541jul 03, 20072796jun 24, 2014248
T.sujathaUC524,694set 21, 20063081ago 20, 2013556
PalagiriUC610,726abr 14, 20121049jun 10, 2013627
IkotobaityUC81,455dez 19, 20111166dez 20, 20111165
DvnsarmaUC9898jan 15, 20111504set 17, 2012893
Rajasekhar1962UC10882jan 17, 20121137fev 17, 20121106
బుడుగోయ్UC11842jan 21, 20111498mar 30, 20111430
సుండ్రుUC12773jan 21, 20082594out 22, 20091954
MpradeepUC13495abr 24, 20063231abr 18, 20082506
శశికాంత్UC14468set 22, 20101619mar 16, 20111444
AngajalaARSUC15386jan 18, 20121136fev 10, 20121113
Kolipaka.raghuramUC16332jan 25, 20121129mar 31, 20121063
JambolikUC17328dez 05, 2012814jan 11, 201547
ChavakiranUC18252mar 28, 20063258set 13, 20111263
విశ్వనాధ్.బి.కె.UC19225nov 10, 20072666jan 07, 20092242
SriphaniUC20202fev 14, 2013743fev 09, 2014383
ArjunaraocUC21154set 07, 20101634dez 12, 2013442
ChaduvariUC22135ago 05, 20053493fev 14, 2014378

 

usuários anônimos, ordenados por número de contribuições
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
182.18.191.86302
122.169.239.91228
122.175.13.89182
122.169.232.26157
122.169.233.22138
117.195.247.184134
122.175.14.40132
122.175.6.78112
122.175.11.65110
122.169.234.232107

No total 5.359 edições foram feitas por usuários anônimos, de um total de 506.522 edições ( 1e %)
  


19 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
Luckas-botUC150,407mar 03, 20092187jan 27, 2014396--
HydrizBotUC245,566set 13, 2012897jan 24, 201534--
MpradeepbotUC336,337jul 12, 20072787set 12, 2007272527,473-
VolkovBotUC414,184ago 20, 20072748abr 18, 2013680--
KamikazeBotUC512,082dez 03, 20111182mar 07, 2013722--
RobotGMwiktUC66,272ago 21, 20063112jun 06, 20082457--
AvocatoBotUC75,962out 27, 20111219ago 09, 2013567--
YS-BotUC84,358set 05, 2012905fev 26, 20151--
MonoBotUC92,584dez 25, 20072621jun 14, 20082449--
SpaceBirdyBotUC10489fev 02, 20092216mai 12, 20092117--
Bot-JagwarUC11387dez 30, 20111155jun 06, 2012996--
VyzbotUC12305dez 19, 20082261dez 19, 20082261304-
CarsracBotUC13248dez 02, 20091913mai 29, 2013639--
Makecat-botUC14174nov 10, 2012839abr 05, 2013693--
タチコマ robotUC1524dez 06, 20111179nov 23, 2013461--
JAnDbotUC1613jun 26, 2012976jan 05, 201553--
QualiaBotUC172jul 20, 20082413ago 19, 20082383--
ArjunaraocbotUC182mai 04, 20121029mai 04, 20121029--
BucetaBotUC191set 08, 20101633set 08, 20101633--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110GifJpgOggPngSvg
fev 2015107 k6245961,3 k1521,2 k15690      667101,2 k43639
jan 2015106 k6195961,3 k1521,2 k15690      1762101,2 k43639
dez 2014106 k6175961,3 k1521,2 k15689      5587101,2 k43639
nov 2014104 k6165931,3 k1511,1 k14683      3208101,2 k43639
out 2014103 k6125931,3 k1511,1 k14683      3366101,2 k43639
set 2014102 k6115931,3 k1511,1 k14683      5114101,2 k43639
ago 2014101 k6065931,3 k1511,1 k14683      2792101,2 k43639
jul 2014100 k6005931,3 k1511,1 k14683      2106101,2 k43639
jun 201499 k6005931,3 k1511,1 k14683      3599101,2 k43639
mai 201499 k5955931,3 k1511,1 k14683      4175101,2 k43639
abr 201498 k5955931,3 k1511,1 k14683      4340101,2 k43639
mar 201497 k5885931,3 k1511,1 k14681      5198101,2 k43639
fev 201496 k5845931,3 k1511,1 k14678      4325101,2 k43639
jan 201495 k5785931,3 k1511,1 k14678      8219101,2 k43639
dez 201395 k5635931,3 k1511,1 k14677      7975101,2 k43639
nov 201394 k5625811,3 k1511,0 k13658      12714101,2 k43639
out 201394 k5575641,3 k15196410644      508101,2 k43639
set 201394 k5525641,3 k15196410644      1415101,2 k43639
ago 201394 k5385641,3 k15196410644      2511101,2 k43639
jul 201393 k5345641,3 k15196410642      2379101,2 k43639
jun 201392 k5305641,3 k15196410640      2240101,2 k43639
mai 201391 k5285621,3 k15196110636      2547101,2 k43639
abr 201390 k5265551,3 k15196110636      4020101,2 k43639
mar 201388 k5145241,2 k1519579626      4586101,1 k43539
fev 201386 k5035241,2 k1439579626      6513101,1 k43539
jan 201381 k4975011,2 k1439579617      9898101,1 k43539
dez 201275 k4934621,1 k1439559615      68011099943539
nov 201271 k4874159541439379602      87351086543539
out 201266 k4863808921438029583      135741080343539
set 201259 k4813748571437499548      53391076843539
ago 201256 k4733598561437469545      31641076743539
jul 201255 k4663367961437469541      3411070743539
jun 201255 k4602807961437469539      7101070743539
mai 201254 k4472547931437389537      17301070443539
abr 201254 k4371957871437269528      60901069843539
mar 201252 k4261457841437029516      45861069543539
fev 201250 k4221457841437009481      53281069543539
jan 201249 k4121067831433963355      18981069443539
dez 201148 k346797741433353351      2141869223239
nov 201147 k339787741433323348      45869223239
out 201147 k328787741433313348      22869223239
set 201147 k324787741433313348      119869223239
ago 201146 k319787731433313346      1389869123239
jul 201146 k313787671433183323      276868523239
jun 201146 k304777661433073319      455868513239
mai 201146 k301777611432993311      95868113139
abr 201146 k296777591432993311      151867913139
mar 201146 k287777591432993310      464867913139
fev 201146 k285777591432993310      829867913139
jan 201146 k273777431432993310      897866313139
dez 201045 k268777371432973310      2234865713139
nov 201044 k266663561431603274      49463348 5 
out 201043 k25066181142144380      13359 178 3 
set 201041 k24965148142143379      8412 145 3 
ago 201040 k24162147141139379      5184 144 3 
jul 201040 k22362147141139379      5484 144 3 
jun 201040 k22262147141139379      4805 144 3 
mai 201040 k20662147141139379      4147 144 3 
abr 201040 k20462147141139379      2469 144 3 
mar 201040 k20062147141139379      2497 144 3 
fev 201040 k19762147141139379      2800 144 3 
jan 201040 k19562147141139379      4332 144 3 
dez 200940 k18162147141139379      5290 144 3 
nov 200940 k18062147141139379      5371 144 3 
out 200940 k17962147141139379      5218 144 3 
set 200940 k17562147141139377      3488 144 3 
ago 200940 k16862147141139365      3847 144 3 
jul 200940 k16862147141139365      2069 144 3 
jun 200940 k16662147141139365      2367 144 3 
mai 200940 k16562147141138365      5469 144 3 
abr 200940 k16462147141138365      6244 144 3 
mar 200940 k15662147141136365      14135 144 3 
fev 200940 k14961147141136365      7908 144 3 
jan 200940 k14361147141136365      153 144 3 
dez 200840 k14261147141136365      12 144 3 
nov 200840 k14261147141135365      8 144 3 
out 200840 k12861147141135365      592 144 3 
set 200840 k11661147141135365      1204 144 3 
ago 200839 k11661144141135364      552 141 3 
jul 200839 k11461143141135364      346 140 3 
jun 200839 k11361143141134364      140 140 3 
mai 200839 k10860142141134364      81 139 3 
abr 200839 k10860142141134364      162 139 3 
mar 200839 k10760142141131364      225 139 3 
fev 200839 k10260142140124259      328 139 3 
jan 200839 k9759114140123257      233 111 3 
dez 200739 k9459114140123257      1290 111 3 
nov 200738 k7659114140123257      1169 111 3 
out 200738 k7359113140123257      619 111 2 
set 200737 k7359113140123257      2259 111 2 
ago 200723 k6758113140119254      2913 111 2 
jul 20073,5 k5857113140107242      3266 111 2 
jun 20072,4 k555311113910021      741 109 2 
mai 20072,2 k555311113810021      765 109 2 
abr 20072,0 k545311113810021      1133 109 2 
mar 20071,7 k545311113810021      1738 109 2 
fev 20071,1 k52531101379421      693 109 1 
jan 200788850531101379421      811 109 1 
dez 20065544953851379421      231 84 1 
nov 20064634953531379421      355 52 1 
out 2006311485211379421      288   1 
set 200621644521137922           1 
ago 200612043271137912           1 
jul 20061184227 137912             
jun 20061164124 137882             
mai 2006154124 137882             
abr 2006152924 137882             
mar 2006112120 137881             
fev 200681115 137851             
jan 200681115 137851             
dez 20058915 137841             
nov 20058513 134841             
out 20058511 134841             
set 20058510 13484              
ago 20058510 13284              
jul 2005121 13175              
jun 2005121 13175              

