Estatísticas da Wikcionário télugo

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist

Metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.
See also metrics definitions


 
Monthly counts & Quarterly rankings: junho 2015
 
DataWikcionaristasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
jun 20150%   +1%   +259%      0%
mai 20150%   0%   -98%      0%
abr 2015+2%   +2%+45%  -37%      0%
mar 2015+2%   +1%   +18104%+2%+4%+2%+1%+2%+1%0%
fev 2015+2%   0%   -87%0%0%0%0%0%0%0%
jan 20150%   +1%   -37%+1%+1%+1%+1%0%0%0%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
jun 201564 43104 k187,1 6,9 k      6,5 k
mai 201564 22104 k157,1 1,9 k      6,5 k
abr 201564196103 k617,1 88 k      6,5 k
mar 201563154101 k426,4375139 k121 Mb4,6 M397 k1,6 M3,0 k1,0 k6,5 k
fev 201562143100 k85,1366766119 Mb4,4 M389 k1,6 M2,9 k1,0 k6,5 k
jan 201561 32100 k185,13665,7 k118 Mb4,4 M388 k1,6 M2,9 k1,0 k6,5 k
dez 201461 5399 k5053659,1 k117 Mb4,4 M384 k1,6 M2,9 k1,0 k6,5 k
nov 201461 3298 k3353623,2 k115 Mb4,3 M370 k1,5 M2,9 k1,0 k6,5 k
out 201461 2297 k2653603,4 k113 Mb4,2 M360 k1,5 M2,9 k8276,5 k
set 201461 2296 k5353595,1 k112 Mb4,2 M353 k1,5 M2,8 k8256,5 k
ago 201461 3294 k265,13553,2 k110 Mb4,1 M342 k1,5 M2,8 k8256,5 k
jul 201461 3294 k255,13532,5 k108 Mb4,0 M336 k1,5 M2,8 k8246,5 k
jun 201461 4293 k255,13523,9 k107 Mb4,0 M332 k1,5 M2,8 k8236,5 k
mai 201461 4292 k285,13514,3 k107 Mb3,9 M328 k1,5 M2,8 k8236,5 k
abr 20146115391 k155,13494,6 k105 Mb3,9 M322 k1,5 M2,7 k8196,5 k
mar 20146014291 k315,13485,7 k105 Mb3,9 M317 k1,4 M2,7 k8176,4 k
fev 20145928190 k285,13445,3 k103 Mb3,8 M308 k1,4 M2,7 k8166,4 k
jan 20145714289 k225,13399,3 k102 Mb3,7 M300 k1,4 M2,6 k8126,4 k
dez 201356 4388 k1153389,8 k101 Mb3,7 M291 k1,4 M2,6 k8086,4 k
nov 201356 3388 k114,933713 k100 Mb3,7 M286 k1,4 M2,6 k8066,4 k
out 201356 2188 k44,8335551100 Mb3,7 M275 k1,4 M2,5 k8066,4 k
set 201356 3188 k174,83351,5 k99 Mb3,7 M273 k1,4 M2,5 k8066,4 k
ago 201356 4287 k284,83347,7 k99 Mb3,6 M267 k1,4 M2,3 k8066,4 k
jul 20135624286 k204,73335,2 k97 Mb3,6 M261 k1,4 M2,2 k8056,4 k
jun 20135426286 k304,73295,0 k96 Mb3,5 M253 k1,4 M2,2 k8056,4 k
mai 201352 5485 k464,73274,5 k95 Mb3,5 M242 k1,4 M2,1 k8056,4 k
abr 20135217483 k524,73255,6 k93 Mb3,4 M233 k1,3 M2,1 k8056,4 k
mar 20135126482 k804,73226,5 k91 Mb3,3 M228 k1,3 M1,9 k7526,4 k
fev 20134916379 k1634,83188,1 k88 Mb3,2 M226 k1,3 M1,6 k7516,4 k
jan 20134817375 k182531218 k82 Mb3,0 M219 k1,2 M1,5 k7506,4 k
dez 20124717469 k1335,130010 k75 Mb2,7 M210 k1,1 M5937506,4 k
nov 201246 5465 k1625,329111 k70 Mb2,5 M198 k1,1 M5887496,4 k
out 201246 6460 k2405,627816 k64 Mb2,3 M183 k997 k5777486,4 k
set 201246 5353 k846,125614 k55 Mb1,9 M169 k900 k5757466,3 k
ago 201246 4250 k496,12504,0 k53 Mb1,8 M164 k863 k5677466,3 k
jul 201246 4249 k26,224475151 Mb1,8 M155 k841 k5527466,2 k
jun 201246 5448 k66,22441,5 k51 Mb1,8 M155 k840 k5467466,2 k
mai 20124616448 k116,22434,3 k51 Mb1,8 M154 k837 k5377466,2 k
abr 20124514448 k686,12409,5 k50 Mb1,7 M149 k812 k5037216,2 k
mar 20124415246 k486,22298,0 k46 Mb1,6 M125 k656 k4574356,0 k
fev 201243 7644 k486,222111 k42 Mb1,5 M114 k519 k4503025,8 k
jan 20124336443 k116,22145,3 k40 Mb1,5 M110 k465 k4172975,5 k
dez 20114023343 k526,120318 k40 Mb1,4 M108 k457 k4002875,4 k
nov 201138 1 41 k 5,92082,1 k39 Mb1,4 M106 k427 k3912785,4 k
out 201138 1 41 k 5,92081,1 k39 Mb1,4 M106 k423 k3902785,4 k
set 201138 4 41 k15,820898539 Mb1,4 M106 k421 k3902785,4 k
ago 201138 1141 k55,82082,2 k39 Mb1,4 M106 k420 k3902785,4 k
jul 201138 3141 k15,82071,5 k38 Mb1,4 M105 k417 k3692225,4 k
jun 201138 3141 k45,72056,0 k38 Mb1,4 M104 k415 k3632015,4 k
mai 201138 3 41 k 5,62042,2 k38 Mb1,4 M102 k406 k3611895,4 k
abr 20113812141 k 5,62044,2 k38 Mb1,4 M102 k403 k3611895,4 k
mar 201137 3241 k55,52043,9 k38 Mb1,4 M102 k398 k3601895,4 k
fev 20113714241 k185,42034,3 k37 Mb1,3 M99 k391 k3601895,4 k
jan 20113635340 k155,32015,1 k37 Mb1,3 M92 k380 k3601895,4 k
dez 201033 3240 k255,31986,8 k36 Mb1,3 M87 k369 k3611895,4 k
nov 201033 4439 k325,21925,0 k34 Mb1,2 M80 k353 k3421505,4 k
out 201033 5438 k875,218613 k33 Mb1,2 M73 k341 k26885,4 k
set 20103346335 k65,21818,4 k31 Mb1,1 M55 k315 k19885,3 k
ago 201029 4135 k 51825,2 k31 Mb1,1 M54 k307 k19375,3 k
jul 20102911135 k 4,91825,5 k31 Mb1,1 M54 k302 k19375,3 k
jun 201028 1135 k 4,71824,8 k31 Mb1,1 M54 k297 k19375,3 k
mai 201028 1135 k 4,61824,2 k31 Mb1,1 M54 k292 k19375,3 k
abr 201028 3135 k 4,41822,5 k31 Mb1,1 M54 k288 k19475,3 k
mar 201028 1135 k 4,41822,5 k31 Mb1,1 M54 k286 k19455,3 k
fev 201028 1135 k 4,31812,8 k31 Mb1,1 M54 k283 k19455,3 k
jan 201028 1135 k 4,21814,4 k31 Mb1,1 M54 k281 k19455,3 k
dez 200928 1135 k 4,11815,4 k31 Mb1,1 M54 k276 k19555,3 k
nov 20092812135 k 3,91815,4 k31 Mb1,1 M54 k271 k19655,3 k
out 200927 3235 k13,81815,2 k31 Mb1,1 M54 k266 k19655,3 k
set 200927 2235 k33,61813,5 k30 Mb1,1 M54 k261 k19655,3 k
ago 200927 1135 k 3,61813,9 k30 Mb1,1 M53 k258 k19555,3 k
jul 200927 1135 k 3,41812,1 k30 Mb1,1 M53 k254 k19555,3 k
jun 200927 1135 k 3,41812,4 k30 Mb1,1 M53 k252 k19555,3 k
mai 200927 2135 k 3,31815,5 k30 Mb1,1 M53 k250 k19555,3 k
abr 200927 1135 k 3,21816,3 k30 Mb1,1 M53 k245 k19555,3 k
mar 20092713235 k 318114 k31 Mb1,1 M48 k255 k19575,3 k
fev 200926 1135 k 2,61818,5 k30 Mb1,1 M48 k222 k6375,3 k
jan 20092613135 k32,318180429 Mb1,1 M48 k188 k6375,3 k
dez 200825 1 35 k102,318167829 Mb1,1 M48 k186 k6375,3 k
nov 200825 1 34 k 2,318051429 Mb1,1 M48 k184 k6365,3 k
out 200825 1134 k52,318093829 Mb1,1 M48 k182 k6365,3 k
set 200825 1134 k112,31791,6 k29 Mb1,1 M47 k179 k6365,3 k
ago 200825 1134 k42,317774428 Mb1,1 M44 k173 k6365,3 k
jul 20082512134 k22,217782428 Mb1,1 M43 k171 k6365,3 k
jun 200824 2134 k12,21762,2 k28 Mb1,1 M43 k168 k6365,3 k
mai 20082411 34 k 2,21765,4 k28 Mb1,1 M42 k161 k6345,3 k
abr 200823 3134 k2217662327 Mb1,1 M42 k138 k6345,3 k
mar 200823 3134 k221761,5 k27 Mb1,1 M42 k136 k6345,3 k
fev 20082324134 k21,91762,1 k27 Mb1,1 M41 k132 k6335,3 k
jan 20082113134 k11,91753,8 k27 Mb1,0 M40 k120 k6035,3 k
dez 200720 1134 k171,81752,2 k26 Mb1,0 M40 k82 k6035,3 k
nov 20072012233 k171,71741,6 k25 Mb1,0 M36 k69 k6035,3 k
out 200719 1132 k81,71732,5 k25 Mb1,0 M31 k63 k6025,3 k
set 20071914132 k4161,617218 k24 Mb995 k28 k44 k6025,3 k
ago 20071836320 k5341,817024 k14 Mb590 k19 k27 k6023,2 k
jul 2007153623,2 k283,62183,5 k2,7 Mb99 k14 k5,9 k582280
jun 2007121212,3 k93,52127681,8 Mb63 k7,8 k4,1 k10 140
mai 200711 112,0 k63,52019441,5 Mb52 k7,3 k3,0 k10 134
abr 200711 211,9 k83,41951,3 k1,3 Mb45 k6,7 k2,2 k8 113
mar 2007113611,6 k183,11871,8 k1,0 Mb37 k5,7 k1,2 k8 90
fev 200781211,1 k73184784735 kb25 k3,6 k1,2 k8 45
jan 20077 11854102,81731,0 k564 kb18 k2,4 k3817 33
dez 20067 1153632,6214250414 kb12 k1,5 k1005 17
nov 2006712145252,5213371339 kb9,3 k1,0 k975 10
out 2006613130332,5205323210 kb4,1 k280945 7
set 2006512121332,1278252138 kb1,2 k123833 2
ago 20064   118 1,72201076 kb69280771 1
jul 20064 1 116 1,62241374 kb65674471 1
jun 2006423111431,522011673 kb6417347  1
mai 20062   14 4229 8,7 kb3435747   
abr 20062   14 422998,7 kb3435747   
mar 200621  10 4,727096,5 kb267427   
fev 20061   7 5,415941,8 kb95142   
jan 20061   7 4,915941,8 kb95142   
dez 20051   7 4,315961,8 kb95142   
nov 20051   7 3,4159 1,8 kb95142   
out 20051   7 3,4159 1,8 kb95142   
set 20051   7 3,4159 1,8 kb95142   
ago 20051 1 7 3,4159201,8 kb95142   
jul 20051   1 426 71 31    
jun 200511  1 426471 31    
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
The following table ranks this project in relation to projects in other languages with 1000+ articles
abr 201543402411371230 3      140
jan 201544354229372756322716272611928140
out 201441384627352360333217262511930140
jul 201441333826352556343118262711929140
abr 201439273017352760342118262711927140
jan 201441333526341661331517232411927140
out 2013414346323336623351162325111227140
jul 2013401835273226623223162125111625140
abr 2013402622143215623521162325111625140
jan 2013413323203210583418172425121827140
out 201241362014346513916192927142925140
jul 2012404937253555414663233230162924140
abr 201239313712358414618233230152823140
jan 2012391027203628385229253532263231140
out 2011414066483568405358243332263329140
jul 2011414446383460395239223032263433140
abr 2011412952383361425233222933263232140
jan 2011411333183327425324212833263031140
out 2010413536183312445520213034253392140
jul 2010433589633266465730212938243891140
abr 2010434650593158575537202937243792140
jan 2010433378533061545328192936243692140
out 2009434052402652585326192834233692140
jul 2009434081582659595138172632223591140
abr 2009425083562553594923162530203290140
jan 2009404643342441654844132329214689140
out 2008403659362435654731132328204889139
jul 2008392744342445644744122229204688139
abr 2008404240382248604447122028214387139
jan 2008403839401955614124111825214189139
out 2007393956391831623724111626253694139
jul 2007401621254419362718364334553294138
abr 20074539503348323831364553436256107138
jan 20075348563057245555385563548550100138
out 20065433383363385050496379811094797138
jul 20066440523868534646776897891105797138
abr 200688385435954942427096104841025495138
jan 2006964459349141373786108103901184590131
out 2005883350268736323279999686994182118
jul 2005823043259435292975106103901003079113
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100ediçõesbytes
 WikcionaristasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikcionaristas (usuários registrados)
A = Wikcionaristas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikcionaristas que editaram pelo menos dez vezes desde que chegaram
C = Wikcionaristas que contribuíram cinco vezes ou mais este mês
D = Wikcionaristas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  2500  10000  25000  100000  5  10  100  1000  10000  1  3  5  10  25  100  250  1000  5  10  100  1  3  5  10  25  100  250  1000  5  10  100 
jun 2015125443331    2221 21         111     11 
mai 20158322222     221  1          2       11 
abr 20151110986643111 332  10611    22210555411122 
mar 20151265554432111331  72221   111533321  11 
fev 20156443331     11   92111      81      11 
jan 201573332221    3321 62111      43321   111
dez 2014555443311   2221 21111      62211   11 
nov 201483333221         5211       41         
out 2014522222211        21111      3          
set 2014532222221        31         3          
ago 2014113322222    111  3          832        
jul 201484322211    111  31         2          
jun 2014864322211   111  211        51         
mai 2014644442211   111  2          21         
abr 20141055543221   111  4311       81         
mar 2014944442221   111  411        9322       
fev 201414108521111   111  2111       71         
jan 2014754442221   222  21111      1054        
dez 20131054333311   2211 73211      533111     
nov 201312333332111       8521       1965311     
out 20136322211          321        932        
set 2013104332111         221        7422       
ago 201384443222    1111 52221      42211      
jul 201385433222    1111 4211       6321       
jun 2013136655221    1111 211        75321      
mai 2013116555411    2211 8542       137731   1  
abr 2013137765433    5411 166531111   2287431     
mar 2013159664432    4411 621        10541    11 
fev 20131376443311   3331 71         105332      
jan 20131187543222   5511 51         115422   11 
abr 20151110986643111 332  10611    22210555411122 
jan 201573332221    3321 62111      43321   111
out 2014522222211        21111      3          
jul 201484322211    111  31         2          
abr 20141055543221   111  4311       81         
jan 2014754442221   222  21111      1054        
out 20136322211          321        932        
jul 201385433222    1111 4211       6321       
abr 2013137765433    5411 166531111   2287431     
jan 20131187543222   5511 51         115422   11 
out 20121066544433   4421 421        1264431     
jul 2012874332      332  6221       104321      
abr 20121044444321   4422 621        127422      
jan 201213865443     3321 422221     744431  21 
out 20115211       332             4       11 
jul 2011433321      2111 11         63111      
abr 2011852211      2221 21         311        
jan 201110655432     2211 2          941        
out 2010555444322   11   3222       52211      
jul 2010611111111        1          1          
abr 201064321111    21   1          21         
jan 2010421111111   22   2          2111       
out 2009533222111   11   1          421        
jul 200931111111                    3          
abr 2009411111111   32   1          311        
jan 2009633321      111             321        
out 20085111111     111  2          422        
jul 20083222211     111  21         11         
abr 2008643221      111  2          3111       
jan 2008433321      2222 21         1          
out 20075211111     1111 1          1          
jul 200797653222    22   431        54441   1  
abr 200732222111    11   3          11111      
jan 20073111111     11   1          21111      
out 2006433221      1    3          52         
jul 2006211             1          4321       
abr 200641             631        84422   11 
jan 20061              2111       3          
out 2005                          1          
jul 2005                                  11 

