Estatísticas da Wikiquote min nan

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist
 
Jan 31, 2019: This is the final release of Wikistats-1 dump-based reports. Part of these data are available in the first release of Wikistats 2. Read more here

 

Metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.
See also metrics definitions


 
Monthly counts & Quarterly rankings: dezembro 2018
 
DataWikiquotariansArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
dez 20184   24 12      ( ) 43
nov 20184   24 12      ( ) 43
out 20184   24 12      ( ) 43
set 20184   24 12      ( ) 43
ago 20184   24 12      ( ) 43
jul 20184   24 12      ( ) 43
jun 20184   24 12      ( ) 43
mai 20184   24 12      ( ) 43
abr 20184   24 12      ( ) 43
mar 20184   24 12      ( ) 43
fev 20184   24 12      ( ) 43
jan 20184   24 12      ( ) 43
dez 20174   24 12      ( ) 43
nov 20174   24 12      ( ) 43
out 20174   24 12      ( ) 43
set 20174   24 12      ( ) 43
ago 20174   24 12      ( ) 43
jul 20174   24 12      ( ) 43
jun 20174   24 12      ( ) 43
mai 20174   24 12      ( ) 43
abr 20174   24 12      ( ) 43
mar 20174   24 12      ( ) 43
fev 20174   24 12      ( ) 43
jan 20174   24 12      ( ) 43
dez 20164   24 12      ( ) 43
nov 20164   24 12      ( ) 43
out 20164   24 12      ( ) 43
set 20164   24 12      ( ) 43
ago 20164   24 12      ( ) 43
jul 20164   24 12      ( ) 43
jun 20164   24 12      ( ) 43
mai 20164   24 12      ( ) 43
abr 20164   24 12      ( ) 43
mar 20164   24 12      ( ) 43
fev 20164   24 12      ( ) 43
jan 20164   24 12      ( ) 43
dez 20154   24 12      ( ) 43
nov 20154   24 12      ( ) 43
out 20154   24 12      ( ) 43
set 20154   24 12      ( ) 43
ago 20154   24 12      ( ) 43
jul 20154   24 12      ( ) 43
jun 20154   24 12      ( ) 43
mai 20154   24 12      ( ) 43
abr 20154   24 12      ( ) 43
mar 20154   24 12      ( ) 43
fev 20154   24 12      ( ) 43
jan 20154   24 12      ( ) 43
dez 20144   24 12      ( ) 43
nov 20144   24 12      ( ) 43
out 20144   24 12      ( ) 43
set 20144   24 12      ( ) 43
ago 20144   24 12      ( ) 43
jul 20144   24 12      ( ) 43
jun 20144   24 12      ( ) 43
mai 20144   24 12      ( ) 43
abr 20144   24 12      ( ) 43
mar 20144   24 12      ( ) 43
fev 20144   24 12      ( ) 43
jan 20144   24 12      ( ) 43
dez 20134   24 12      ( ) 43
nov 20134   24 12      ( ) 43
out 20134   24 12      ( ) 43
set 20134   24 12      ( ) 43
ago 20134   24 12      ( ) 43
jul 20134   24 12      ( ) 43
jun 20134   24 12      ( ) 43
mai 20134   24 12      ( ) 43
abr 20134   24 12      ( ) 43
mar 20134   24 12      ( ) 43
fev 20134   24 12      ( ) 43
jan 20134   24 12 3    ( ) 43
dez 20124   24 11,8      ( ) 43
nov 20124   24 11,8 1    ( ) 43
out 20124   24 11,8 3    ( ) 43
set 20124   24 11,7 4    ( ) 43
ago 20124   24 11,5      ( ) 43
jul 20124   24 11,5 3    ( ) 43
jun 20124   24 11,4 1    ( ) 43