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

ago 2005: 1 2 మొదటి పేజీ , 2 1 శరీరావయవాలు

dez 2005: 1 1 మొదటి పేజీ

jan 2006: 1 1 మొదటి పేజీ

fev 2006: 1 1 attract

mar 2006: 1 2 మొదటి పేజీ , 2 1 విదళించు

abr 2006: 1 2 mother , 2 1 mère

jun 2006: 1 2 బకాల్ , 2 2 బకాయ , 3 2 బకవైరి , 4 2 బంధము , 5 2 బంగారుకొండ , 6 1 బానిస

jul 2006: 1 2 అమ్మ , 2 1 మచ్చుకి

ago 2006: 1 1 అన్నము

set 2006: 1 2 బాబాయి , 2 2 బందుగుడు , 3 2 బందిఖానా , 4 2 బందా , 5 2 బంతి , 6 2 బండి , 7 2 బంగారుతీగలు , 8 2 బంగారము , 9 2 బంకోలు , 10 2 బంకమన్ను , 11 2 చాకిరి , 12 1 ఔషధము

out 2006: 1 3 బట్టతల , 2 2 క్షణము , 3 2 అరటిపండు , 4 2 బట్టమేక , 5 2 ఐకమత్యము , 6 2 ఐరావతము , 7 2 ఊకదంపుడు , 8 2 ఊరు , 9 2 ఉడుత , 10 2 ఉమ , 11 2 ఇంపు , 12 2 ఇల్లు , 13 1 kind

nov 2006: 1 2 ఊతము , 2 2 ఊపు , 3 2 ఉగ్రము , 4 2 ఉపయోగము , 5 2 ఉదయము , 6 2 అహింస , 7 2 అర్ధము , 8 2 అంతము , 9 2 అంతరము , 10 1 Raice flaks

dez 2006: 1 1 మూత్రపిండాలు

jan 2007: 1 3 టెంకాయచెట్టు , 2 2 వేపచెట్టు , 3 1 చందనము

fev 2007: 1 2 అపరాధము , 2 1 Cumin

mar 2007: 1 2 ఉర్వి , 2 2 మను , 3 2 మనస్తాపము , 4 2 మనస్కారము , 5 2 మనస్కరించు , 6 2 మనసు , 7 2 మనసిజుడు , 8 2 మనసరి , 9 1 ఆత్మ

abr 2007: 1 2 Daughter , 2 2 కోడలు , 3 2 కొడుకు , 4 2 అల్లుడు , 5 2 కూతురు , 6 2 బావమరిది , 7 1 కళాకారుడు

mai 2007: 1 2 కర్ణము , 2 2 ఆశ , 3 1 Joint

jun 2007: 1 2 వారసత్వము , 2 2 అబద్ధము , 3 2 అపహరణ , 4 2 అంధత్వము , 5 2 భోజనం , 6 1 బ్రమ

jul 2007: 1 3 వరుడు , 2 3 రక్తము , 3 3 ఆమ్లజని , 4 3 attraction , 5 3 alimony , 6 3 వెన్నెల , 7 3 మరదలు , 8 3 అన్న , 9 3 ఉడుము , 10 2 పరాభవము , 11 2 పంజరము , 12 2 దానిమ్మ , 13 2 సిరా , 14 2 లోతు , 15 2 లెక్క , 16 2 రుచి , 17 2 నగ , 18 2 నెమలి , 19 2 తోకచుక్క , 20 2 తోక , 21 2 తేనీరు , 22 2 తేయాకు , 23 2 పత్ని , 24 2 వివాహము , 25 2 రోగము