 

Distribuição de edições de artigos por wikcionaristas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikcionaristasEdições total
1238100.0%551,869100.0%
310745.0%551,674100.0%
106326.5%551,43899.9%
324318.1%551,09499.9%
1002711.3%550,17199.7%
316198.0%548,80599.4%
100093.8%542,91398.4%
316283.4%541,45898.1%
1000062.5%527,50895.6%
3162331.3%461,42783.6%
10000031.3%461,42783.6%

 

12 wikcionaristas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions
agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
JVRKPRASADUC1 0247,1951,4097,1429set 20, 2010174314,0121233,8342
BhaskaranaiduUC3 0106,6726257613abr 12, 2012117339,082205502-
NrgullapalliUC7 08,4585398-jan 19, 20145261,9072012-
GokulellankiUC15 0488151-fev 06, 201514319431-
CommonsDelinkerUC27 013019-mai 13, 20072969----
Marcus CyronUC87+15512-jan 09, 2014536--1-
HydrizUC106...445-jun 23, 20156--1-
Praveen IllaUC122+2531--jan 13, 201453211--
BlacknclickUC234...11--jun 06, 201523----
1994thegoodolddaysUC235...11--jun 20, 20159----
MakkachinUC236...11--jun 24, 20155----
Ḧÿn̈öẍïUC237...11--jun 25, 20154----

 

