Estatísticas da Wikcionário tigrinya

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist

Metrics have been collected from a full archive dump, which contains all revisions of every article, meta data and raw content.
See also metrics definitions


 
Monthly counts & Quarterly rankings: agosto 2014
 
DataWikcionaristasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
ago 2014    0%    0%0%0%+1%   
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
ago 20144   389 53717109 kb2,4 k1803,1 k 83
jul 20144   389 5377109 kb2,4 k1803,1 k 83
jun 20144   389 4,9371109 kb2,4 k1803,1 k 83
mai 20144   389 4,9371109 kb2,4 k1803,1 k 83
abr 20144   389 4,9372109 kb2,4 k1803,1 k 83
mar 20144   389 4,9371109 kb2,4 k1803,1 k 83
fev 20144   389 4,9371109 kb2,4 k1803,1 k 83
jan 20144   389 4,9375108 kb2,4 k1803,1 k 83
dez 20134   389 4,937226108 kb2,4 k1803,1 k 83
nov 20134   388 4,3374102 kb2,3 k1802,7 k 83
out 20134   388 4,337 102 kb2,3 k1802,7 k 83
set 20134   388 4,337 102 kb2,3 k1802,7 k 83
ago 20134   388 4,33727102 kb2,3 k1802,7 k 83
jul 20134   388 4,33718101 kb2,3 k1802,6 k 83
jun 20134   388 4,23722101 kb2,3 k1802,6 k 83
mai 20134   388 4,2378101 kb2,3 k1802,6 k 83
abr 20134   388 4,1374100 kb2,3 k1802,6 k 83
mar 20134   388 4,13725100 kb2,3 k1802,6 k 83
fev 20134   388 4,1379100 kb2,3 k1802,5 k 83
jan 20134   388 4377100 kb2,3 k1802,5 k 83
dez 20124   388 4377100 kb2,3 k1802,5 k 83
nov 20124   388 4376100 kb2,3 k1802,5 k 83
out 20124   388 4375100 kb2,3 k1802,5 k 83
set 20124   388 4376100 kb2,3 k1802,5 k 83
ago 20124   388 43713100 kb2,3 k1802,5 k 83
jul 20124   388 3,9373099 kb2,3 k1802,5 k 83
jun 20124   388 3,837599 kb2,3 k1802,5 k 83
mai 20124   388 3,8371199 kb2,3 k1802,4 k 83
abr 20124   388 3,8371499 kb2,3 k1802,4 k 83
mar 20124   388 3,8373199 kb2,3 k1802,4 k 83
fev 20124   388 3,7371098 kb2,3 k1802,4 k 83
jan 20124   388 3,7371498 kb2,3 k1802,4 k 83
dez 20114   388 3,6373898 kb2,3 k1802,4 k 83
nov 20114   388 3,5373298 kb2,3 k1802,3 k 83
out 20114   388 3,4372297 kb2,3 k1802,3 k 83
set 20114   388 3,437396 kb2,3 k1802,3 k 83
ago 20114   388 3,437996 kb2,3 k1802,3 k 83
jul 20114   388 3,437596 kb2,3 k1802,2 k 83
jun 20114   388 3,337796 kb2,3 k1802,2 k 83
mai 20114   386 3,337895 kb2,3 k1762,2 k 83
abr 20114   386 3,3371095 kb2,3 k1762,2 k 83
mar 20114   386 3,3371995 kb2,3 k1762,1 k 83
fev 20114   386 3,337695 kb2,3 k1762,1 k 83
jan 20114 1 386 3,2371594 kb2,3 k1762,1 k 83
dez 20104   383 3,2372193 kb2,3 k1692,0 k 83
nov 20104   380 3,2371092 kb2,3 k1631,9 k 83
out 20104 1 380 3,237992 kb2,3 k1631,9 k 83
set 20104 1 380 3,1372091 kb2,3 k1631,9 k 83
ago 2010412 380 3,1372791 kb2,3 k1631,9 k 83
jul 20103 2 379 3374991 kb2,3 k1551,9 k 83
jun 20103 1 375 2,9373689 kb2,3 k1481,7 k 83
mai 20103 1 367 2,9374386 kb2,2 k1311,6 k 83
abr 20103 1 360 2,8361782 kb2,2 k961,3 k 83
mar 20103 1 357 2,8361481 kb2,2 k901,3 k 83
fev 20103 1 357 2,8363081 kb2,2 k901,2 k 83
jan 20103 1 354 2,7352479 kb2,1 k811,1 k 83
dez 20093 1 352 2,7352077 kb2,1 k701,0 k 83
nov 20093 1 351 2,6351076 kb2,1 k65964 83
out 20093 1 351 2,6351376 kb2,1 k65957 83
set 20093   351 2,535376 kb2,1 k65944 83
ago 20093 1 351 2,5352676 kb2,1 k65941 83
jul 20093 1 349 2,5353575 kb2,1 k61885 83
jun 20093   338 2,435371 kb2,1 k38589 83
mai 20093 1 338 2,435771 kb2,1 k38586 83
abr 20093 1 338 2,4351270 kb2,1 k38579 83
mar 2009322133272,43524570 kb2,0 k38580 83
fev 20091   123 4,645162 kb9176100 83
jan 20091   123 4,545162 kb917699 83