ago 2007: 1 3 వీర్యం , 2 3 , 3 3 ఉదరము , 4 2 కార్ముకము , 5 2 twist , 6 2 cape , 7 2 cleaver , 8 2 clerk , 9 2 clerical , 10 2 cleverness , 11 2 clever , 12 2 couch , 13 2 dislocated , 14 2 effectually , 15 2 గోపురము , 16 2 చెంచా , 17 2 entail , 18 2 పొద్దుతిరుగుడు , 19 2 hand , 20 2 harbour , 21 2 harem , 22 2 how , 23 2 huff , 24 2 spiritual , 25 2 iota

set 2007: 1 2 పరమండలము , 2 2 పుట్టినదినము , 3 2 మరమరాలు , 4 2 whelk , 5 2 జ్యేష్ఠ , 6 2 saint , 7 2 potter , 8 2 part , 9 2 లిప్త , 10 2 వితత , 11 2 stool , 12 2 food , 13 2 oil , 14 2 line , 15 2 చిరుతపులి , 16 2 జ్ఞానము , 17 2 ఆచారము , 18 2 అంగారకుడు , 19 2 cloth , 20 2 భూమి , 21 2 ఈగ , 22 1 చిన్నగా

out 2007: 1 2 నారాయణుడు , 2 1 రాజదూత

nov 2007: 1 2 పెండ్లి , 2 2 ప్రసంగము , 3 2 ఈక కలము , 4 2 దస్తా , 5 2 చెల్లింపు , 6 2 పద్యం , 7 2 గుణింతము , 8 2 బోధన , 9 2 రమణీయము , 10 2 ఉచితం , 11 2 అభ్యాసము , 12 2 గంట , 13 1 గోతము

dez 2007: 1 2 విష్ణుమూర్తి , 2 2 గొడుగు , 3 1 గిరాకి

jan 2008: 1 2 యోగ్యత , 2 2 అండ , 3 1 బరిసె

fev 2008: 1 2 సీసము , 2 2 ఉల్లిగడ్డ , 3 2 అంధవిశ్వాసము , 4 2 ఇత్తడి , 5 2 మంత్రి , 6 2 కొండ , 7 2 ఆవాలు , 8 2 ఊరు , 9 1 ముద్దాయి

mar 2008: 1 2 train , 2 2 fraction , 3 1 nitrogen

abr 2008: 1 2 protocol , 2 2 magnet , 3 1 మాగాణి

mai 2008: 1 1 అడవి గన్నేరు

jun 2008: 1 1 స్వతంత్రము

jul 2008: 1 2 సిగ్గుమాలిన , 2 2 తురక , 3 2 తవుడు , 4 2 బెత్తము , 5 2 సాలె , 6 2 అందము , 7 2 అమ్మ

ago 2008: 1 2 ధూమ శకటము , 2 1 ఎన్నిక

set 2008: 1 2 విస్తరి , 2 1 మరక

out 2008: 1 2 తూనీగ , 2 1 అనూరుడు

nov 2008: 1 1 లింగము

dez 2008: 1 3 chose , 2 1 తిరుపతి యాస, భాష, పదాలు

jan 2009: 1 1 apses

fev 2009: 1 2 Improvisation , 2 1 africa

mar 2009: 1 3 పాట , 2 2 orthodox , 3 2 ముద్దు , 4 2 మడుగు , 5 2 తనయ , 6 2 నిఘంటువు , 7 2 గొడ్డలి , 8 2 తోడేలు , 9 2 గంట , 10 2 ప్రకటన , 11 2 అంగుళము , 12 2 దువ్వెన , 13 2 దేవుడు , 14 2 మణికట్టు , 15 2 గుండె , 16 2 ఆవు

abr 2009: 1 1 Flyover

mai 2009: 1 2 o' clock , 2 1 కలహభోజనుడు

jun 2009: 1 1 coup d’etat

jul 2009: 1 2 Minerva , 2 2 monday , 3 1 minerva

ago 2009: 1 2 Feedback , 2 1 Expandable

set 2009: 1 3 శనివారము , 2 2 బంగాళాదుంప , 3 2 డిసెంబర్ , 4 2 నవంబర్ , 5 2 సెప్టెంబర్ , 6 2 ఆగష్టు , 7 2 జులై , 8 1 పింగళ

out 2009: 1 2 వరి , 2 2 లోటా , 3 1 అప్రమేయ

nov 2009: 1 2 spine , 2 2 వెన్నుపాము , 3 2 నాభి , 4 2 బొడ్డు , 5 1 ద్వైతం

dez 2009: 1 2 amala

jan 2010: 1 1 వంశీ

fev 2010: 1 2 zoo , 2 1 aye

mar 2010: 1 2 o' clock , 2 1 zoo

abr 2010: 1 2 anklets , 2 2 అల్లాహ్ , 3 2 awesome , 4 2 Subtrahend

mai 2010: 1 2 end , 2 1 సుమారు

jun 2010: 1 2 unitarian , 2 2 solution , 3 1 algebraic

jul 2010: 1 2 వృథా , 2 2 milk

ago 2010: 1 3 vert , 2 3 dried , 3 2 suicide bomber , 4 2 toothless , 5 2 publisher , 6 2 over-roasted , 7 2 community , 8 2 fleshiness , 9 2 January

set 2010: 1 3 abnormal , 2 3 quadruped , 3 3 abate , 4 3 abject , 5 3 accent , 6 3 abdicate , 7 2 మధువు , 8 2 శెలవు , 9 2 ఏడాది , 10 2 put off , 11 2 in vain , 12 2 put out , 13 2 in time , 14 2 to and fro , 15 2 set down , 16 2 set out , 17 2 set in , 18 2 in search of , 19 2 go for a walk , 20 2 at home , 21 2 cut down , 22 2 as soon as , 23 2 pick up , 24 2 wake up , 25 2 crowbar

out 2010: 1 3 fractional distillation , 2 3 గుండీ , 3 2 పరిపక్వత , 4 2 సుద్ద , 5 2 జాగిలము , 6 2 చాకిరీ , 7 2 చాకచక్యము , 8 2 పానము , 9 2 పడిగాపు , 10 2 నిమిషము , 11 2 ప్రాణవాయువు , 12 2 ఎత్తైన , 13 2 చిత్రం , 14 2 నూర్పిడి , 15 2 గాలించు , 16 2 చెండు , 17 2 నిర్వచనము , 18 2 నియంత్రణ , 19 2 కజ్జికాయచెక్క , 20 2 ఎర్రగడ్డ , 21 2 సోయా చిక్కుడు , 22 2 జల్లిగరిట , 23 2 తెల్లపాయలు , 24 2 మినపప్పు , 25 2 గీతా జయంతి