20 wikcionaristas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
InterwicketUC2107,560jan 29, 20092342nov 08, 20101694
Rajasekhar1961UC430,665jul 03, 20072918abr 20, 201570
T.sujathaUC524,693set 21, 20063203ago 20, 2013678
PalagiriUC610,723abr 14, 20121171jun 10, 2013749
Info-farmerUC85,492fev 04, 2015145abr 04, 201586
IkotobaityUC91,455dez 19, 20111288dez 20, 20111287
DvnsarmaUC10898jan 15, 20111626set 17, 20121015
Rajasekhar1962UC11881jan 17, 20121259fev 17, 20121228
బుడుగోయ్UC12842jan 21, 20111620mar 30, 20111552
సుండ్రుUC13773jan 21, 20082716out 22, 20092076
MpradeepUC14495abr 24, 20063353abr 18, 20082628
శశికాంత్UC16468set 22, 20101741mar 16, 20111566
AngajalaARSUC17386jan 18, 20121258fev 10, 20121235
Kolipaka.raghuramUC18332jan 25, 20121251mar 31, 20121185
JambolikUC19329dez 05, 2012936mar 09, 2015112
Chavakiran~tewiktionaryUC20252mar 28, 20063380set 13, 20111385
విశ్వనాధ్.బి.కె.UC21225nov 10, 20072788jan 07, 20092364
SriphaniUC22202fev 14, 2013865fev 09, 2014505
ArjunaraocUC23155set 07, 20101756mar 13, 2015108
ChaduvariUC24135ago 05, 20053615fev 14, 2014500

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 5.385 edições foram feitas por usuários anônimos, de um total de 742.370 edições ( 0e %)
  


19 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
HydrizBotUC150,464set 13, 20121019jun 30, 2015---
Luckas-botUC250,405mar 03, 20092309jan 27, 2014518--
MpradeepbotUC336,336jul 12, 20072909set 12, 2007284727,467-
VolkovBotUC414,183ago 20, 20072870abr 18, 2013802--
KamikazeBotUC512,080dez 03, 20111304mar 07, 2013844--
RobotGMwiktUC66,272ago 21, 20063234jun 06, 20082579--
AvocatoBotUC75,962out 27, 20111341ago 09, 2013689--
YS-BotUC85,032set 05, 20121027jun 30, 2015---
MonoBotUC92,584dez 25, 20072743jun 14, 20082571--
SpaceBirdyBotUC10489fev 02, 20092338mai 12, 20092239--
Bot-JagwarUC11386dez 30, 20111277jun 06, 20121118--
VyzbotUC12304dez 19, 20082383dez 19, 20082383303-
CarsracBotUC13248dez 02, 20092035mai 29, 2013761--
Makecat-botUC14174nov 10, 2012961abr 05, 2013815--
JAnDbotUC15129jun 26, 20121098abr 29, 201561--
タチコマ robotUC1624jul 02, 2013727jul 02, 2013727--
QualiaBotUC172jul 20, 20082535ago 19, 20082505--
ArjunaraocbotUC182mai 04, 20121151mai 04, 20121151--
BucetaBotUC191set 08, 20101755set 08, 20101755--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110GifJpgOggPngSvg
jun 2015111 k6165981,3 k1521,3 k15702       101,2 k43639
mai 2015110 k6165981,3 k1521,3 k15702       101,2 k43639
abr 2015110 k6155981,3 k1521,3 k15702       101,2 k43639
mar 2015108 k6045971,3 k1521,3 k15698      139170101,2 k43639
fev 2015107 k5975951,3 k1521,2 k15686      667101,2 k43639
jan 2015106 k5925951,3 k1521,2 k15686      1762101,2 k43639
dez 2014106 k5905951,3 k1521,1 k15685      5588101,2 k43639
nov 2014104 k5895921,3 k1511,1 k14679      3208101,2 k43639
out 2014103 k5855921,3 k1511,1 k14679      3366101,2 k43639
set 2014102 k5845921,3 k1511,1 k14679      5114101,2 k43639
ago 2014101 k5805921,3 k1511,1 k14679      2789101,2 k43639
jul 2014100 k5745921,3 k1511,1 k14679      2106101,2 k43639
jun 201499 k5745921,3 k1511,1 k14679      3599101,2 k43639
mai 201499 k5695921,3 k1511,1 k14679      4175101,2 k43639
abr 201498 k5695921,3 k1511,1 k14679      4340101,2 k43639
mar 201497 k5645921,3 k1511,1 k14677      5198101,2 k43639
fev 201496 k5605921,3 k1511,1 k14674      4325101,2 k43639
jan 201495 k5545921,3 k1511,1 k14674      8218101,2 k43639
dez 201395 k5415921,3 k1511,1 k14673      7975101,2 k43639
nov 201394 k5415801,3 k1511,0 k13654      12713101,2 k43639
out 201394 k5375631,3 k15195110640      508101,2 k43639
set 201394 k5325631,3 k15195110640      1415101,2 k43639
ago 201393 k5185631,3 k15195110640      2511101,2 k43639
jul 201393 k5145631,2 k15195110638      2379101,2 k43639
jun 201392 k5105631,2 k15195110636      2240101,2 k43639
mai 201391 k5085611,2 k15194810632      2545101,2 k43639
abr 201390 k5065541,2 k15194810632      3998101,2 k43639
mar 201388 k4945231,2 k1519449622      4586101,1 k43539
fev 201386 k4835231,2 k1439449622      6513101,1 k43539
jan 201381 k4775001,2 k1439449613      9895101,1 k43539
dez 201275 k4734611,1 k1439429611      67991099443539
nov 201271 k4674149491439249598      87331086043539
out 201266 k4663798871437909579      135711079843539
set 201259 k4613738521437379544      53391076343539
ago 201256 k4533588511437349541      31621076243539
jul 201255 k4463357921437349537      3411070343539
jun 201255 k4412797921437349535      7101070343539
mai 201254 k4282537891437269533      17301070043539
abr 201254 k4191947831437149524      60901069443539
mar 201252 k4091447801436919512      45851069143539
fev 201250 k4051447801436899477      53261069143539
jan 201249 k3951067791433843351      18981069043539
dez 201148 k329797701433253347      2141868823239
nov 201147 k322787701433223344      45868823239
out 201147 k311787701433213344      21868823239
set 201147 k307787701433213344      119868823239
ago 201146 k303787691433213342      1389868723239
jul 201146 k299787631433093319      276868123239
jun 201146 k291777621433003315      455868113239
mai 201146 k288777571432973307      95867713139
abr 201146 k283777561432973307      151867613139
mar 201146 k275777561432973306      464867613139
fev 201146 k273777561432973306      829867613139
jan 201145 k265777401432973306      897866013139
dez 201045 k260777341432953306      2234865413139
nov 201044 k259663531431603270      49463345 5 
out 201043 k24366179142144379      13359 176 3 
set 201041 k24265146142143378      8412 143 3 
ago 201040 k23462145141139378      5184 142 3 
jul 201040 k21762145141139378      5483 142 3 
jun 201040 k21662145141139378      4805 142 3 
mai 201040 k20262145141139378      4147 142 3 
abr 201040 k20062145141139378      2469 142 3 
mar 201040 k19662145141139378      2497 142 3 
fev 201040 k19362145141139378      2800 142 3 
jan 201040 k19162145141139378      4332 142 3 
dez 200940 k17762145141139378      5289 142 3 
nov 200940 k17662145141139378      5371 142 3 
out 200940 k17562145141139378      5218 142 3 
set 200940 k17162145141139376      3488 142 3 
ago 200940 k16562145141139364      3847 142 3 
jul 200940 k16562145141139364      2069 142 3 
jun 200940 k16362145141139364      2367 142 3 
mai 200940 k16262145141138364      5469 142 3 
abr 200940 k16162145141138364      6244 142 3 
mar 200940 k15362145141136364      14135 142 3 
fev 200940 k14761145141136364      7907 142 3 
jan 200940 k14161145141136364      153 142 3 
dez 200840 k14061145141136364      12 142 3 
nov 200840 k14061145141135364      8 142 3 
out 200840 k12861145141135364      592 142 3 
set 200840 k11661145141135364      1204 142 3 
ago 200839 k11661142141135363      550 139 3 
jul 200839 k11461141141135363      346 138 3 
jun 200839 k11361141141134363      139 138 3 
mai 200839 k10860140141134363      81 137 3 
abr 200839 k10860140141134363      162 137 3 
mar 200839 k10760140141131363      225 137 3 
fev 200839 k10260140140124258      328 137 3 
jan 200839 k9759112140123256      233 109 3 
dez 200739 k9459112140123256      1290 109 3 
nov 200738 k7659112140123256      1169 109 3 
out 200738 k7359111140123256      619 109 2 
set 200737 k7359111140123256      2259 109 2 
ago 200723 k6758111140119253      2913 109 2 
jul 20073,5 k5857111140107242      3265 109 2 
jun 20072,4 k555310913910021      741 107 2 
mai 20072,2 k555310913810021      765 107 2 
abr 20072,0 k545310913810021      1133 107 2 
mar 20071,7 k545310913810021      1738 107 2 
fev 20071,1 k52531081379421      693 107 1 
jan 200788750531081379421      811 107 1 
dez 20065534953851379421      231 84 1 
nov 20064624953531379421      355 52 1 
out 2006310485211379421      288   1 
set 200621544521137922           1 
ago 200611943271137912           1 
jul 20061174227 137912             
jun 20061154124 137882             
mai 2006144124 137882             
abr 2006142924 137882             
mar 2006102120 137881             
fev 200671115 137851             
jan 200671115 137851             
dez 20057915 137841             
nov 20057513 134841             
out 20057511 134841             
set 20057510 13484              
ago 20057510 13284              
jul 2005121 13175              
jun 2005121 13175              