dez 20081   123 4,545 62 kb917698 83
nov 20081   123 4,545 62 kb917698 83
out 20081   123 4,545 62 kb917698 83
set 20081   123 4,545 62 kb917698 83
ago 20081   123 4,5451362 kb917698 83
jul 20081   111 4,9472161 kb856655 83
jun 20081   99 5,349 61 kb7966107 82
mai 20081   99 5,349 61 kb7966107 82
abr 20081   99 5,349 61 kb7966107 82
mar 20081   99 5,349 61 kb7966107 82
fev 20081   99 5,349161 kb7966107 82
jan 20081   98 5,349261 kb7895107 82
dez 20071   97 5,449 61 kb7844107 82
nov 20071   97 5,449261 kb7844107 82
out 20071   97 5,449161 kb7844107 82
set 20071   97 5,349 61 kb7844107 82
ago 20071   97 5,349161 kb7844107 82
jul 20071   9735,35017461 kb7904107 82
jun 20071   15 22,913633543 kb2444107 81
mai 20071   1 8500 1,8 kb75 107 81
abr 20071   1 8500 1,8 kb75 107 81
mar 20071   1 8500 1,8 kb75 107 81
fev 20071   1 850011,8 kb75 107 81
jan 20071        77      1
dez 20061        77      1
nov 20061        77      1
out 20061        77      1
set 20061        77      1
ago 20061       477      1
jul 20061       166       
jun 20061        44       
mai 20061        44       
abr 20061        44       
mar 20061        44       
fev 20061       144       
jan 200611      144       
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
 WikcionaristasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikcionaristas (usuários registrados)
A = Wikcionaristas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikcionaristas que editaram pelo menos dez vezes desde que chegaram
C = Wikcionaristas que contribuíram cinco vezes ou mais este mês
D = Wikcionaristas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  5  10  100  1  3  1  3  5  10  5  10 
Monthly counts for recent history of wiki
ago 2014    11    31    
jul 2014    1           
jun 2014                
mai 2014          1     
abr 20141         6     
mar 2014       1  3     
fev 2014       1  4     
jan 2014    1  1  6211  
dez 2013    1112  6     
nov 2013       1  9     
out 2013       1  51    
set 2013       21 3211  
ago 2013    11    2     
jul 2013    11    11    
jun 2013    11 1  2     
mai 2013          1     
abr 2013          1     
mar 2013    31    111   
fev 2013       2  31    
jan 2013    1     2     
dez 2012    1  1  41    
nov 2012          2     
out 2012          31  1 
set 2012    1     111   
ago 2012    1  2  311   
jul 2012    22    51    
jun 2012          311   
mai 20121   1  2  52    
abr 2012    2  11 2111  
mar 2012    31 2  31    
fev 2012    1  1  531   
jan 2012    2     21  1 
Quarterly counts for entire history of wiki
jul 2014    1           
abr 20141         6     
jan 2014    1  1  6211  
out 2013       1  51    
jul 2013    11    11    
abr 2013          1     
jan 2013    1     2     
out 2012          31  1 
jul 2012    22    51    
abr 2012    2  11 2111  
jan 2012    2     21  1 
out 2011    21 1  4     
jul 2011       1  311   
abr 2011    1     2111  
jan 2011211        3     
out 2010111        2     
jul 201022211            
abr 20101111    1  42    
jan 20101111    1  1111  
out 20091111       2     
jul 20091111       2   1 
abr 20091111       3111  
jan 2009          211   
out 2008       1  322   
jul 200811  11 2        
abr 2008                
jan 2008          1     
out 2007          1     
jul 2007          1     
abr 2007                
jan 2007                
out 2006          1     
jul 2006          1     
abr 2006                
jan 20061      2  41    