nov 2010: 1 3 మిత్రద్రోహి , 2 3 సముద్రం , 3 3 నిరుత్సాహము , 4 3 శాఖము , 5 3 క్యాబేజీ , 6 3 ఆర్గాన్ , 7 3 ధూళి , 8 3 జీడిపప్పు , 9 3 రంపము , 10 2 చిమ్ముబిల్ల , 11 2 అష్టాదశ , 12 2 గరుడవర్ధనం పువ్వు , 13 2 బొరుగుల ఉప్మా , 14 2 అప్పము , 15 2 మురికికాలువ , 16 2 పచ్చగడ్డి , 17 2 నిర్మాణకౌశలము , 18 2 సంగీతకళాశాల , 19 2 ప్రదర్శనశాల , 20 2 చెక్కభజన , 21 2 సరుగుడుమొక్క , 22 2 జిల్లేడు పువ్వు , 23 2 సరుగుడు , 24 2 జిల్లేడుమొక్క , 25 2 దానిమ్మచెట్టు

dez 2010: 1 2 కుంకుడు గింజ , 2 2 కుంకుడు వృక్షం , 3 2 కుంకుడు కాయ , 4 2 కుంకుడు ఆకు , 5 2 ధన్వంతరి , 6 2 గరిడె , 7 2 నటరాజు , 8 2 మలికితము , 9 2 కొబ్బరి నూనె , 10 2 దత్తాత్రేయుడు , 11 2 ఆదిశేషుడు , 12 2 ఇండియా గేట్ , 13 2 కాళి , 14 2 అఱుపు , 15 2 జనప్రవాహము , 16 2 కూజా , 17 2 ఢమరుకం , 18 2 గిటారు , 19 2 ఉమ్మెత్త , 20 2 అచల , 21 2 ఆంధ్రప్రదేశ్ , 22 2 దేవుడి గూడు , 23 2 సముద్రతీరము , 24 2 ఇసుక గూడు , 25 2 కంజీర

jan 2011: 1 2 హడపు , 2 2 హఠము , 3 2 wiki , 4 2 హరిశ్చంద్రుడు , 5 2 పెన్సిలు , 6 2 అంగ మర్దనము , 7 2 అంగమర్ధుడు , 8 2 అక్కటికము , 9 2 అంకగణితము , 10 2 వర్గము , 11 2 మర , 12 2 తురగము , 13 1 హరిసఖుడు

fev 2011: 1 2 burning , 2 1 హోత

mar 2011: 1 1 ఘర్షకం

abr 2011: 1 1 கணினி

mai 2011: 1 2 ఆధునిక , 2 2 అనగా , 3 2 అనంతం , 4 2 అధ్యయనము , 5 1 అధునిక

jun 2011: 1 2 అనువాదాలు , 2 2 క్షమ , 3 1 క్రోసుడు

jul 2011: 1 2 అనుభోగము , 2 2 అనుభవము , 3 2 అనుపమానము , 4 2 mastiff , 5 1 అగ్ని (దేవుడు)

ago 2011: 1 1 మాత్రము

set 2011: 1 2 ఈత , 2 2 అతుకు , 3 1 గాయకురాలు

out 2011: 1 1 రాచనగరు

nov 2011: 1 1 శంఖం

dez 2011: 1 2 నిర్యాణము , 2 2 zoro , 3 2 sehatra , 4 2 మిరపకాయ , 5 2 జనపనార , 6 2 airy , 7 1 ప్రపితామహం

jan 2012: 1 3 చేయి , 2 3 చెవి , 3 3 మొదటి పేజీ , 4 2 యవ్వారం , 5 2 కపోతము , 6 2 ఛాతీ , 7 2 గుర్రప్పందాలు , 8 2 వ్రేలాడదీయు , 9 2 విజ్ఞాన శాస్త్రము , 10 2 తత్వ శాస్త్రము , 11 2 జీవ శాస్త్రము , 12 2 వృక్ష శాస్త్రము , 13 2 జంతు శాస్త్రము , 14 2 వాస్తు శాస్త్రము , 15 2 అర్ధ శాస్త్రము , 16 2 ఆర్ధిక శాస్త్రము , 17 2 మానసిక శాస్త్రము , 18 2 భూగోళ శాస్త్రము , 19 2 గణిత శాస్త్రము , 20 2 తర్క శాస్త్రము , 21 2 పౌర శాస్త్రము , 22 2 వైద్య శాస్త్రము , 23 2 యంత్ర శాస్త్రము , 24 2 భూగర్భ శాస్త్రము , 25 2 వ్యాకరణ శాస్త్రము

fev 2012: 1 3 calf , 2 3 రాజు , 3 3 పక్షవాతము , 4 3 ఔషధము , 5 2 పోగుచేసిన , 6 2 మృదువైన , 7 2 సీసా , 8 2 అస్థిరత , 9 2 ఊరివాడు , 10 2 నల్లచేవమాను , 11 2 బొగ్గు నలుపు , 12 2 ఆకుపచ్చ , 13 2 చామనఛాయ , 14 2 ఇతివృత్తము , 15 2 గౌరవమైన , 16 2 వాత్సల్యము , 17 2 ప్రియమైన , 18 2 సహజముగా , 19 2 ప్రశంసనీయం , 20 2 కమ్మని , 21 2 నియంత , 22 2 అంటువ్యాధి , 23 2 వాతం , 24 2 నవ్యత , 25 2 నిర్దాక్షణ్యం

mar 2012: 1 2 మైకము , 2 2 బలుపాకురాయి , 3 2 దక్షిణధృవము , 4 2 ఉత్తరధృవము , 5 2 ధృవము , 6 2 తడిపొడి , 7 2 సుదతి , 8 2 కొరత , 9 2 అనుగుణ్యము , 10 2 కక్షిదారు , 11 2 బడలిక , 12 2 శోభ , 13 2 దౌత్యము , 14 2 రక్తహీనత , 15 2 అంబరు , 16 2 దేశ్యము , 17 2 ఎగుమతి , 18 2 దిగుమతి , 19 2 కోశాధికారి , 20 2 పుంలింగము , 21 2 తెడ్డు , 22 2 పేక , 23 2 నూలు , 24 2 పాఠశాల , 25 2 గుర్రము

abr 2012: 1 3 ఇరుసు , 2 3 ఆస్ట్రేలియా , 3 3 గంటము , 4 3 పూస , 5 2 తాచుపాము , 6 2 సౌదీ అరేబియా , 7 2 ఉత్తర కొరియా , 8 2 దక్షిణ కొరియా , 9 2 ఆఫ్రికా , 10 2 గంటసాల , 11 2 చెంగావి , 12 2 ముక్కిన , 13 2 తొండం తాడు , 14 2 కదురుగోలు , 15 2 కపిలి బండి , 16 2 ములుగర్ర , 17 2 కొండ్ర , 18 2 దాపట , 19 2 మోట , 20 2 కపిలి , 21 2 ఎలపట , 22 2 మడవ , 23 2 గూడ , 24 2 హీలియము , 25 2 ఉండ్రాళ్ళు