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

ago 2005: 1 2 మొదటి పేజీ , 2 1 శరీరావయవాలు

dez 2005: 1 1 మొదటి పేజీ

jan 2006: 1 1 మొదటి పేజీ

fev 2006: 1 1 attract

mar 2006: 1 2 మొదటి పేజీ , 2 1 విదళించు

abr 2006: 1 2 mother , 2 1 mère

jun 2006: 1 2 బకాల్ , 2 2 బకాయ , 3 2 బకవైరి , 4 2 బంధము , 5 2 బంగారుకొండ , 6 1 బానిస

jul 2006: 1 2 అమ్మ , 2 1 మచ్చుకి

ago 2006: 1 1 అన్నము

set 2006: 1 2 బాబాయి , 2 2 బందుగుడు , 3 2 బందిఖానా , 4 2 బందా , 5 2 బంతి , 6 2 బండి , 7 2 బంగారుతీగలు , 8 2 బంగారము , 9 2 బంకోలు , 10 2 బంకమన్ను , 11 2 చాకిరి , 12 1 ఔషధము

out 2006: 1 3 బట్టతల , 2 2 క్షణము , 3 2 అరటిపండు , 4 2 బట్టమేక , 5 2 ఐకమత్యము , 6 2 ఐరావతము , 7 2 ఊకదంపుడు , 8 2 ఊరు , 9 2 ఉడుత , 10 2 ఉమ , 11 2 ఇంపు , 12 2 ఇల్లు , 13 1 kind

nov 2006: 1 2 ఊతము , 2 2 ఊపు , 3 2 ఉగ్రము , 4 2 ఉపయోగము , 5 2 ఉదయము , 6 2 అహింస , 7 2 అర్ధము , 8 2 అంతము , 9 2 అంతరము , 10 1 Raice flaks

dez 2006: 1 1 మూత్రపిండాలు

jan 2007: 1 3 టెంకాయచెట్టు , 2 2 వేపచెట్టు , 3 1 చందనము

fev 2007: 1 2 అపరాధము , 2 1 Cumin

mar 2007: 1 2 ఉర్వి , 2 2 మను , 3 2 మనస్తాపము , 4 2 మనస్కారము , 5 2 మనస్కరించు , 6 2 మనసు , 7 2 మనసిజుడు , 8 2 మనసరి , 9 1 ఆత్మ

abr 2007: 1 2 Daughter , 2 2 కోడలు , 3 2 కొడుకు , 4 2 అల్లుడు , 5 2 కూతురు , 6 2 బావమరిది , 7 1 కళాకారుడు

mai 2007: 1 2 కర్ణము , 2 2 ఆశ , 3 1 Joint

jun 2007: 1 2 వారసత్వము , 2 2 అబద్ధము , 3 2 అపహరణ , 4 2 అంధత్వము , 5 2 భోజనం , 6 1 బ్రమ

jul 2007: 1 3 వరుడు , 2 3 రక్తము , 3 3 ఆమ్లజని , 4 3 attraction , 5 3 alimony , 6 3 వెన్నెల , 7 3 మరదలు , 8 3 అన్న , 9 3 ఉడుము , 10 2 పరాభవము , 11 2 పంజరము , 12 2 దానిమ్మ , 13 2 సిరా , 14 2 లోతు , 15 2 లెక్క , 16 2 రుచి , 17 2 నగ , 18 2 నెమలి , 19 2 తోకచుక్క , 20 2 తోక , 21 2 తేనీరు , 22 2 తేయాకు , 23 2 పత్ని , 24 2 వివాహము , 25 2 రోగము

ago 2007: 1 3 వీర్యం , 2 3 , 3 3 ఉదరము , 4 2 కార్ముకము , 5 2 twist , 6 2 cape , 7 2 cleaver , 8 2 clerk , 9 2 clerical , 10 2 cleverness , 11 2 clever , 12 2 couch , 13 2 dislocated , 14 2 effectually , 15 2 గోపురము , 16 2 చెంచా , 17 2 entail , 18 2 పొద్దుతిరుగుడు , 19 2 hand , 20 2 harbour , 21 2 harem , 22 2 how , 23 2 huff , 24 2 spiritual , 25 2 iota

set 2007: 1 2 పరమండలము , 2 2 పుట్టినదినము , 3 2 మరమరాలు , 4 2 whelk , 5 2 జ్యేష్ఠ , 6 2 saint , 7 2 potter , 8 2 part , 9 2 లిప్త , 10 2 వితత , 11 2 stool , 12 2 food , 13 2 oil , 14 2 line , 15 2 చిరుతపులి , 16 2 జ్ఞానము , 17 2 ఆచారము , 18 2 అంగారకుడు , 19 2 cloth , 20 2 భూమి , 21 2 ఈగ , 22 1 చిన్నగా

out 2007: 1 2 నారాయణుడు , 2 1 రాజదూత

nov 2007: 1 2 పెండ్లి , 2 2 ప్రసంగము , 3 2 ఈక కలము , 4 2 దస్తా , 5 2 చెల్లింపు , 6 2 పద్యం , 7 2 గుణింతము , 8 2 బోధన , 9 2 రమణీయము , 10 2 ఉచితం , 11 2 అభ్యాసము , 12 2 గంట , 13 1 గోతము

dez 2007: 1 2 విష్ణుమూర్తి , 2 2 గొడుగు , 3 1 గిరాకి

jan 2008: 1 2 యోగ్యత , 2 2 అండ , 3 1 బరిసె

fev 2008: 1 2 సీసము , 2 2 ఉల్లిగడ్డ , 3 2 అంధవిశ్వాసము , 4 2 ఇత్తడి , 5 2 మంత్రి , 6 2 కొండ , 7 2 ఆవాలు , 8 2 ఊరు , 9 1 ముద్దాయి

mar 2008: 1 2 train , 2 2 fraction , 3 1 nitrogen

abr 2008: 1 2 protocol , 2 2 magnet , 3 1 మాగాణి

mai 2008: 1 1 అడవి గన్నేరు

jun 2008: 1 1 స్వతంత్రము

jul 2008: 1 2 సిగ్గుమాలిన , 2 2 తురక , 3 2 తవుడు , 4 2 బెత్తము , 5 2 సాలె , 6 2 అందము , 7 2 అమ్మ

ago 2008: 1 2 ధూమ శకటము , 2 1 ఎన్నిక

set 2008: 1 2 విస్తరి , 2 1 మరక

out 2008: 1 2 తూనీగ , 2 1 అనూరుడు

nov 2008: 1 1 లింగము

dez 2008: 1 3 chose , 2 1 తిరుపతి యాస, భాష, పదాలు

jan 2009: 1 1 apses

fev 2009: 1 2 Improvisation , 2 1 africa

mar 2009: 1 3 పాట , 2 2 orthodox , 3 2 ముద్దు , 4 2 మడుగు , 5 2 తనయ , 6 2 నిఘంటువు , 7 2 గొడ్డలి , 8 2 తోడేలు , 9 2 గంట , 10 2 ప్రకటన , 11 2 అంగుళము , 12 2 దువ్వెన , 13 2 దేవుడు , 14 2 మణికట్టు , 15 2 గుండె , 16 2 ఆవు

abr 2009: 1 1 Flyover

mai 2009: 1 2 o' clock , 2 1 కలహభోజనుడు

jun 2009: 1 1 coup d’etat

jul 2009: 1 2 Minerva , 2 2 monday , 3 1 minerva

ago 2009: 1 2 Feedback , 2 1 Expandable

set 2009: 1 3 శనివారము , 2 2 బంగాళాదుంప , 3 2 డిసెంబర్ , 4 2 నవంబర్ , 5 2 సెప్టెంబర్ , 6 2 ఆగష్టు , 7 2 జులై , 8 1 పింగళ

out 2009: 1 2 వరి , 2 2 లోటా , 3 1 అప్రమేయ

nov 2009: 1 2 spine , 2 2 వెన్నుపాము , 3 2 నాభి , 4 2 బొడ్డు , 5 1 ద్వైతం

dez 2009: 1 2 amala

jan 2010: 1 1 వంశీ

fev 2010: 1 2 zoo , 2 1 aye

mar 2010: 1 2 o' clock , 2 1 zoo

abr 2010: 1 2 anklets , 2 2 అల్లాహ్ , 3 2 awesome , 4 2 Subtrahend

mai 2010: 1 2 end , 2 1 సుమారు

jun 2010: 1 2 unitarian , 2 2 solution , 3 1 algebraic

jul 2010: 1 2 వృథా , 2 2 milk

ago 2010: 1 3 vert , 2 3 dried , 3 2 suicide bomber , 4 2 toothless , 5 2 publisher , 6 2 over-roasted , 7 2 community , 8 2 fleshiness , 9 2 January

set 2010: 1 3 abnormal , 2 3 quadruped , 3 3 abate , 4 3 abject , 5 3 accent , 6 3 abdicate , 7 2 మధువు , 8 2 శెలవు , 9 2 ఏడాది , 10 2 put off , 11 2 in vain , 12 2 put out , 13 2 in time , 14 2 to and fro , 15 2 set down , 16 2 set out , 17 2 set in , 18 2 in search of , 19 2 go for a walk , 20 2 at home , 21 2 cut down , 22 2 as soon as , 23 2 pick up , 24 2 wake up , 25 2 crowbar

out 2010: 1 3 fractional distillation , 2 3 గుండీ , 3 2 పరిపక్వత , 4 2 సుద్ద , 5 2 జాగిలము , 6 2 చాకిరీ , 7 2 చాకచక్యము , 8 2 పానము , 9 2 పడిగాపు , 10 2 నిమిషము , 11 2 ప్రాణవాయువు , 12 2 ఎత్తైన , 13 2 చిత్రం , 14 2 నూర్పిడి , 15 2 గాలించు , 16 2 చెండు , 17 2 నిర్వచనము , 18 2 నియంత్రణ , 19 2 కజ్జికాయచెక్క , 20 2 ఎర్రగడ్డ , 21 2 సోయా చిక్కుడు , 22 2 జల్లిగరిట , 23 2 తెల్లపాయలు , 24 2 మినపప్పు , 25 2 గీతా జయంతి

