Estatísticas da Wikcionário tigrinya

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist

Metrics have been collected from a full archive dump, which contains all revisions of every article, meta data and raw content.
See also metrics definitions


 
Monthly counts & Quarterly rankings: dezembro 2013
 
DataWikcionaristasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
dez 2013    0%    +6%0%0%+15%   
ago 2013    0%    0%0%0%+1%   
jul 2013    0%    0%0%0%+1%   
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
dez 20134   389 4,937226108 kb2,4 k1803,1 k 83
nov 20134   388 4,3374102 kb2,3 k1802,7 k 83
out 20134   388 4,337 102 kb2,3 k1802,7 k 83
set 20134   388 4,337 102 kb2,3 k1802,7 k 83
ago 20134   388 4,33727102 kb2,3 k1802,7 k 83
jul 20134   388 4,33718101 kb2,3 k1802,6 k 83
jun 20134   388 4,23722101 kb2,3 k1802,6 k 83
mai 20134   388 4,2378101 kb2,3 k1802,6 k 83
abr 20134   388 4,1374100 kb2,3 k1802,6 k 83
mar 20134   388 4,13725100 kb2,3 k1802,6 k 83
fev 20134   388 4,1379100 kb2,3 k1802,5 k 83
jan 20134   388 4377100 kb2,3 k1802,5 k 83
out 20134   388 4,337 102 kb2,3 k1802,7 k 83
jul 20134   388 4,33718101 kb2,3 k1802,6 k 83
abr 20134   388 4,1374100 kb2,3 k1802,6 k 83
jan 20134   388 4377100 kb2,3 k1802,5 k 83
out 20124   388 4375100 kb2,3 k1802,5 k 83
jul 20124   388 3,9373099 kb2,3 k1802,5 k 83
abr 20124   388 3,8371499 kb2,3 k1802,4 k 83
jan 20124   388 3,7371498 kb2,3 k1802,4 k 83
out 20114   388 3,4372297 kb2,3 k1802,3 k 83
jul 20114   388 3,437596 kb2,3 k1802,2 k 83
abr 20114   386 3,3371095 kb2,3 k1762,2 k 83
jan 20114 1 386 3,2371594 kb2,3 k1762,1 k 83
out 20104 1 380 3,237992 kb2,3 k1631,9 k 83
jul 20103 2 379 3374991 kb2,3 k1551,9 k 83
abr 20103 1 360 2,8361782 kb2,2 k961,3 k 83
jan 20103 1 354 2,7352479 kb2,1 k811,1 k 83
out 20093 1 351 2,6351376 kb2,1 k65957 83
jul 20093 1 349 2,5353575 kb2,1 k61885 83
abr 20093 1 338 2,4351270 kb2,1 k38579 83
jan 20091   123 4,545162 kb917699 83
out 20081   123 4,545 62 kb917698 83
jul 20081   111 4,9472161 kb856655 83
abr 20081   99 5,349 61 kb7966107 82
jan 20081   98 5,349261 kb7895107 82
out 20071   97 5,449161 kb7844107 82
jul 20071   9735,35017461 kb7904107 82
abr 20071   1 8500 1,8 kb75 107 81
jan 20071        77      1
out 20061        77      1
jul 20061       166       
abr 20061        44       
jan 200611      144       
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
 WikcionaristasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikcionaristas (usuários registrados)
A = Wikcionaristas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikcionaristas que editaram pelo menos dez vezes desde que chegaram
C = Wikcionaristas que contribuíram cinco vezes ou mais este mês
D = Wikcionaristas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  5  10  100  1  3  1  3  5  10  25  5  10 
dez 2013    1112  61     
nov 2013       1  9      
out 2013       1  51     
set 2013       21 42111  
ago 2013    11    2      
jul 2013    11    11     
jun 2013    11 1  2      
mai 2013          1      
abr 2013          1      
mar 2013    31    111    
fev 2013       2  411    
jan 2013    1     2      
dez 2012    1  1  41     
nov 2012          2      
out 2012          31   1 
set 2012    1     111    
ago 2012    1  2  311    
jul 2012    22    51     
jun 2012          311    
mai 20121   1  2  52     
abr 2012    2  11 4111   
mar 2012    31 2  31     
fev 2012    1  1  5311   
jan 2012    2     21   1 
out 2013       1  51     
jul 2013    11    11     
abr 2013          1      
jan 2013    1     2      
out 2012          31   1 
jul 2012    22    51     
abr 2012    2  11 4111   
jan 2012    2     21   1 
out 2011    21 1  41     
jul 2011       1  311    
abr 2011    1     2111   
jan 2011211        3      
out 2010111        2      
jul 201022211             
abr 20101111    1  421    
jan 20101111    1  1111   
out 20091111       2      
jul 20091111       2    1 
abr 20091111       3111   
jan 2009          211    
out 2008       1  322    
jul 200811  11 2         
abr 2008                 
jan 2008          1      
out 2007          1      
jul 2007          1      
abr 2007                 
jan 2007                 
out 2006          1      
jul 2006          1      
abr 2006                 
jan 20061      2  41     

 

Distribuição de edições de artigos por wikcionaristas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikcionaristasEdições total
114100.0%568100.0%
3428.6%55297.2%
10321.4%54796.3%
3217.1%50588.9%
10017.1%50588.9%
31617.1%50588.9%