mai 2012: 1 3 కడుపుతో నుండుట , 2 2 కడపర , 3 2 కడతెగు , 4 2 రాజకీయాలు , 5 2 ఆటవెలది , 6 2 తపాలాబిళ్ళ , 7 2 పిరంగి , 8 2 జగము , 9 2 కంకర , 10 2 వాడి , 11 2 కార్యాలయము , 12 2 కడపటి , 13 2 ఎనుము , 14 2 నందివర్ధనం చెట్టు , 15 2 చల్ల , 16 2 కోడిపుంజు , 17 2 ఉత్తరక్రియ , 18 2 వరము , 19 2 ఛాపము , 20 2 పరము , 21 2 మట్టిపాత్రలు , 22 2 బస్సు , 23 2 సంస్కృత నిఘంటువు , 24 2 నీరుల్లి , 25 2 అలరు

jun 2012: 1 2 షట్కోణము , 2 2 జీవకణము , 3 2 ఠంకారము , 4 2 కడలు , 5 2 టెలిఫోన్ , 6 2 నకలు , 7 2 రోమము , 8 2 ఓడ , 9 1 రామ

jul 2012: 1 2 శిఖండి , 2 2 హిడింబి , 3 2 కీచకుడు , 4 2 కేంద్రకము , 5 2 అంగప్రదక్షిణము , 6 2 బీజము , 7 2 శంతనుడు , 8 2 జనమేజయుడు , 9 2 ఆదిత్యుడు , 10 2 వ్యాసుడు , 11 1 జంబూ

ago 2012: 1 3 గీత , 2 2 అరకన్ను , 3 2 అరకాని , 4 2 అయ్యవారు , 5 2 అయోగము , 6 2 అయుక్తము , 7 2 అయశస్కరము , 8 2 అయశము , 9 2 అయత్నము , 10 2 అమృతకలశము , 11 2 అమృతుడు , 12 2 అమృతాంశువు , 13 2 అమృతాంధనుడు , 14 2 అముద్రితము , 15 2 అమిత్రుడు , 16 2 అమాంతవర్తకుడు , 17 2 అమవస , 18 2 అమలుదారుడు , 19 2 అభూతము , 20 2 అమరావతి , 21 2 అమరాద్రి , 22 2 అమరాంగన , 23 2 అభ్యున్నతము , 24 2 అభ్యుచితము , 25 2 అభ్యారోహణము

set 2012: 1 3 దుర్గ , 2 2 ఈల , 3 2 ఈడ , 4 2 ఇలకోడి , 5 2 ఇర్వురు , 6 2 ఇరువురు , 7 2 ఇరువది , 8 2 ఇరుగుపొరుగు , 9 2 ఇరుగు , 10 2 ఇట్టిక , 11 2 ఇటిక , 12 2 ఇచ్చట , 13 2 ఇగో , 14 2 ఇక్షువు , 15 2 ఇండ్లు , 16 2 జాగా , 17 2 ఆవంత , 18 2 ఆదివరాహము , 19 2 ఆజ్ఞానుసారముగా , 20 2 ఆజ్ఞానుసారము , 21 2 ఆజ్ఞానువర్థి , 22 2 ఆకుపురుగు , 23 2 ఆబోతు , 24 2 గీతము , 25 2 ఉష్ణం

out 2012: 1 3 కాపురస్థుడు , 2 3 తెలుగు మహిళల పేర్లు , 3 3 ఎతడు , 4 3 ఎడ్లు , 5 3 ఎడ్డము , 6 3 ఎడారె , 7 3 ఎడవాడు , 8 3 ఎడద , 9 3 ఊదా , 10 3 ఉల్లంఘించు , 11 3 ఉలగరము , 12 3 ఉరోజము , 13 3 ఉరము , 14 3 ఉముక , 15 3 ఉబ్బు , 16 3 ఉపవనము , 17 3 ఉంపుడుకత్తె , 18 3 ఉంపడము , 19 3 ఉంఛవృత్తి , 20 3 ఉంఛము , 21 3 ఉంగ్రము , 22 3 కంచరగాడిద , 23 3 ఉక్కిరిబిక్కిరి , 24 3 ఉల్బము , 25 3 ఎగురు

nov 2012: 1 3 షట్చక్రవర్తులు , 2 3 అష్టదిక్పాలకులు , 3 3 తెలుగు పురుషుల పేర్లు , 4 3 లక్షాధికారి , 5 3 తెలుగు మహిళల పేర్లు , 6 3 కమ్మ , 7 3 తెలుగు జాతీయములు , 8 3 కుట్టు , 9 3 విను , 10 3 చింత , 11 3 కట్టు , 12 2 అంగలూరు , 13 2 కృష్ణా జిల్లా గ్రామాలు , 14 2 చిదుగు , 15 2 చిదాత్మ , 16 2 చిదగొద , 17 2 చిత్రిణి , 18 2 చిత్రాసనము , 19 2 చిత్రాన్నము , 20 2 చిత్రశిఖండిజుడు , 21 2 చిత్రశాల , 22 2 చిత్రవాలము , 23 2 చిత్తిని , 24 2 చిత్తవృత్తి , 25 2 చిత్తవిప్లవము

dez 2012: 1 3 కక్కాయి , 2 3 ద్వయము , 3 2 నాటుకొను , 4 2 కలువరాయడు , 5 2 కమ్మరీడు , 6 2 ధేనుక , 7 2 దావాగ్ని , 8 2 తేలుకొండి , 9 2 తెగ , 10 2 తీర్థకాకము , 11 2 తీతువు , 12 2 తుల , 13 2 తడక , 14 2 తంతివాద్దెము , 15 2 తండువు , 16 2 డోలనము , 17 2 డలాయతు , 18 2 డవాలి , 19 2 డయనము , 20 2 డమాయి , 21 2 డమాను , 22 2 డమరువు , 23 2 డమరము , 24 2 డబ్బాటు , 25 2 నామాలపురుగు

jan 2013: 1 2 డంబరము , 2 2 జయఘంట , 3 2 పొట్టపోసికొను , 4 2 తెలుగు నిఘంటువులో పేర్కొన్న ఉర్దూ పదాలు , 5 2 పులిదుంప , 6 2 పుంఖానుపుంఖము , 7 2 గొణగు , 8 2 గుండియ , 9 2 పాణి , 10 2 గాలికుంటు , 11 2 గాముల ఱేడు , 12 2 పరివేశము , 13 2 పరశువు , 14 2 గవకు , 15 2 ఖడ్గి , 16 2 புவியியல் , 17 2 பகுதி , 18 2 அகண்டதீபம் , 19 2 அகங்கரிப்பு , 20 2 அகக்கமலம் , 21 2 நாடோடி , 22 2 கிழக்கு , 23 2 அங்குசம் , 24 2 அகிம்சை , 25 2 నేతిబీర