nov 2010: 1 3 మిత్రద్రోహి , 2 3 సముద్రం , 3 3 నిరుత్సాహము , 4 3 శాఖము , 5 3 క్యాబేజీ , 6 3 ఆర్గాన్ , 7 3 ధూళి , 8 3 జీడిపప్పు , 9 3 రంపము , 10 2 చిమ్ముబిల్ల , 11 2 అష్టాదశ , 12 2 గరుడవర్ధనం పువ్వు , 13 2 బొరుగుల ఉప్మా , 14 2 అప్పము , 15 2 మురికికాలువ , 16 2 పచ్చగడ్డి , 17 2 నిర్మాణకౌశలము , 18 2 సంగీతకళాశాల , 19 2 ప్రదర్శనశాల , 20 2 చెక్కభజన , 21 2 సరుగుడుమొక్క , 22 2 జిల్లేడు పువ్వు , 23 2 సరుగుడు , 24 2 జిల్లేడుమొక్క , 25 2 దానిమ్మచెట్టు

dez 2010: 1 2 కుంకుడు గింజ , 2 2 కుంకుడు వృక్షం , 3 2 కుంకుడు కాయ , 4 2 కుంకుడు ఆకు , 5 2 ధన్వంతరి , 6 2 గరిడె , 7 2 నటరాజు , 8 2 మలికితము , 9 2 కొబ్బరి నూనె , 10 2 దత్తాత్రేయుడు , 11 2 ఆదిశేషుడు , 12 2 ఇండియా గేట్ , 13 2 కాళి , 14 2 అఱుపు , 15 2 జనప్రవాహము , 16 2 కూజా , 17 2 ఢమరుకం , 18 2 గిటారు , 19 2 ఉమ్మెత్త , 20 2 అచల , 21 2 ఆంధ్రప్రదేశ్ , 22 2 దేవుడి గూడు , 23 2 సముద్రతీరము , 24 2 ఇసుక గూడు , 25 2 కంజీర

jan 2011: 1 2 హడపు , 2 2 హఠము , 3 2 wiki , 4 2 హరిశ్చంద్రుడు , 5 2 పెన్సిలు , 6 2 అంగ మర్దనము , 7 2 అంగమర్ధుడు , 8 2 అక్కటికము , 9 2 అంకగణితము , 10 2 వర్గము , 11 2 మర , 12 2 తురగము , 13 1 హరిసఖుడు

fev 2011: 1 2 burning , 2 1 హోత

mar 2011: 1 1 ఘర్షకం

abr 2011: 1 1 கணினி

mai 2011: 1 2 ఆధునిక , 2 2 అనగా , 3 2 అనంతం , 4 2 అధ్యయనము , 5 1 అధునిక

jun 2011: 1 2 అనువాదాలు , 2 2 క్షమ , 3 1 క్రోసుడు

jul 2011: 1 2 అనుభోగము , 2 2 అనుభవము , 3 2 అనుపమానము , 4 2 mastiff , 5 1 అగ్ని (దేవుడు)

ago 2011: 1 1 మాత్రము

set 2011: 1 2 ఈత , 2 2 అతుకు , 3 1 గాయకురాలు

out 2011: 1 1 రాచనగరు

nov 2011: 1 1 శంఖం

dez 2011: 1 2 నిర్యాణము , 2 2 zoro , 3 2 sehatra , 4 2 మిరపకాయ , 5 2 జనపనార , 6 2 airy , 7 1 ప్రపితామహం

jan 2012: 1 3 చేయి , 2 3 చెవి , 3 3 మొదటి పేజీ , 4 2 యవ్వారం , 5 2 కపోతము , 6 2 ఛాతీ , 7 2 గుర్రప్పందాలు , 8 2 వ్రేలాడదీయు , 9 2 విజ్ఞాన శాస్త్రము , 10 2 తత్వ శాస్త్రము , 11 2 జీవ శాస్త్రము , 12 2 వృక్ష శాస్త్రము , 13 2 జంతు శాస్త్రము , 14 2 వాస్తు శాస్త్రము , 15 2 అర్ధ శాస్త్రము , 16 2 ఆర్ధిక శాస్త్రము , 17 2 మానసిక శాస్త్రము , 18 2 భూగోళ శాస్త్రము , 19 2 గణిత శాస్త్రము , 20 2 తర్క శాస్త్రము , 21 2 పౌర శాస్త్రము , 22 2 వైద్య శాస్త్రము , 23 2 యంత్ర శాస్త్రము , 24 2 భూగర్భ శాస్త్రము , 25 2 వ్యాకరణ శాస్త్రము

fev 2012: 1 3 calf , 2 3 రాజు , 3 3 పక్షవాతము , 4 3 ఔషధము , 5 2 పోగుచేసిన , 6 2 మృదువైన , 7 2 సీసా , 8 2 అస్థిరత , 9 2 ఊరివాడు , 10 2 నల్లచేవమాను , 11 2 బొగ్గు నలుపు , 12 2 ఆకుపచ్చ , 13 2 చామనఛాయ , 14 2 ఇతివృత్తము , 15 2 గౌరవమైన , 16 2 వాత్సల్యము , 17 2 ప్రియమైన , 18 2 సహజముగా , 19 2 ప్రశంసనీయం , 20 2 కమ్మని , 21 2 నియంత , 22 2 అంటువ్యాధి , 23 2 వాతం , 24 2 నవ్యత , 25 2 నిర్దాక్షణ్యం

mar 2012: 1 2 మైకము , 2 2 బలుపాకురాయి , 3 2 దక్షిణధృవము , 4 2 ఉత్తరధృవము , 5 2 ధృవము , 6 2 తడిపొడి , 7 2 సుదతి , 8 2 కొరత , 9 2 అనుగుణ్యము , 10 2 కక్షిదారు , 11 2 బడలిక , 12 2 శోభ , 13 2 దౌత్యము , 14 2 రక్తహీనత , 15 2 అంబరు , 16 2 దేశ్యము , 17 2 ఎగుమతి , 18 2 దిగుమతి , 19 2 కోశాధికారి , 20 2 పుంలింగము , 21 2 తెడ్డు , 22 2 పేక , 23 2 నూలు , 24 2 పాఠశాల , 25 2 గుర్రము

abr 2012: 1 3 ఇరుసు , 2 3 ఆస్ట్రేలియా , 3 3 గంటము , 4 3 పూస , 5 2 తాచుపాము , 6 2 సౌదీ అరేబియా , 7 2 ఉత్తర కొరియా , 8 2 దక్షిణ కొరియా , 9 2 ఆఫ్రికా , 10 2 గంటసాల , 11 2 చెంగావి , 12 2 ముక్కిన , 13 2 తొండం తాడు , 14 2 కదురుగోలు , 15 2 కపిలి బండి , 16 2 ములుగర్ర , 17 2 కొండ్ర , 18 2 దాపట , 19 2 మోట , 20 2 కపిలి , 21 2 ఎలపట , 22 2 మడవ , 23 2 గూడ , 24 2 హీలియము , 25 2 ఉండ్రాళ్ళు

mai 2012: 1 3 కడుపుతో నుండుట , 2 2 కడపర , 3 2 కడతెగు , 4 2 రాజకీయాలు , 5 2 ఆటవెలది , 6 2 తపాలాబిళ్ళ , 7 2 పిరంగి , 8 2 జగము , 9 2 కంకర , 10 2 వాడి , 11 2 కార్యాలయము , 12 2 కడపటి , 13 2 ఎనుము , 14 2 నందివర్ధనం చెట్టు , 15 2 చల్ల , 16 2 కోడిపుంజు , 17 2 ఉత్తరక్రియ , 18 2 వరము , 19 2 ఛాపము , 20 2 పరము , 21 2 మట్టిపాత్రలు , 22 2 బస్సు , 23 2 సంస్కృత నిఘంటువు , 24 2 నీరుల్లి , 25 2 అలరు

jun 2012: 1 2 షట్కోణము , 2 2 జీవకణము , 3 2 ఠంకారము , 4 2 కడలు , 5 2 టెలిఫోన్ , 6 2 నకలు , 7 2 రోమము , 8 2 ఓడ , 9 1 రామ

jul 2012: 1 2 శిఖండి , 2 2 హిడింబి , 3 2 కీచకుడు , 4 2 కేంద్రకము , 5 2 అంగప్రదక్షిణము , 6 2 బీజము , 7 2 శంతనుడు , 8 2 జనమేజయుడు , 9 2 ఆదిత్యుడు , 10 2 వ్యాసుడు , 11 1 జంబూ

ago 2012: 1 3 గీత , 2 2 అరకన్ను , 3 2 అరకాని , 4 2 అయ్యవారు , 5 2 అయోగము , 6 2 అయుక్తము , 7 2 అయశస్కరము , 8 2 అయశము , 9 2 అయత్నము , 10 2 అమృతకలశము , 11 2 అమృతుడు , 12 2 అమృతాంశువు , 13 2 అమృతాంధనుడు , 14 2 అముద్రితము , 15 2 అమిత్రుడు , 16 2 అమాంతవర్తకుడు , 17 2 అమవస , 18 2 అమలుదారుడు , 19 2 అభూతము , 20 2 అమరావతి , 21 2 అమరాద్రి , 22 2 అమరాంగన , 23 2 అభ్యున్నతము , 24 2 అభ్యుచితము , 25 2 అభ్యారోహణము