 

Distribuição de edições de artigos por wikcionaristas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikcionaristasEdições total
115100.0%569100.0%
3426.7%55297.0%
10320.0%54796.1%
3216.7%50588.8%
10016.7%50588.8%
31616.7%50588.8%

 

14 wikcionaristas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
InterwicketUC1505fev 20, 20092017out 20, 20101410
虎の女の児UC222jul 10, 20101512jun 13, 20111174
PiolinfaxUC320mar 05, 20092004mar 05, 20092004
SpacebirdyUC45jul 21, 20082231jul 29, 20082223
KoavfUC53ago 01, 20062951ago 01, 20062951
බිඟුවාUC63dez 31, 20101338dez 31, 20101338
DanydŵrUC72mai 08, 20101575mai 08, 20101575
NewriteUC82jan 08, 20111330jan 08, 20111330
GangleriUC91jan 05, 20063159jan 05, 20063159
Az1568UC101fev 14, 20072754fev 14, 20072754
OcotonigiqUC111nov 23, 20101376nov 23, 20101376
MercyUC121nov 24, 20101375nov 24, 20101375
Piet-cUC131mai 22, 2012830mai 22, 2012830
Adriano MorelliUC141abr 27, 2014125abr 27, 2014125

 

usuários anônimos, ordenados por número de contribuições
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
58.179.207.31207
58.179.201.106101
210.50.14.14470
210.50.226.17669
58.179.203.8941
116.240.133.1416
82.198.250.614
82.198.250.7014
83.61.161.24410

No total 620 edições foram feitas por usuários anônimos, de um total de 1945 edições ( 31e %)
  