fev 2013: 1 2 మృగనా భి , 2 2 రక్తగంధము , 3 2 మాతాపితలు , 4 2 రత్నాకరము , 5 2 చంద్రగిరి , 6 2 కాళహస్తి , 7 2 భూగర్భము , 8 2 గర్భగృహము , 9 2 గర్భవతి , 10 2 రోడ్డు , 11 2 లెంపకాయ , 12 2 ముడ్డి , 13 2 తాపి , 14 2 గిరి , 15 2 ద్వారం , 16 2 తరువు , 17 2 తీరు , 18 2 తుండు , 19 2 తాడు , 20 2 మగ , 21 2 సముద్రము , 22 2 కాలము , 23 2 ముగ్గు , 24 1 తుటారికత్తియ

mar 2013: 1 4 దిగంబరుడు , 2 2 తొంటచేతివాడు , 3 2 తైషము , 4 2 తెల్లయేనుగు , 5 2 తెలికలు , 6 2 వెండ్రుక , 7 2 వెండిగుండు , 8 2 వెంట్రువ , 9 2 వృషుడు , 10 2 వృషాంకుడు , 11 2 వృక్షచరము , 12 2 వృకదంశము , 13 2 వీగియాడు , 14 2 చుర్రు , 15 2 విశిష్టుడు , 16 2 విశ్వనాథుడు , 17 2 వజ్రాయుధము , 18 2 త్రిపురాంతకుడు , 19 2 తేలాడు , 20 2 తేఱు , 21 2 గంగాధరుడు , 22 2 కంఠాభరణము , 23 2 వట్టకాయ , 24 2 వృషణము , 25 2 ఫాలనేత్రుడు

abr 2013: 1 4 మొదటి పేజీ , 2 3 ద్విజరాజు , 3 3 చతుర్భుజి , 4 3 శుక్రుడు , 5 2 నల్లెరు , 6 2 నమస్కృతి , 7 2 నఫా , 8 2 నగరి , 9 2 నగధరుడు , 10 2 నక్తంచరము , 11 2 ఎప్సిలోన్ , 12 2 శుక్కు , 13 2 సీలించు , 14 2 శీర్ణము , 15 2 శీతాంసువు , 16 2 అంతర్జాతీయ న్యాయస్థానం , 17 2 వ్యభిచారిణి , 18 2 వైజయంతుడు , 19 2 వేశము , 20 2 కరీంనగర్ జిల్లా , 21 2 ఆదిలాబాదు జిల్లా , 22 2 డార్జిలింగ్ హిమాలయ రైల్వే , 23 2 ఢిల్లీ సబ్అర్బన్ రైల్వే , 24 2 ఆగ్నేయ మధ్య రైల్వే , 25 2 ఆగ్నేయ రైల్వే

mai 2013: 1 4 పాడు , 2 3 ఏలు , 3 3 నశించు , 4 3 శునకము , 5 3 పూయు , 6 3 శ్లోకము , 7 3 కవిత , 8 2 ఏకలింగ పుష్పములు , 9 2 ఎఱ్ఱరక్తకణములు , 10 2 ఉపజిహ్విక , 11 2 ఆయస్కాంతికక్షేత్రము , 12 2 ఆమ్లీకరణము , 13 2 ఆమ్లజనీకరణము , 14 2 సేవించు , 15 2 సమర్పించు , 16 2 సిద్ధార్థుడు , 17 2 ఎముకలగూడు , 18 2 శ్వానకాసము , 19 2 శ్రీకాంతుడు , 20 2 శ్రీకరుడు , 21 2 శ్రాద్ధదేవుడు , 22 2 శోషము , 23 2 శుభకరము , 24 2 శుని , 25 2 సంరక్షించు

jun 2013: 1 2 వృషభచక్రం , 2 2 వృద్దావస్థ , 3 2 పరాజిత , 4 2 పాపలగ్నాలు , 5 2 సూత్రంపట్టడం , 6 2 భిత్తి , 7 2 జీర్ణోద్దారం , 8 2 తృణం , 9 2 కర్ణికారం , 10 2 శత పత్రం , 11 2 ఆమ్రం , 12 2 నింబం , 13 2 రాజవృక్షం , 14 2 రుధిరదోషం , 15 2 బధిరగృహం , 16 2 విగ్రహాలు , 17 2 కూపం , 18 2 రథరేణువు , 19 2 శల్యోథ్ధారం , 20 2 నవకోష్టకం , 21 2 ఆయుత భూమి , 22 2 వాయుయానము , 23 2 శల్యాలు , 24 2 భూశోధన , 25 2 వర్గులు

jul 2013: 1 3 తలపు , 2 3 అన్నము , 3 2 తొంగొను , 4 2 తినగతినగ , 5 2 మ్రోగెను , 6 2 చెలరేగెను , 7 2 కమ్మగా , 8 2 బాల్యక్రీడలు , 9 2 అంబరరత్నము , 10 2 అంబరమణి , 11 2 అంశుడు , 12 2 తెల్లవాడు , 13 2 మృగేంద్రుడు , 14 2 మాతలుడు , 15 2 మకరధ్వజుడు , 16 2 పన్నగాశనుడు , 17 2 అంగరంగవైభవము , 18 2 పోగాలము , 19 2 అమిషము , 20 2 కాగిలి , 21 2 వృచ్ఛికవానర న్యాయము , 22 2 వృశ్చికచోరన్యాయము , 23 2 స్వరూపం , 24 2 బధిరవీణాన్యాయము , 25 2 మార్జాలకబళన్యాయము

ago 2013: 1 3 ఉల్లి , 2 2 అఖేటనుడు , 3 2 అఖురథుడు , 4 2 అఖుబుక్కు , 5 2 ఆక్షారితుడు , 6 2 ఆక్లేదము , 7 2 ఆక్రోశనము , 8 2 ఆకుజల్ల , 9 2 అకతాళ్ళు , 10 2 ఆగాకర , 11 2 ఆకపడు , 12 2 అంధ్యము , 13 2 ఎండుచేప , 14 2 అర్పించుట , 15 2 అరుచుట , 16 2 అరుగుట , 17 2 పోటముంజు , 18 2 పొంగట్టు , 19 2 పంద , 20 2 నేస్తకాడు , 21 2 నేలపట్టి , 22 2 నేత్రిక , 23 2 నెలవీసము , 24 2 నెలవెలుగు , 25 2 నెలవత్తి