set 2012: 1 3 దుర్గ , 2 2 ఈల , 3 2 ఈడ , 4 2 ఇలకోడి , 5 2 ఇర్వురు , 6 2 ఇరువురు , 7 2 ఇరువది , 8 2 ఇరుగుపొరుగు , 9 2 ఇరుగు , 10 2 ఇట్టిక , 11 2 ఇటిక , 12 2 ఇచ్చట , 13 2 ఇగో , 14 2 ఇక్షువు , 15 2 ఇండ్లు , 16 2 జాగా , 17 2 ఆవంత , 18 2 ఆదివరాహము , 19 2 ఆజ్ఞానుసారముగా , 20 2 ఆజ్ఞానుసారము , 21 2 ఆజ్ఞానువర్థి , 22 2 ఆకుపురుగు , 23 2 ఆబోతు , 24 2 గీతము , 25 2 ఉష్ణం

out 2012: 1 3 కాపురస్థుడు , 2 3 తెలుగు మహిళల పేర్లు , 3 3 ఎతడు , 4 3 ఎడ్లు , 5 3 ఎడ్డము , 6 3 ఎడారె , 7 3 ఎడవాడు , 8 3 ఎడద , 9 3 ఊదా , 10 3 ఉల్లంఘించు , 11 3 ఉలగరము , 12 3 ఉరోజము , 13 3 ఉరము , 14 3 ఉముక , 15 3 ఉబ్బు , 16 3 ఉపవనము , 17 3 ఉంపుడుకత్తె , 18 3 ఉంపడము , 19 3 ఉంఛవృత్తి , 20 3 ఉంఛము , 21 3 ఉంగ్రము , 22 3 కంచరగాడిద , 23 3 ఉక్కిరిబిక్కిరి , 24 3 ఉల్బము , 25 3 ఎగురు

nov 2012: 1 3 షట్చక్రవర్తులు , 2 3 అష్టదిక్పాలకులు , 3 3 తెలుగు పురుషుల పేర్లు , 4 3 లక్షాధికారి , 5 3 తెలుగు మహిళల పేర్లు , 6 3 కమ్మ , 7 3 తెలుగు జాతీయములు , 8 3 కుట్టు , 9 3 విను , 10 3 చింత , 11 3 కట్టు , 12 2 అంగలూరు , 13 2 కృష్ణా జిల్లా గ్రామాలు , 14 2 చిదుగు , 15 2 చిదాత్మ , 16 2 చిదగొద , 17 2 చిత్రిణి , 18 2 చిత్రాసనము , 19 2 చిత్రాన్నము , 20 2 చిత్రశిఖండిజుడు , 21 2 చిత్రశాల , 22 2 చిత్రవాలము , 23 2 చిత్తిని , 24 2 చిత్తవృత్తి , 25 2 చిత్తవిప్లవము

dez 2012: 1 3 కక్కాయి , 2 3 ద్వయము , 3 2 నాటుకొను , 4 2 కలువరాయడు , 5 2 కమ్మరీడు , 6 2 ధేనుక , 7 2 దావాగ్ని , 8 2 తేలుకొండి , 9 2 తెగ , 10 2 తీర్థకాకము , 11 2 తీతువు , 12 2 తుల , 13 2 తడక , 14 2 తంతివాద్దెము , 15 2 తండువు , 16 2 డోలనము , 17 2 డలాయతు , 18 2 డవాలి , 19 2 డయనము , 20 2 డమాయి , 21 2 డమాను , 22 2 డమరువు , 23 2 డమరము , 24 2 డబ్బాటు , 25 2 నామాలపురుగు

jan 2013: 1 2 డంబరము , 2 2 జయఘంట , 3 2 పొట్టపోసికొను , 4 2 తెలుగు నిఘంటువులో పేర్కొన్న ఉర్దూ పదాలు , 5 2 పులిదుంప , 6 2 పుంఖానుపుంఖము , 7 2 గొణగు , 8 2 గుండియ , 9 2 పాణి , 10 2 గాలికుంటు , 11 2 గాముల ఱేడు , 12 2 పరివేశము , 13 2 పరశువు , 14 2 గవకు , 15 2 ఖడ్గి , 16 2 புவியியல் , 17 2 பகுதி , 18 2 அகண்டதீபம் , 19 2 அகங்கரிப்பு , 20 2 அகக்கமலம் , 21 2 நாடோடி , 22 2 கிழக்கு , 23 2 அங்குசம் , 24 2 அகிம்சை , 25 2 నేతిబీర

fev 2013: 1 2 మృగనా భి , 2 2 రక్తగంధము , 3 2 మాతాపితలు , 4 2 రత్నాకరము , 5 2 చంద్రగిరి , 6 2 కాళహస్తి , 7 2 భూగర్భము , 8 2 గర్భగృహము , 9 2 గర్భవతి , 10 2 రోడ్డు , 11 2 లెంపకాయ , 12 2 ముడ్డి , 13 2 తాపి , 14 2 గిరి , 15 2 ద్వారం , 16 2 తరువు , 17 2 తీరు , 18 2 తుండు , 19 2 తాడు , 20 2 మగ , 21 2 సముద్రము , 22 2 కాలము , 23 2 ముగ్గు , 24 1 తుటారికత్తియ

mar 2013: 1 4 దిగంబరుడు , 2 2 తొంటచేతివాడు , 3 2 తైషము , 4 2 తెల్లయేనుగు , 5 2 తెలికలు , 6 2 వెండ్రుక , 7 2 వెండిగుండు , 8 2 వెంట్రువ , 9 2 వృషుడు , 10 2 వృషాంకుడు , 11 2 వృక్షచరము , 12 2 వృకదంశము , 13 2 వీగియాడు , 14 2 చుర్రు , 15 2 విశిష్టుడు , 16 2 విశ్వనాథుడు , 17 2 వజ్రాయుధము , 18 2 త్రిపురాంతకుడు , 19 2 తేలాడు , 20 2 తేఱు , 21 2 గంగాధరుడు , 22 2 కంఠాభరణము , 23 2 వట్టకాయ , 24 2 వృషణము , 25 2 ఫాలనేత్రుడు

abr 2013: 1 4 మొదటి పేజీ , 2 3 ద్విజరాజు , 3 3 చతుర్భుజి , 4 3 శుక్రుడు , 5 2 నల్లెరు , 6 2 నమస్కృతి , 7 2 నఫా , 8 2 నగరి , 9 2 నగధరుడు , 10 2 నక్తంచరము , 11 2 ఎప్సిలోన్ , 12 2 శుక్కు , 13 2 సీలించు , 14 2 శీర్ణము , 15 2 శీతాంసువు , 16 2 అంతర్జాతీయ న్యాయస్థానం , 17 2 వ్యభిచారిణి , 18 2 వైజయంతుడు , 19 2 వేశము , 20 2 కరీంనగర్ జిల్లా , 21 2 ఆదిలాబాదు జిల్లా , 22 2 ఆగ్నేయ మధ్య రైల్వే , 23 2 ఆగ్నేయ రైల్వే , 24 2 దక్షిణ రైల్వే , 25 2 వాయువ్య రైల్వే

mai 2013: 1 4 పాడు , 2 3 ఏలు , 3 3 నశించు , 4 3 శునకము , 5 3 పూయు , 6 3 శ్లోకము , 7 3 కవిత , 8 2 ఏకలింగ పుష్పములు , 9 2 ఎఱ్ఱరక్తకణములు , 10 2 ఉపజిహ్విక , 11 2 ఆయస్కాంతికక్షేత్రము , 12 2 ఆమ్లీకరణము , 13 2 ఆమ్లజనీకరణము , 14 2 సేవించు , 15 2 సమర్పించు , 16 2 సిద్ధార్థుడు , 17 2 ఎముకలగూడు , 18 2 శ్వానకాసము , 19 2 శ్రీకాంతుడు , 20 2 శ్రీకరుడు , 21 2 శ్రాద్ధదేవుడు , 22 2 శోషము , 23 2 శుభకరము , 24 2 శుని , 25 2 సంరక్షించు

jun 2013: 1 2 వృషభచక్రం , 2 2 వృద్దావస్థ , 3 2 పరాజిత , 4 2 పాపలగ్నాలు , 5 2 సూత్రంపట్టడం , 6 2 భిత్తి , 7 2 జీర్ణోద్దారం , 8 2 తృణం , 9 2 కర్ణికారం , 10 2 శత పత్రం , 11 2 ఆమ్రం , 12 2 నింబం , 13 2 రాజవృక్షం , 14 2 రుధిరదోషం , 15 2 బధిరగృహం , 16 2 విగ్రహాలు , 17 2 కూపం , 18 2 రథరేణువు , 19 2 శల్యోథ్ధారం , 20 2 నవకోష్టకం , 21 2 ఆయుత భూమి , 22 2 వాయుయానము , 23 2 శల్యాలు , 24 2 భూశోధన , 25 2 వర్గులు

jul 2013: 1 3 తలపు , 2 3 అన్నము , 3 2 తొంగొను , 4 2 తినగతినగ , 5 2 మ్రోగెను , 6 2 చెలరేగెను , 7 2 కమ్మగా , 8 2 బాల్యక్రీడలు , 9 2 అంబరరత్నము , 10 2 అంబరమణి , 11 2 అంశుడు , 12 2 తెల్లవాడు , 13 2 మృగేంద్రుడు , 14 2 మాతలుడు , 15 2 మకరధ్వజుడు , 16 2 పన్నగాశనుడు , 17 2 అంగరంగవైభవము , 18 2 పోగాలము , 19 2 అమిషము , 20 2 కాగిలి , 21 2 వృచ్ఛికవానర న్యాయము , 22 2 వృశ్చికచోరన్యాయము , 23 2 స్వరూపం , 24 2 బధిరవీణాన్యాయము , 25 2 మార్జాలకబళన్యాయము