 

13 wikcionaristas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
InterwicketUC1505fev 20, 20091774out 20, 20101167
虎の女の児UC222jul 10, 20101269jun 13, 2011931
PiolinfaxUC320mar 05, 20091761mar 05, 20091761
SpacebirdyUC45jul 21, 20081988jul 29, 20081980
KoavfUC53ago 01, 20062708ago 01, 20062708
බිඟුවාUC63dez 31, 20101095dez 31, 20101095
DanydŵrUC72mai 08, 20101332mai 08, 20101332
NewriteUC82jan 08, 20111087jan 08, 20111087
GangleriUC91jan 05, 20062916jan 05, 20062916
Az1568UC101fev 14, 20072511fev 14, 20072511
OcotonigiqUC111nov 23, 20101133nov 23, 20101133
MercyUC121nov 24, 20101132nov 24, 20101132
Piet-cUC131mai 22, 2012587mai 22, 2012587

 

usuários anônimos, ordenados por número de contribuições
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
58.179.207.31207
58.179.201.106101
210.50.14.14470
210.50.226.17669
58.179.203.8941
116.240.133.1416
82.198.250.614
82.198.250.7014
83.61.161.24410

No total 620 edições foram feitas por usuários anônimos, de um total de 1910 edições ( 32e %)
  


15 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
Luckas-botUC1285mar 27, 20091739dez 27, 20133--
HydrizBotUC2137abr 24, 2012615ago 21, 2013131--
KamikazeBotUC389out 18, 2011804mar 07, 2013298--
JAnDbotUC468mai 23, 2011952nov 19, 201341--
WikitanvirBotUC531abr 24, 2011981jan 11, 2012719--
AvocatoBotUC623nov 05, 2011786mai 26, 2012583--
VolkovBotUC719jul 29, 20081980mar 21, 2013284--
SpaceBirdyBotUC816jul 21, 20081988jan 20, 20091805--
ArthurBotUC916nov 20, 20101136mai 30, 2011945--
MjbmrbotUC1013fev 14, 20111050mar 26, 20111010--
RoggBotUC117dez 23, 20101103jan 18, 20111077--
YS-BotUC127mar 28, 2013277mar 28, 2013277--
CarsracBotUC136out 21, 20091531mai 19, 2013225--
WarddrBOTUC143jul 29, 2012519jul 31, 2012517--
Makecat-botUC152dez 04, 2012391dez 04, 2012391--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110
dez 20135644369 191 8       
nov 20135644339 191 7       
out 20135644239 191 7       
set 20135644169 191 7       
ago 20135643919 191 7       
jul 20135643889 191 7       
out 20135644239 191 7       
jul 20135643889 191 7       
abr 20135643819 191 7       
jan 20135643629 191 7       
out 20125643529 191 7       
jul 20125643349 191 7       
abr 20125643109 191 7       
jan 20125642769 190 7       
out 20115642569 189 7       
jul 20115642379 189 7       
abr 20115622119 189 7       
jan 20115621919 189 7      7
out 20105561799  89 7      9
jul 20105561559  89 7      47
abr 20105371299  89 6      10
jan 20105311149  89 6      16
out 2009528969  88 6      11
jul 2009526869  88 6      15
abr 2009516809  87 6      10
jan 2009502576  80 6       
out 2008502406  80 6       
jul 2008502276  80 6      5
abr 2008501235  80 6       
jan 2008501175  80 6       
out 2007500145  80 5       
jul 2007499104  80 5       
abr 20073103  79         
jan 2007393  78         
out 2006383  78         
jul 2006173  78         
abr 2006163  78         
jan 2006163  78         

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

jan 2006: 1 1 መበገሲ ገጽ

fev 2006: 1 1 መበገሲ ገጽ

ago 2006: 1 1 main Page

fev 2007: 1 1 መበገሲ ገጽ

jul 2008: 1 1 Main Page

fev 2009: 1 1 hello

mar 2009: 1 2 water , 2 2 ውኃ , 3 2 ወፍ , 4 2 bird , 5 2 hurricane , 6 1 mountain

abr 2009: 1 1 hello

mai 2009: 1 1 mountain

jun 2009: 1 1 water

jul 2009: 1 1 one

ago 2009: 1 1 መብላት

set 2009: 1 1 bee

out 2009: 1 1 eat

nov 2009: 1 1 eat

dez 2009: 1 1 silver

jan 2010: 1 1 December

fev 2010: 1 1 March

mar 2010: 1 1 eat

abr 2010: 1 1 April

mai 2010: 1 2 ዐይን , 2 1 hyena

jun 2010: 1 1 ከልብ

jul 2010: 1 2 ጣት , 2 2 finger

ago 2010: 1 1 star

set 2010: 1 1 star

out 2010: 1 1 horse

nov 2010: 1 2 ሃገር

dez 2010: 1 1 እንሰሳ

jan 2011: 1 1 ሐያ

jun 2011: 1 1 ሁለት

mai 2012: 1 1 መበገሲ ገጽ

Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Segunda-feira, 27 de janeiro 2014 20:56

Dump file tiwiktionary-20140106-pages-meta-history.xml.7z (full dump), size 325 kb as 7z -> 4.2 Mb
Dump processed till Dec 31, 2013, on server stat1002, ready at Fri-10/01/2014-03:30 after 9 sec.

Versão do script:2.6
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.