set 2013: 1 2 ఏతయ్య , 2 2 విజయవాడ , 3 2 తలారి , 4 2 ప్రేమించు , 5 2 దధీచి , 6 2 కంపరము , 7 2 కంబము , 8 2 కండూతి , 9 2 కంచు , 10 2 సవ్యసాచి , 11 2 తండి , 12 2 ఓడు , 13 2 కంకణము , 14 2 కంద , 15 2 కందిరీగ , 16 1 కుంటగలగరమొక్క

out 2013: 1 2 తుహినకరుడు , 2 2 నాకు , 3 1 మధము

nov 2013: 1 3 పొదుగు , 2 2 సాకుట , 3 2 పాపిష్టి , 4 2 ముచ్చటించు , 5 2 అలీన ఉద్యమం , 6 2 మొఱ్ఱి , 7 2 మొగుదారి , 8 2 మేఘపుష్పము , 9 2 మృగధరుడు , 10 2 ధారణము , 11 2 అస్థిపంజర వ్యవస్థ , 12 2 గుగ్గిలము , 13 2 కాబేజీ , 14 2 గర్భాదానము , 15 2 మొండి , 16 2 మొలత్రాడు , 17 2 మొద్దు , 18 2 ముంగురులు , 19 2 పొగ , 20 2 సాకు , 21 2 వదంతి , 22 2 rambling , 23 2 acquit , 24 2 billingsgate , 25 2 brinjal

dez 2013: 1 2 బుద్ధిపూర్వకముగా , 2 2 హుషారుగా , 3 2 సంపూర్ణముగా , 4 2 నిశ్చయముగా , 5 2 స్థిరముగా , 6 2 శాశ్వతముగా , 7 2 విశ్వాసముగా , 8 2 దయగా , 9 2 ఉగ్రముగా , 10 2 విచిత్రముగా , 11 2 చల్లగా , 12 2 వేడిగా , 13 2 బోర్లించుట , 14 2 చప్పగా , 15 2 అగోచరముగా , 16 2 నిత్యత్వము , 17 2 మనుష్యహత్య , 18 2 పుణ్యదివసము , 19 2 మనఃపూర్వకముగా , 20 2 హేయముగా , 21 2 కుంటుతూ , 22 2 సుఖముగా , 23 2 అసూయగా , 24 2 సుధర్ముడు , 25 2 వ్యాకరణవేత్త

jan 2014: 1 3 చెల్లించుట , 2 3 ఫలం , 3 2 సిద్ధపరచు , 4 2 అచలించు , 5 2 అగడుపఱచు , 6 2 అక్కఱకువచ్చు , 7 2 అంతుతేల్చుకొను , 8 2 అంతముచూడు , 9 2 అంతమునొందించు , 10 2 ఊగు , 11 2 సాత్వికముగా , 12 2 సరదాగా , 13 2 శ్రావ్యముగా , 14 2 కాపాడుట , 15 2 సంధించు , 16 2 సంకోచించు , 17 2 వర్ణించు , 18 2 లభించు , 19 2 బోధించు , 20 2 బండెలుక , 21 2 ప్రాబల్యము , 22 2 ప్రతిసరము , 23 2 దురవస్థ , 24 2 తమ్మిచూలి , 25 2 మంగలివాడు

fev 2014: 1 3 తుచ్ఛుడు , 2 2 చందము , 3 2 గడుచు , 4 2 ఓగులవాడు , 5 2 నాంతరీయకన్యాయము , 6 2 మత్తకాశినీన్యాయం , 7 2 దాక్షిణ్యము , 8 2 చినిగిన , 9 2 పీపాయి , 10 2 విరిగిన , 11 2 వినయముగా , 12 2 చొరబడడము , 13 2 గ్రామ్యము , 14 2 తంత్రము , 15 2 రథము , 16 2 కుతంత్రము , 17 2 నీచుడు , 18 2 ప్రతిధ్వని , 19 2 కరుణ , 20 1 జాగారణము

mar 2014: 1 2 గొప్పలు , 2 2 అంగజము , 3 2 మహాపండితుడు , 4 2 సురపతి , 5 2 స్మరించుట , 6 2 కారకం , 7 2 గార్హస్థ్యసన్యాసపరీక్షాన్యాయం , 8 2 చిరునగవు , 9 2 సంహరించుట , 10 2 అవతరించు , 11 2 ప్రతిభావంతుడు , 12 2 కాంచనుడు , 13 2 మునివాహనుడు , 14 2 పరాంకుశదాసుడు , 15 2 భక్తిసారుడు , 16 2 నారదుఁడు , 17 2 పురుమీఢుడు , 18 2 హస్తికుఁడు , 19 2 అంగుఁడు , 20 2 వామనుఁడు , 21 2 ఉపేంద్రుఁడు , 22 2 మరచుట , 23 2 వాదోపవాదములు , 24 2 మహిషుడు , 25 2 అలసుడు

abr 2014: 1 2 కుమ్మరిపురుగు , 2 2 అలుగుట , 3 2 మెలగుట , 4 2 కలుగుట , 5 2 కుందనం , 6 2 నువ్వు , 7 2 ఆరోగ్యవంతుడు , 8 2 వ్యాధిగ్రస్తుడు , 9 2 వ్యాధిపీడితుడు , 10 2 పూచుట , 11 2 రుణం , 12 2 తప్పిదం , 13 2 గరిమము , 14 2 క్రూరలోచనుడు , 15 2 భవిత , 16 2 మీరుట , 17 2 బొప్పాయిపండు , 18 2 శూద్రుడు , 19 2 వేలుపుబానిస , 20 2 వెలయింతి , 21 2 వారకాంత , 22 2 తిరము , 23 2 యజమానుడు , 24 2 మెలగు , 25 2 పర్యాయపదము

mai 2014: 1 3 దీపము , 2 2 ఋజుమార్గేణ్ సిధ్యతి , 3 2 అక్షిగోళము , 4 2 అంధాక్షిమీలనన్యాయము , 5 2 నక్షత్రమండలము , 6 2 అంధదర్పణన్యాయము , 7 2 అంధగోక్షేత్రన్యాయము , 8 2 అంధగజన్యాయము , 9 2 సలుపుట , 10 2 అంధపరంపరాన్యాయము , 11 2 అంకోలబీజన్యాయము , 12 2 ఊర్ధ్వముఖము , 13 2 అంకుశన్యాయము , 14 2 నిండుచందమామ , 15 2 నింపుట , 16 2 అంధపరంపరాన్యాయం , 17 2 లావిక , 18 2 పుష్పలావిక , 19 2 పుంగర్భము , 20 2 అప్రసక్తనిషేధన్యాయము , 21 2 ఇక్షురసన్యాయము , 22 2 వితానము , 23 2 కంటకన్యాయము , 24 2 మహోదరము , 25 2 మహావీరుడు