ago 2013: 1 3 ఉల్లి , 2 2 అఖేటనుడు , 3 2 అఖురథుడు , 4 2 అఖుబుక్కు , 5 2 ఆక్షారితుడు , 6 2 ఆక్లేదము , 7 2 ఆక్రోశనము , 8 2 ఆకుజల్ల , 9 2 అకతాళ్ళు , 10 2 ఆగాకర , 11 2 ఆకపడు , 12 2 అంధ్యము , 13 2 ఎండుచేప , 14 2 అర్పించుట , 15 2 అరుచుట , 16 2 అరుగుట , 17 2 పోటముంజు , 18 2 పొంగట్టు , 19 2 పంద , 20 2 నేస్తకాడు , 21 2 నేలపట్టి , 22 2 నేత్రిక , 23 2 నెలవీసము , 24 2 నెలవెలుగు , 25 2 నెలవత్తి

set 2013: 1 2 ఏతయ్య , 2 2 విజయవాడ , 3 2 తలారి , 4 2 ప్రేమించు , 5 2 దధీచి , 6 2 కంపరము , 7 2 కంబము , 8 2 కండూతి , 9 2 కంచు , 10 2 సవ్యసాచి , 11 2 తండి , 12 2 ఓడు , 13 2 కంకణము , 14 2 కంద , 15 2 కందిరీగ , 16 1 కుంటగలగరమొక్క

out 2013: 1 2 తుహినకరుడు , 2 2 నాకు , 3 1 మధము

nov 2013: 1 3 పొదుగు , 2 2 సాకుట , 3 2 పాపిష్టి , 4 2 ముచ్చటించు , 5 2 అలీన ఉద్యమం , 6 2 మొఱ్ఱి , 7 2 మొగుదారి , 8 2 మేఘపుష్పము , 9 2 మృగధరుడు , 10 2 ధారణము , 11 2 అస్థిపంజర వ్యవస్థ , 12 2 గుగ్గిలము , 13 2 కాబేజీ , 14 2 గర్భాదానము , 15 2 మొండి , 16 2 మొలత్రాడు , 17 2 మొద్దు , 18 2 ముంగురులు , 19 2 పొగ , 20 2 సాకు , 21 2 వదంతి , 22 2 rambling , 23 2 acquit , 24 2 billingsgate , 25 2 brinjal

dez 2013: 1 2 బుద్ధిపూర్వకముగా , 2 2 హుషారుగా , 3 2 సంపూర్ణముగా , 4 2 నిశ్చయముగా , 5 2 స్థిరముగా , 6 2 శాశ్వతముగా , 7 2 విశ్వాసముగా , 8 2 దయగా , 9 2 ఉగ్రముగా , 10 2 విచిత్రముగా , 11 2 చల్లగా , 12 2 వేడిగా , 13 2 బోర్లించుట , 14 2 చప్పగా , 15 2 అగోచరముగా , 16 2 నిత్యత్వము , 17 2 మనుష్యహత్య , 18 2 పుణ్యదివసము , 19 2 మనఃపూర్వకముగా , 20 2 హేయముగా , 21 2 కుంటుతూ , 22 2 సుఖముగా , 23 2 అసూయగా , 24 2 సుధర్ముడు , 25 2 వ్యాకరణవేత్త

jan 2014: 1 3 చెల్లించుట , 2 3 ఫలం , 3 2 సిద్ధపరచు , 4 2 అచలించు , 5 2 అగడుపఱచు , 6 2 అక్కఱకువచ్చు , 7 2 అంతుతేల్చుకొను , 8 2 అంతముచూడు , 9 2 అంతమునొందించు , 10 2 ఊగు , 11 2 సాత్వికముగా , 12 2 సరదాగా , 13 2 శ్రావ్యముగా , 14 2 కాపాడుట , 15 2 సంధించు , 16 2 సంకోచించు , 17 2 వర్ణించు , 18 2 లభించు , 19 2 బోధించు , 20 2 బండెలుక , 21 2 ప్రాబల్యము , 22 2 ప్రతిసరము , 23 2 దురవస్థ , 24 2 తమ్మిచూలి , 25 2 మంగలివాడు

fev 2014: 1 3 తుచ్ఛుడు , 2 2 చందము , 3 2 గడుచు , 4 2 ఓగులవాడు , 5 2 నాంతరీయకన్యాయము , 6 2 మత్తకాశినీన్యాయం , 7 2 దాక్షిణ్యము , 8 2 చినిగిన , 9 2 పీపాయి , 10 2 విరిగిన , 11 2 వినయముగా , 12 2 చొరబడడము , 13 2 గ్రామ్యము , 14 2 తంత్రము , 15 2 రథము , 16 2 కుతంత్రము , 17 2 నీచుడు , 18 2 ప్రతిధ్వని , 19 2 కరుణ , 20 1 జాగారణము

mar 2014: 1 2 గొప్పలు , 2 2 అంగజము , 3 2 మహాపండితుడు , 4 2 సురపతి , 5 2 స్మరించుట , 6 2 కారకం , 7 2 గార్హస్థ్యసన్యాసపరీక్షాన్యాయం , 8 2 చిరునగవు , 9 2 సంహరించుట , 10 2 అవతరించు , 11 2 ప్రతిభావంతుడు , 12 2 కాంచనుడు , 13 2 మునివాహనుడు , 14 2 పరాంకుశదాసుడు , 15 2 భక్తిసారుడు , 16 2 నారదుఁడు , 17 2 పురుమీఢుడు , 18 2 హస్తికుఁడు , 19 2 అంగుఁడు , 20 2 వామనుఁడు , 21 2 ఉపేంద్రుఁడు , 22 2 మరచుట , 23 2 వాదోపవాదములు , 24 2 మహిషుడు , 25 2 అలసుడు

abr 2014: 1 2 కుమ్మరిపురుగు , 2 2 అలుగుట , 3 2 మెలగుట , 4 2 కలుగుట , 5 2 కుందనం , 6 2 నువ్వు , 7 2 ఆరోగ్యవంతుడు , 8 2 వ్యాధిగ్రస్తుడు , 9 2 వ్యాధిపీడితుడు , 10 2 పూచుట , 11 2 రుణం , 12 2 తప్పిదం , 13 2 గరిమము , 14 2 క్రూరలోచనుడు , 15 2 భవిత , 16 2 మీరుట , 17 2 బొప్పాయిపండు , 18 2 శూద్రుడు , 19 2 వేలుపుబానిస , 20 2 వెలయింతి , 21 2 వారకాంత , 22 2 తిరము , 23 2 యజమానుడు , 24 2 మెలగు , 25 2 పర్యాయపదము

mai 2014: 1 3 దీపము , 2 2 ఋజుమార్గేణ్ సిధ్యతి , 3 2 అక్షిగోళము , 4 2 అంధాక్షిమీలనన్యాయము , 5 2 నక్షత్రమండలము , 6 2 అంధదర్పణన్యాయము , 7 2 అంధగోక్షేత్రన్యాయము , 8 2 అంధగజన్యాయము , 9 2 సలుపుట , 10 2 అంధపరంపరాన్యాయము , 11 2 అంకోలబీజన్యాయము , 12 2 ఊర్ధ్వముఖము , 13 2 అంకుశన్యాయము , 14 2 నిండుచందమామ , 15 2 నింపుట , 16 2 అంధపరంపరాన్యాయం , 17 2 లావిక , 18 2 పుష్పలావిక , 19 2 పుంగర్భము , 20 2 అప్రసక్తనిషేధన్యాయము , 21 2 ఇక్షురసన్యాయము , 22 2 వితానము , 23 2 కంటకన్యాయము , 24 2 మహోదరము , 25 2 మహావీరుడు

jun 2014: 1 2 కన్నుకుట్టు , 2 2 ఎనక , 3 2 సోపానారోహణన్యాయము , 4 2 జలమథనన్యాయము , 5 2 జలతుంబికాన్యాయము , 6 2 చిత్రితాంగజంబుకన్యాయము , 7 2 ఆమ్రవనము , 8 2 మలినం , 9 2 కంబళభోజనన్యాయము , 10 2 మహిషము , 11 2 బదరము , 12 2 చాలనము , 13 2 చండాలుడు , 14 2 చంచల , 15 2 స్ఫటికము , 16 2 గుడము , 17 2 కాకము , 18 2 ఆడ , 19 2 ఉల్లాసం , 20 2 బిల్వము , 21 2 జిగురు , 22 2 ఒలుకు , 23 2 మూగ , 24 2 క్షీరము , 25 2 గొప్ప

jul 2014: 1 2 తల్లడిల్లి , 2 2 మిధ్యామతి , 3 2 మోసంచేయు , 4 2 పురాతన , 5 2 అనుగ్రహించు , 6 2 నలువ , 7 2 అంకం , 8 2 కుత్తుక , 9 2 సీమంతము , 10 2 ఉద్రేకం , 11 2 అవలీల , 12 1 ఉత్ఖాతదంష్టభుజగన్యాయము

