Estatísticas da Wikcionário tigrinya

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist

Metrics have been collected from a full archive dump, which contains all revisions of every article, meta data and raw content.
See also metrics definitions


 
Monthly counts & Quarterly rankings: fevereiro 2015
 
DataWikcionaristasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
fev 2015    +1%    +1%+2%+4%+2%   
set 2014    0%    0%0%0%+1%   
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
fev 20154   393 5,13711111 kb2,4 k1883,2 k 83
jan 20154   389 5,1377110 kb2,4 k1803,2 k 83
dez 20144   389 5,1378110 kb2,4 k1803,1 k 83
nov 20144   389 537 109 kb2,4 k1803,1 k 83
out 20144   389 5375109 kb2,4 k1803,1 k 83
set 20144   389 53711109 kb2,4 k1803,1 k 83
ago 20144   389 53717109 kb2,4 k1803,1 k 83
jul 20144   389 5377109 kb2,4 k1803,1 k 83
jun 20144   389 4,9371109 kb2,4 k1803,1 k 83
mai 20144   389 4,9371109 kb2,4 k1803,1 k 83
abr 20144   389 4,9372109 kb2,4 k1803,1 k 83
mar 20144   389 4,9371109 kb2,4 k1803,1 k 83
fev 20144   389 4,9371109 kb2,4 k1803,1 k 83
jan 20144   389 4,9375108 kb2,4 k1803,1 k 83
dez 20134   389 4,937226108 kb2,4 k1803,1 k 83
nov 20134   388 4,3374102 kb2,3 k1802,7 k 83
out 20134   388 4,337 102 kb2,3 k1802,7 k 83
set 20134   388 4,337 102 kb2,3 k1802,7 k 83
ago 20134   388 4,33727102 kb2,3 k1802,7 k 83
jul 20134   388 4,33718101 kb2,3 k1802,6 k 83
jun 20134   388 4,23722101 kb2,3 k1802,6 k 83
mai 20134   388 4,2378101 kb2,3 k1802,6 k 83
abr 20134   388 4,1374100 kb2,3 k1802,6 k 83
mar 20134   388 4,13725100 kb2,3 k1802,6 k 83
fev 20134   388 4,1379100 kb2,3 k1802,5 k 83
jan 20134   388 4377100 kb2,3 k1802,5 k 83
dez 20124   388 4377100 kb2,3 k1802,5 k 83
nov 20124   388 4376100 kb2,3 k1802,5 k 83
out 20124   388 4375100 kb2,3 k1802,5 k 83
set 20124   388 4376100 kb2,3 k1802,5 k 83
ago 20124   388 43713100 kb2,3 k1802,5 k 83
jul 20124   388 3,9373099 kb2,3 k1802,5 k 83
jun 20124   388 3,837599 kb2,3 k1802,5 k 83
mai 20124   388 3,8371199 kb2,3 k1802,4 k 83
abr 20124   388 3,8371499 kb2,3 k1802,4 k 83
mar 20124   388 3,8373199 kb2,3 k1802,4 k 83
fev 20124   388 3,7371098 kb2,3 k1802,4 k 83
jan 20124   388 3,7371498 kb2,3 k1802,4 k 83
dez 20114   388 3,6373898 kb2,3 k1802,4 k 83
nov 20114   388 3,5373298 kb2,3 k1802,3 k 83
out 20114   388 3,4372297 kb2,3 k1802,3 k 83
set 20114   388 3,437396 kb2,3 k1802,3 k 83
ago 20114   388 3,437996 kb2,3 k1802,3 k 83
jul 20114   388 3,437596 kb2,3 k1802,2 k 83
jun 20114   388 3,337796 kb2,3 k1802,2 k 83
mai 20114   386 3,337895 kb2,3 k1762,2 k 83
abr 20114   386 3,3371095 kb2,3 k1762,2 k 83
mar 20114   386 3,3371995 kb2,3 k1762,1 k 83
fev 20114   386 3,337695 kb2,3 k1762,1 k 83
jan 20114 1 386 3,2371594 kb2,3 k1762,1 k 83
dez 20104   383 3,2372193 kb2,3 k1692,0 k 83
nov 20104   380 3,2371092 kb2,3 k1631,9 k 83
out 20104 1 380 3,237992 kb2,3 k1631,9 k 83
set 20104 1 380 3,1372091 kb2,3 k1631,9 k 83
ago 2010412 380 3,1372791 kb2,3 k1631,9 k 83
jul 20103 2 379 3374991 kb2,3 k1551,9 k 83
jun 20103 1 375 2,9373689 kb2,3 k1481,7 k 83
mai 20103 1 367 2,9374386 kb2,2 k1311,6 k 83
abr 20103 1 360 2,8361782 kb2,2 k961,3 k 83
mar 20103 1 357 2,8361481 kb2,2 k901,3 k 83
fev 20103 1 357 2,8363081 kb2,2 k901,2 k 83
jan 20103 1 354 2,7352479 kb2,1 k811,1 k 83
dez 20093 1 352 2,7352077 kb2,1 k701,0 k 83
nov 20093 1 351 2,6351076 kb2,1 k65964 83
out 20093 1 351 2,6351376 kb2,1 k65957 83
set 20093   351 2,535376 kb2,1 k65944 83
ago 20093 1 351 2,5352676 kb2,1 k65941 83
jul 20093 1 349 2,5353575 kb2,1 k61885 83
jun 20093   338 2,435371 kb2,1 k38589 83