15 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
Luckas-botUC1290mar 27, 20091982jan 27, 2014215--
HydrizBotUC2137abr 24, 2012858ago 21, 2013374--
JAnDbotUC390mai 23, 20111195ago 28, 20142--
KamikazeBotUC489out 18, 20111047mar 07, 2013541--
WikitanvirBotUC531abr 24, 20111224jan 11, 2012962--
AvocatoBotUC623nov 05, 20111029mai 26, 2012826--
VolkovBotUC719jul 29, 20082223mar 21, 2013527--
SpaceBirdyBotUC816jul 21, 20082231jan 20, 20092048--
ArthurBotUC916nov 20, 20101379mai 30, 20111188--
YS-BotUC1014mar 28, 2013520ago 11, 201419--
MjbmrbotUC1113fev 14, 20111293mar 26, 20111253--
RoggBotUC127dez 23, 20101346jan 18, 20111320--
CarsracBotUC136out 21, 20091774mai 19, 2013468--
WarddrBOTUC143jul 29, 2012762jul 31, 2012760--
Makecat-botUC152dez 04, 2012634dez 04, 2012634--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110
ago 20145644269 191 8       
jul 20145644229 191 8       
jun 20145644229 191 8       
mai 20145644229 191 8       
abr 20145644229 191 8      1
mar 20145644169 191 8       
fev 20145644139 191 8       
jan 20145644109 191 8       
dez 20135644009 191 8       
nov 20135643989 191 7       
out 20135643909 191 7       
set 20135643859 191 7       
ago 20135643659 191 7       
jul 20135643629 191 7       
jun 20135643599 191 7       
mai 20135643579 191 7       
abr 20135643569 191 7       
mar 20135643539 191 7       
fev 20135643469 191 7       
jan 20135643419 191 7       
dez 20125643389 191 7       
nov 20125643339 191 7       
out 20125643329 191 7       
set 20125643289 191 7       
ago 20125643239 191 7       
jul 20125643179 191 7       
jun 20125643149 191 7       
mai 20125643029 191 7      1
abr 20125642939 191 7       
mar 20125642839 191 7       
fev 20125642809 191 7       
jan 20125642659 190 7       
dez 20115642609 190 7       
nov 20115642579 190 7       
out 20115642469 189 7       
set 20115642409 189 7       
ago 20115642369 189 7       
jul 20115642299 189 7       
jun 20115642169 189 7      3
mai 20115622129 189 7       
abr 20115622049 189 7       
mar 20115621939 189 7       
fev 20115621939 189 7       
jan 20115621859 189 7      7
dez 20105591809 189 7      7
nov 20105561799 189 7      2
out 20105561749  89 7      9
set 20105561729  89 7      20
ago 20105561679  89 7      27
jul 20105561509  89 7      47
jun 20105521509  89 7      27
mai 20105441289  89 6      21
abr 20105371269  89 6      10
mar 20105341189  89 6      14
fev 20105341149  89 6      23
jan 20105311129  89 6      16
dez 2009529979  89 6      9
nov 2009528969  88 6      9
out 2009528949  88 6      11
set 2009528929  88 6      3
ago 2009528859  88 6      21
jul 2009526859  88 6      15
jun 2009516829  88 6      3
mai 2009516819  87 6      7
abr 2009516799  87 6      10
mar 2009516718  87 6      234
fev 2009502636  80 6      1
jan 2009502576  80 6       
dez 2008502576  80 6       
nov 2008502576  80 6       
out 2008502406  80 6       
set 2008502296  80 6       
ago 2008502296  80 6       
jul 2008502276  80 6      5
jun 2008501276  80 6       
mai 2008501245  80 6       
abr 2008501235  80 6       
mar 2008501235  80 6       
fev 2008501175  80 6       
jan 2008501175  80 6       
dez 2007501165  80 5       
nov 2007501155  80 5       
out 2007500145  80 5       
set 2007499134  80 5       
ago 2007499124  80 5       
jul 2007499104  80 5       
jun 2007329104  80 3       
mai 20073103  79         
abr 20073103  79         
mar 20073103  79         
fev 20073103  78         
jan 2007393  78         
dez 2006393  78         
nov 2006393  78         
out 2006383  78         
set 2006373  78         
ago 2006373  78         
jul 2006173  78         
jun 2006163  78         
mai 2006163  78         
abr 2006163  78         
mar 2006163  78         
fev 2006163  78         
jan 2006163  78         

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

jan 2006: 1 1 መበገሲ ገጽ

fev 2006: 1 1 መበገሲ ገጽ

ago 2006: 1 1 main Page

fev 2007: 1 1 መበገሲ ገጽ

jul 2008: 1 1 Main Page

fev 2009: 1 1 hello

mar 2009: 1 2 water , 2 2 ውኃ , 3 2 ወፍ , 4 2 bird , 5 2 hurricane , 6 1 mountain

abr 2009: 1 1 hello

mai 2009: 1 1 mountain

jun 2009: 1 1 water

jul 2009: 1 1 one

ago 2009: 1 1 መብላት

set 2009: 1 1 bee

out 2009: 1 1 eat

nov 2009: 1 1 eat

dez 2009: 1 1 silver

jan 2010: 1 1 December

fev 2010: 1 1 March

mar 2010: 1 1 eat

abr 2010: 1 1 April

mai 2010: 1 2 ዐይን , 2 1 hyena

jun 2010: 1 1 ከልብ

jul 2010: 1 2 ጣት , 2 2 finger

ago 2010: 1 1 star

set 2010: 1 1 star

out 2010: 1 1 horse

nov 2010: 1 2 ሃገር

dez 2010: 1 1 እንሰሳ

jan 2011: 1 1 ሐያ

jun 2011: 1 1 ሁለት

mai 2012: 1 1 መበገሲ ገጽ

abr 2014: 1 1 ከልቢ

No data on this page have been normalized to 30 day months (as WMF does on certain traffic reports).
Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Domingo, 28 de setembro 2014 22:01

Dump file tiwiktionary-20140905-pages-meta-history.xml.7z (full dump), size 332 kb as 7z -> 4.3 Mb
Dump processed till Aug 31, 2014, on server stat1002, ready at Mon-08/09/2014-12:09 after 7 sec.

Versão do script:2.6
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.