jun 2014: 1 2 కన్నుకుట్టు , 2 2 ఎనక , 3 2 సోపానారోహణన్యాయము , 4 2 జలమథనన్యాయము , 5 2 జలతుంబికాన్యాయము , 6 2 చిత్రితాంగజంబుకన్యాయము , 7 2 ఆమ్రవనము , 8 2 మలినం , 9 2 కంబళభోజనన్యాయము , 10 2 మహిషము , 11 2 బదరము , 12 2 చాలనము , 13 2 చండాలుడు , 14 2 చంచల , 15 2 స్ఫటికము , 16 2 గుడము , 17 2 కాకము , 18 2 ఆడ , 19 2 ఉల్లాసం , 20 2 బిల్వము , 21 2 జిగురు , 22 2 ఒలుకు , 23 2 మూగ , 24 2 క్షీరము , 25 2 గొప్ప

jul 2014: 1 2 తల్లడిల్లి , 2 2 మిధ్యామతి , 3 2 మోసంచేయు , 4 2 పురాతన , 5 2 అనుగ్రహించు , 6 2 నలువ , 7 2 అంకం , 8 2 కుత్తుక , 9 2 సీమంతము , 10 2 ఉద్రేకం , 11 2 అవలీల , 12 1 ఉత్ఖాతదంష్టభుజగన్యాయము

ago 2014: 1 2 బ్రహ్మ జ్ఞానం , 2 2 ఆత్మబంధువు , 3 2 గుబాళింపు , 4 2 సంధ్యవేళ , 5 2 జానపదం , 6 2 పర్యావరణ , 7 2 పదనిధి , 8 2 సమ్మోహనం , 9 2 విక్రయ కేంద్రం , 10 2 మరకలు , 11 2 సిరిసంపదలు , 12 2 భారం , 13 2 ఏగుట , 14 2 షట్కర్మ , 15 2 వటారము , 16 2 రక్షామణి , 17 2 బొంకరి , 18 2 ప్రవేశపెట్టు , 19 2 తంతు , 20 2 డేకురు , 21 2 ఠవళి , 22 2 శాకము , 23 2 ఋతుశాంతి , 24 2 వైవిధ్యము , 25 2 అతిక్రమించు

set 2014: 1 3 వృషణము , 2 2 పలవరింపు , 3 2 చక్రబంధం , 4 2 ముందస్తు , 5 2 వాస్తుపూజ , 6 2 రుణం , 7 2 లౌకికము , 8 2 పులుగు , 9 2 గమనించు , 10 2 ఆచరించు , 11 2 సందడి , 12 2 రంభ , 13 2 నిందితుడు , 14 2 ఆసక్తి , 15 2 తిమ్మిరి , 16 2 సదస్సు , 17 2 అమ్మకము , 18 2 నగుబాటు , 19 2 విందు , 20 2 కొలువు , 21 2 భాస్కరుడు , 22 2 వృషణం , 23 2 ఆజ్ఞ , 24 2 ధనము , 25 2 అంగడి

out 2014: 1 2 సునిశితము , 2 2 అగ్నిహోత్రి , 3 2 పండబారు , 4 2 విశ్వప్రయత్నం , 5 2 మిశ్రమం , 6 2 అక్షగ్లహము , 7 2 కౌగిలింత , 8 2 సహస్రాంశు , 9 2 పరిశుభ్రత , 10 2 సాధికారత , 11 2 చక్రాంకితము , 12 2 అనుక్షణం , 13 2 శిల్పకళ , 14 2 ప్రవచనాలు , 15 2 గుబాళించు , 16 2 చుట్టిల్లు , 17 2 జాగిలము , 18 2 సంకల్పం , 19 2 ఉత్తరీయం , 20 2 ఉరి , 21 2 కునుకు , 22 2 గుహ , 23 2 మాటు , 24 2 సేవ , 25 2 అలంకారము

nov 2014: 1 2 మంత్రగాడు , 2 2 అతిధృతి , 3 2 దారుణం , 4 2 పండుకప్ప , 5 2 విధవరాలు , 6 2 మంకి , 7 2 పొలికె , 8 2 ఎందువలన , 9 2 చంకగోడ , 10 2 వీరంగము , 11 2 సంజనము , 12 2 అననము , 13 2 అనన్య దృష్టి , 14 2 ముంగరి , 15 2 ముంగత్తి , 16 2 నాగేలి , 17 2 పుష్కలం , 18 2 జింకపిల్ల , 19 2 రాంకవము , 20 2 ఎక్కటి , 21 2 పచ్చ , 22 2 వంటకము , 23 2 పొగబండి , 24 2 జాలరి , 25 2 జానపదము

dez 2014: 1 3 మృగతృష్ణ , 2 2 తటస్థమైన , 3 2 సర్వసంగ , 4 2 గిడ్లదొడ్డి , 5 2 సర్వస్వతంత్రుడు , 6 2 పరాగ , 7 2 వీర రాత్రి , 8 2 వృద్ధిచేయు , 9 2 సాత్వికమైన , 10 2 మేళా , 11 2 అన్యభృత్తు , 12 2 అందచందములు , 13 2 అదుపు , 14 2 ప్రశంస , 15 2 లోహండి , 16 2 మరీచిక , 17 2 ధేనుక , 18 2 ఆహారము , 19 2 ఎత్తుగడ , 20 2 సంస్కారము , 21 2 చిల్లర , 22 2 పల్లె , 23 2 నేర్పు , 24 2 సాక్ష్యము , 25 2 అద్భుతము

jan 2015: 1 2 లంకె , 2 2 పంచుకొను , 3 2 లేవనెత్తు , 4 2 మేకొను , 5 2 అర్గళము , 6 2 కరణములు , 7 2 ఆకర్షణము , 8 2 నీరాజనము , 9 2 బుద్ధి , 10 2 తిలకము , 11 2 ఉపదేశము , 12 2 ఎత్తు , 13 1 మువ్వన్నె

fev 2015: 1 2 గుబురు , 2 2 అందము , 3 1 అజాకృపాణీయన్యాయం

No data on this page have been normalized to 30 day months (as WMF does on certain traffic reports).
Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Sexta-feira, 27 de março 2015 00:00

Dump file tewiktionary-20150309-pages-meta-history.xml.7z (full dump), size 35 Mb as 7z -> 978 Mb
Dump processed till Feb 28, 2015, on server stat1002, ready at Thu-12/03/2015-03:10 after 6 min, 57 sec.

Versão do script:2.6
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.