mai 20093 1 338 2,435771 kb2,1 k38586 83
abr 20093 1 338 2,4351270 kb2,1 k38579 83
mar 2009322133272,43524570 kb2,0 k38580 83
fev 20091   123 4,645162 kb9176100 83
jan 20091   123 4,545162 kb917699 83
dez 20081   123 4,545 62 kb917698 83
nov 20081   123 4,545 62 kb917698 83
out 20081   123 4,545 62 kb917698 83
set 20081   123 4,545 62 kb917698 83
ago 20081   123 4,5451362 kb917698 83
jul 20081   111 4,9472161 kb856655 83
jun 20081   99 5,349 61 kb7966107 82
mai 20081   99 5,349 61 kb7966107 82
abr 20081   99 5,349 61 kb7966107 82
mar 20081   99 5,349 61 kb7966107 82
fev 20081   99 5,349161 kb7966107 82
jan 20081   98 5,349261 kb7895107 82
dez 20071   97 5,449 61 kb7844107 82
nov 20071   97 5,449261 kb7844107 82
out 20071   97 5,449161 kb7844107 82
set 20071   97 5,349 61 kb7844107 82
ago 20071   97 5,349161 kb7844107 82
jul 20071   9735,35017461 kb7904107 82
jun 20071   15 22,913633543 kb2444107 81
mai 20071   1 8500 1,8 kb75 107 81
abr 20071   1 8500 1,8 kb75 107 81
mar 20071   1 8500 1,8 kb75 107 81
fev 20071   1 850011,8 kb75 107 81
jan 20071        77      1
dez 20061        77      1
nov 20061        77      1
out 20061        77      1
set 20061        77      1
ago 20061       477      1
jul 20061       166       
jun 20061        44       
mai 20061        44       
abr 20061        44       
mar 20061        44       
fev 20061       144       
jan 200611      144       
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
 WikcionaristasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikcionaristas (usuários registrados)
A = Wikcionaristas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikcionaristas que editaram pelo menos dez vezes desde que chegaram
C = Wikcionaristas que contribuíram cinco vezes ou mais este mês
D = Wikcionaristas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  5  10  100  1  3  1  3  5  10  5  10 
Monthly counts for recent history of wiki
fev 201521  1  31 821 11
jan 2015    1  11 11  1 
dez 2014    1  1  2   11
nov 2014       21 21    
out 2014    1  1  2     
set 2014    11 3  41    
ago 2014    11    31    
jul 2014    1           
jun 2014                
mai 2014          1     
abr 20141         5     
mar 2014       1  2     
fev 2014       1  3     
jan 2014    1  1  521   
dez 2013    1112  3     
nov 2013       1  8     
out 2013       1  41    
set 2013       21 3211  
ago 2013    11    2     
jul 2013    11    11    
jun 2013    11 1  1     
mai 2013          1     
abr 2013          1     
mar 2013    31    111   
fev 2013       2  31    
jan 2013    1           
Quarterly counts for entire history of wiki
jan 2015    1  11 11  1 
out 2014    1  1  2     
jul 2014    1           
abr 20141         5     
jan 2014    1  1  521   
out 2013       1  41    
jul 2013    11    11    
abr 2013          1     
jan 2013    1           
out 2012          31  1 
jul 2012    22    31    
abr 2012    2  11 211   
jan 2012    2     21  1 
out 2011    21 1  4     
jul 2011       1  211   
abr 2011    1     211   
jan 2011211        3     
out 2010111        1     
jul 201022211            
abr 20101111    1  31    
jan 20101111    1  1111  
out 20091111       2     
jul 20091111       2   1 
abr 20091111       3111  
jan 2009          211   
out 2008       1  322   
jul 200811  11 2        
abr 2008                
jan 2008          1     
out 2007          1     
jul 2007          1     
abr 2007                
jan 2007                
out 2006          1     
jul 2006          1     
abr 2006                
jan 20061      2  41    