ago 2014: 1 2 బ్రహ్మ జ్ఞానం , 2 2 ఆత్మబంధువు , 3 2 గుబాళింపు , 4 2 సంధ్యవేళ , 5 2 జానపదం , 6 2 పర్యావరణ , 7 2 పదనిధి , 8 2 సమ్మోహనం , 9 2 విక్రయ కేంద్రం , 10 2 మరకలు , 11 2 సిరిసంపదలు , 12 2 భారం , 13 2 ఏగుట , 14 2 షట్కర్మ , 15 2 వటారము , 16 2 రక్షామణి , 17 2 బొంకరి , 18 2 ప్రవేశపెట్టు , 19 2 తంతు , 20 2 డేకురు , 21 2 ఠవళి , 22 2 శాకము , 23 2 ఋతుశాంతి , 24 2 వైవిధ్యము , 25 2 అతిక్రమించు

set 2014: 1 3 వృషణము , 2 2 పలవరింపు , 3 2 చక్రబంధం , 4 2 ముందస్తు , 5 2 వాస్తుపూజ , 6 2 రుణం , 7 2 లౌకికము , 8 2 పులుగు , 9 2 గమనించు , 10 2 ఆచరించు , 11 2 సందడి , 12 2 రంభ , 13 2 నిందితుడు , 14 2 ఆసక్తి , 15 2 తిమ్మిరి , 16 2 సదస్సు , 17 2 అమ్మకము , 18 2 నగుబాటు , 19 2 విందు , 20 2 కొలువు , 21 2 భాస్కరుడు , 22 2 వృషణం , 23 2 ఆజ్ఞ , 24 2 ధనము , 25 2 అంగడి

out 2014: 1 2 సునిశితము , 2 2 అగ్నిహోత్రి , 3 2 పండబారు , 4 2 విశ్వప్రయత్నం , 5 2 మిశ్రమం , 6 2 అక్షగ్లహము , 7 2 కౌగిలింత , 8 2 సహస్రాంశు , 9 2 పరిశుభ్రత , 10 2 సాధికారత , 11 2 చక్రాంకితము , 12 2 అనుక్షణం , 13 2 శిల్పకళ , 14 2 ప్రవచనాలు , 15 2 గుబాళించు , 16 2 చుట్టిల్లు , 17 2 జాగిలము , 18 2 సంకల్పం , 19 2 ఉత్తరీయం , 20 2 ఉరి , 21 2 కునుకు , 22 2 గుహ , 23 2 మాటు , 24 2 సేవ , 25 2 అలంకారము

nov 2014: 1 2 మంత్రగాడు , 2 2 అతిధృతి , 3 2 దారుణం , 4 2 పండుకప్ప , 5 2 విధవరాలు , 6 2 మంకి , 7 2 పొలికె , 8 2 ఎందువలన , 9 2 చంకగోడ , 10 2 వీరంగము , 11 2 సంజనము , 12 2 అననము , 13 2 అనన్య దృష్టి , 14 2 ముంగరి , 15 2 ముంగత్తి , 16 2 నాగేలి , 17 2 పుష్కలం , 18 2 జింకపిల్ల , 19 2 రాంకవము , 20 2 ఎక్కటి , 21 2 పచ్చ , 22 2 వంటకము , 23 2 పొగబండి , 24 2 జాలరి , 25 2 జానపదము

dez 2014: 1 3 మృగతృష్ణ , 2 2 తటస్థమైన , 3 2 సర్వసంగ , 4 2 గిడ్లదొడ్డి , 5 2 సర్వస్వతంత్రుడు , 6 2 పరాగ , 7 2 వీర రాత్రి , 8 2 వృద్ధిచేయు , 9 2 సాత్వికమైన , 10 2 మేళా , 11 2 అన్యభృత్తు , 12 2 అందచందములు , 13 2 అదుపు , 14 2 ప్రశంస , 15 2 లోహండి , 16 2 మరీచిక , 17 2 ధేనుక , 18 2 ఆహారము , 19 2 ఎత్తుగడ , 20 2 సంస్కారము , 21 2 చిల్లర , 22 2 పల్లె , 23 2 నేర్పు , 24 2 సాక్ష్యము , 25 2 అద్భుతము

jan 2015: 1 2 లంకె , 2 2 పంచుకొను , 3 2 లేవనెత్తు , 4 2 మేకొను , 5 2 అర్గళము , 6 2 కరణములు , 7 2 ఆకర్షణము , 8 2 నీరాజనము , 9 2 బుద్ధి , 10 2 తిలకము , 11 2 ఉపదేశము , 12 2 ఎత్తు , 13 1 మువ్వన్నె

fev 2015: 1 2 గుబురు , 2 2 అందము , 3 1 అజాకృపాణీయన్యాయం

mar 2015: 1 3 స్వరక్షణ , 2 3 అభయ , 3 3 భాసము , 4 3 తోవ , 5 3 గహ్వరము , 6 3 ఆహారము , 7 3 అపదేశము , 8 3 అధీనము , 9 3 తాటిచెట్టు , 10 3 తనువు , 11 3 apathy , 12 3 వెలుగు , 13 3 చిగురు , 14 3 కేశము , 15 2 మృత్తికాస్నానము , 16 2 మేదిరము , 17 2 మధ్యమస్తిష్కము , 18 2 మెడ పట్టని మేనరికం , 19 2 మహసూలు , 20 2 భూతం భవ్యాయోపదిశ్యతే , 21 2 రుద్రాక్షపూస , 22 2 మైథునాంగములు , 23 2 రాజకార్యాంగములు , 24 2 రాగోపాంగములు , 25 2 రాగాంగములు

abr 2015: 1 4 శిల్పము , 2 3 మేషపుచ్ఛన్యాయము , 3 3 బాణోష్ట్రీన్యాయము , 4 3 బిల్వఖల్వాటన్యాయము , 5 3 బిలవర్తిగోధాన్యాయము , 6 3 ఉవ్వలపోటీ , 7 3 మ్రానుగోయిల , 8 3 సరే , 9 3 మానాధీనా మేయసిద్ధి , 10 3 సనాతనము , 11 3 శతపత్రము , 12 3 రంగనాథుడు , 13 3 సర్పయాగము , 14 3 మండలము , 15 3 శోభనము , 16 3 విషయం , 17 3 సంధి , 18 2 యాదృశీ భావనా తాదృశీ సిద్ధిః , 19 2 వరాటకాన్వేషణే ప్రవృత్త శ్చింతామణిం లబ్ధవాన్ , 20 2 మధ్యమమణిన్యాయము , 21 2 మణిమంత్రన్యాయము , 22 2 కేవలై ర్వచనై ర్నిర్ధనాధమర్ణిక ఇవ సాధూన్‌ భ్రామయన్ , 23 2 కాచమణిన్యాయము , 24 2 తటాకపరివాహన్యాయము , 25 2 గడ్డురికాన్యాయము, గడ్డులికాప్రవాహన్యాయము

mai 2015: 1 2 మొంద , 2 2 తక్కోలము , 3 2 లటుడు , 4 2 పహాడ్‌ , 5 2 పావి , 6 2 సమవాయసంబంధన్యాయం , 7 2 పాఠక్రమన్యాయము , 8 2 పతితః పర్వతో లఘుః , 9 2 కారణనాశే కార్యనాశః , 10 2 కార్యేణ కారణసమ్ప్రత్యయః , 11 2 కార్యకారణన్యాయం , 12 2 యుధ్యత్కుక్కుటన్యాయము , 13 2 ఋజుమార్గేణ సిద్ధ్యతి న్యాయం , 14 2 ముండితశిరోనక్షత్రాన్వేషణన్యాయం , 15 2 పరస్పరవిరోధే హి న ప్రకారాన్తరస్థితిః , 16 2 నృపనాపిత(పుత్ర) న్యాయం , 17 2 అపసారితానలభూతలన్యాయం , 18 2 గంధాసక్తషట్పదన్యాయం , 19 2 గణపతిన్యాయము , 20 2 శుష్కస్తనీన్యాయం , 21 2 పథికసర్పమారణన్యాయం , 22 2 నోపకారం వినా ప్రీతిః కథంచిత్‌ కస్యచి ద్భవేత్ , 23 2 ప్రాసాదవాసిన్యాయము , 24 2 ధావద్గండభేరుండన్యాయం , 25 2 అరుంధతీ నక్షత్ర ప్రదర్శనన్యాయం

jun 2015: 1 3 ఆలరకి , 2 3 ముళ్ళమారి , 3 3 లోకేశము , 4 3 వ్యాహారము , 5 3 రాధస్సు , 6 2 పొగరుఁబోతు , 7 2 చిద్రము , 8 2 సహకరించు , 9 2 మున్నీటిపట్టి , 10 2 సగంధ , 11 2 సత్త్రి , 12 2 కార్యకత్తె , 13 2 విధాతృడు , 14 2 స్వరువు , 15 2 నాళీకాకరము , 16 2 మూర్ఖుఁడు , 17 2 స్తిభి , 18 2 జలమయం , 19 2 కోసం , 20 2 కోసరం , 21 2 కోసరము , 22 2 పూర్ణానకము , 23 2 కలఁత , 24 2 అలంకరణము , 25 2 హవణింపు

No data on this page have been normalized to 30 day months (as WMF does on certain traffic reports).
Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Quinta-feira, 30 de julho 2015 22:11

Dump file tewiktionary-20150702-stub-meta-history.xml.gz (edits only), size 42 Mb as gz -> 375 Mb
Dump processed till Jun 30, 2015, on server stat1002, ready at Sat-04/07/2015-23:06 after 5 min, 23 sec.

Versão do script:2.6
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.