 

Distribuição de edições de artigos por wikcionaristas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikcionaristasEdições total
117100.0%574100.0%
3423.5%55296.2%
10317.6%54795.3%
3215.9%50588.0%
10015.9%50588.0%
31615.9%50588.0%

 

2 wikcionaristas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions
agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
MalaysiaboyUC7...3322fev 22, 201552222
JAn DudíkUC10...2275fev 18, 201592254

 

14 wikcionaristas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
InterwicketUC1505fev 20, 20092198out 20, 20101591
虎の女の児UC222jul 10, 20101693jun 13, 20111355
PiolinfaxUC320mar 05, 20092185mar 05, 20092185
SpacebirdyUC45jul 21, 20082412jul 29, 20082404
KoavfUC53ago 01, 20063132ago 01, 20063132
බිඟුවාUC63dez 31, 20101519dez 31, 20101519
DanydŵrUC82mai 08, 20101756mai 08, 20101756
NewriteUC92jan 08, 20111511jan 08, 20111511
GangleriUC111jan 05, 20063340jan 05, 20063340
Az1568UC121fev 14, 20072935fev 14, 20072935
OcotonigiqUC131nov 23, 20101557nov 23, 20101557
MercyUC141nov 24, 20101556nov 24, 20101556
Piet-cUC151mai 22, 20121011mai 22, 20121011
Adriano MorelliUC161abr 27, 2014306abr 27, 2014306

 

usuários anônimos, ordenados por número de contribuições
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
58.179.207.31207
58.179.201.106101
210.50.14.14470
210.50.226.17669
58.179.203.8941
116.240.133.1416
82.198.250.614
82.198.250.7014
83.61.161.24410

No total 620 edições foram feitas por usuários anônimos, de um total de 1987 edições ( 31e %)
  


15 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
Luckas-botUC1290mar 27, 20092163jan 27, 2014396--
HydrizBotUC2152abr 24, 20121039jan 23, 201535--
JAnDbotUC3112mai 23, 20111376fev 19, 20158--
KamikazeBotUC489out 18, 20111228mar 07, 2013722--
WikitanvirBotUC531abr 24, 20111405jan 11, 20121143--
AvocatoBotUC623nov 05, 20111210mai 26, 20121007--
VolkovBotUC719jul 29, 20082404mar 21, 2013708--
SpaceBirdyBotUC816jul 21, 20082412jan 20, 20092229--
ArthurBotUC916nov 20, 20101560mai 30, 20111369--
YS-BotUC1014mar 28, 2013701ago 11, 2014200--
MjbmrbotUC1113fev 14, 20111474mar 26, 20111434--
RoggBotUC127dez 23, 20101527jan 18, 20111501--
CarsracBotUC136out 21, 20091955mai 19, 2013649--
WarddrBOTUC143jul 29, 2012943jul 31, 2012941--
Makecat-botUC152dez 04, 2012815dez 04, 2012815--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110
fev 20155683799 195 11      5
jan 20155643739 192 8       
dez 20145643719 192 8       
nov 20145643709 192 8       
out 20145643679 192 8       
set 20145643669 191 8       
ago 20145643629 191 8       
jul 20145643589 191 8       
jun 20145643589 191 8       
mai 20145643589 191 8       
abr 20145643589 191 8      1
mar 20145643549 191 8       
fev 20145643529 191 8       
jan 20145643499 191 8       
dez 20135643419 191 8       
nov 20135643409 191 7       
out 20135643359 191 7       
set 20135643319 191 7       
ago 20135643159 191 7       
jul 20135643129 191 7       
jun 20135643099 191 7       
mai 20135643089 191 7       
abr 20135643079 191 7       
mar 20135643049 191 7       
fev 20135642979 191 7       
jan 20135642929 191 7       
dez 20125642919 191 7       
nov 20125642879 191 7       
out 20125642869 191 7       
set 20125642829 191 7       
ago 20125642789 191 7       
jul 20125642739 191 7       
jun 20125642709 191 7       
mai 20125642609 191 7      1
abr 20125642529 191 7       
mar 20125642439 191 7       
fev 20125642409 191 7       
jan 20125642309 190 7       
dez 20115642259 190 7       
nov 20115642229 190 7       
out 20115642129 189 7       
set 20115642079 189 7       
ago 20115642049 189 7       
jul 20115641989 189 7       
jun 20115641899 189 7      3
mai 20115621869 189 7       
abr 20115621819 189 7       
mar 20115621719 189 7       
fev 20115621719 189 7       
jan 20115621639 189 7      7
dez 20105591599 189 7      7
nov 20105561589 189 7      2
out 20105561549  89 7      9
set 20105561539  89 7      20
ago 20105561489  89 7      27
jul 20105561319  89 7      47
jun 20105521319  89 7      27
mai 20105441159  89 6      21
abr 20105371139  89 6      10
mar 20105341089  89 6      14
fev 20105341049  89 6      23
jan 20105311029  89 6      16
dez 2009529899  89 6      9
nov 2009528889  88 6      9
out 2009528869  88 6      11
set 2009528849  88 6      3
ago 2009528799  88 6      21
jul 2009526799  88 6      15
jun 2009516769  88 6      3
mai 2009516759  87 6      7
abr 2009516749  87 6      10
mar 2009516668  87 6      234
fev 2009502596  80 6      1
jan 2009502536  80 6       
dez 2008502536  80 6       
nov 2008502536  80 6       
out 2008502396  80 6       
set 2008502286  80 6       
ago 2008502286  80 6       
jul 2008502266  80 6      5
jun 2008501266  80 6       
mai 2008501235  80 6       
abr 2008501225  80 6       
mar 2008501225  80 6       
fev 2008501175  80 6       
jan 2008501175  80 6       
dez 2007501165  80 5       
nov 2007501155  80 5       
out 2007500145  80 5       
set 2007499134  80 5       
ago 2007499124  80 5       
jul 2007499104  80 5       
jun 2007329104  80 3       
mai 20073103  79         
abr 20073103  79         
mar 20073103  79         
fev 20073103  78         
jan 2007393  78         
dez 2006393  78         
nov 2006393  78         
out 2006383  78         
set 2006373  78         
ago 2006373  78         
jul 2006173  78         
jun 2006163  78         
mai 2006163  78         
abr 2006163  78         
mar 2006163  78         
fev 2006163  78         
jan 2006163  78         

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

jan 2006: 1 1 መበገሲ ገጽ

fev 2006: 1 1 መበገሲ ገጽ

ago 2006: 1 1 main Page

fev 2007: 1 1 መበገሲ ገጽ

jul 2008: 1 1 Main Page

fev 2009: 1 1 hello

mar 2009: 1 2 water , 2 2 ውኃ , 3 2 ወፍ , 4 2 bird , 5 2 hurricane , 6 1 mountain

abr 2009: 1 1 hello

mai 2009: 1 1 mountain

jun 2009: 1 1 water

jul 2009: 1 1 one

ago 2009: 1 1 መብላት

set 2009: 1 1 bee

out 2009: 1 1 eat

nov 2009: 1 1 eat

dez 2009: 1 1 silver

jan 2010: 1 1 December

fev 2010: 1 1 March

mar 2010: 1 1 eat

abr 2010: 1 1 April

mai 2010: 1 2 ዐይን , 2 1 hyena

jun 2010: 1 1 ከልብ

jul 2010: 1 2 ጣት , 2 2 finger

ago 2010: 1 1 star

set 2010: 1 1 star

out 2010: 1 1 horse

nov 2010: 1 2 ሃገር

dez 2010: 1 1 እንሰሳ

jan 2011: 1 1 ሐያ

jun 2011: 1 1 ሁለት

mai 2012: 1 1 መበገሲ ገጽ

abr 2014: 1 1 ከልቢ

fev 2015: 1 1 فيبرواري

No data on this page have been normalized to 30 day months (as WMF does on certain traffic reports).
Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Sexta-feira, 27 de março 2015 00:00

Dump file tiwiktionary-20150315-pages-meta-history.xml.7z (full dump), size 341 kb as 7z -> 4.6 Mb
Dump processed till Feb 28, 2015, on server stat1002, ready at Mon-16/03/2015-03:55 after 5 sec.

Versão do script:2.6
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.