mai 20124   24 11,3      ( ) 43
abr 20124   24 11,3 2    ( ) 43
mar 20124   24 11,2      ( ) 43
fev 20124   24 11,2      ( ) 43
jan 20124 1 24 11,2 7    ( ) 43
dez 20114   24 11      ( ) 43
nov 20114   24 11      ( ) 43
out 20114   24 11 4    ( ) 43
set 20114   24 10,8 2    ( ) 43
ago 20114   24 10,7 3    ( ) 43
jul 20114   23 11 5    ( ) 43
jun 20114   23 10,8      ( ) 43
mai 20114   23 10,8      ( ) 43
abr 20114   23 10,8      ( ) 43
mar 20114   23 10,8 7    ( ) 43
fev 20114   23 10,5 1    ( ) 43
jan 20114   23 10,5 2    ( ) 43
dez 20104   23 10,4      ( ) 43
nov 20104   23 10,4 1    ( ) 43
out 20104   23 10,3 2    ( ) 43
set 20104   23 10,3 2    ( ) 43
ago 20104   23 10,2 2    ( ) 43
jul 20104   23 10,1 3    ( ) 43
jun 20104   23 10 3    ( ) 43
mai 20104   23 9,8 1    ( ) 43
abr 20104   23 9,8      ( ) 43
mar 20104   23 9,8 2    ( ) 43
fev 20104   23 9,7 7    ( ) 43
jan 20104   23 9,4      ( ) 43
dez 20094   23 9,4 1    ( ) 43
nov 20094   23 9,3 2    ( ) 43
out 20094 1 23 9,3 11    ( ) 43
set 2009411 23 8,8 7    ( ) 43
ago 20093   23 8,5      ( ) 43
jul 20093   23 8,5 1    ( ) 43
jun 20093 1 23 8,4 9    ( ) 43
mai 2009311 23 8 68    ( ) 41
abr 20092   23 5,1 9    ( ) 8
mar 20092   23 4,7      ( ) 8
fev 20092   23 4,7      ( ) 8
jan 20092   23 4,7 1    ( ) 8
dez 20082   23 4,7 9    ( ) 8
nov 20082   23 4,3      ( ) 8
out 20082   23 4,3 2    ( ) 8
set 20082   22 4,4      ( ) 8
ago 20082   22 4,4      ( ) 8
jul 20082   22 4,4      ( ) 8
jun 20082   22 4,4      ( ) 8
mai 20082   22 4,4      ( ) 8
abr 20082   22 4,4      ( ) 8
mar 20082   22 4,4      ( ) 8
fev 20082   22 4,4      ( ) 8
jan 20082   22 4,4      ( ) 8
dez 20072 1 22 4,4 17    ( ) 8
nov 20072   20 4      ( ) 6
out 20072   20 4      ( ) 6
set 20072   20 4 5    ( ) 6
ago 20072 1 20 3,7 14    ( ) 6
jul 2007211 1713,5 49    ( ) 6
jun 20071 1 1 11 8    ( ) 1
mai 20071   1 3      ( ) 1
abr 20071   1 3      ( ) 1
mar 20071   1 3      ( ) 1
fev 20071   1 3      ( ) 1
jan 20071   1 3      ( ) 1
dez 20061   1 3      ( ) 1
nov 20061   1 3      ( ) 1
out 20061   1 3      ( ) 1
set 20061   1 3      ( ) 1
ago 20061   1 3 2    ( ) 1
jul 20061   1 1      ( )  
jun 20061   1 1      ( )  
mai 20061   1 1      ( )  
abr 20061   1 1      ( )  
mar 20061   1 1      ( )  
fev 20061   1 1      ( )  
jan 20061   1 1      ( )  
dez 20051   1 1      ( )  
nov 20051   1 1      ( )  
out 20051   1 1      ( )  
set 20051   1 1      ( )  
ago 20051   1 1      ( )  
jul 20051   1 1      ( )  
jun 20051   1 1      ( )  
mai 20051   1 1      ( )  
abr 20051   1 1      ( )  
mar 20051   1 1      ( )  
fev 200511  1 1 1    ( )  
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
 WikiquotariansArtigosBase de dadosLigações

Counts for image links are based on keyword(s) found in the message file for this language: .
Note that image links based on default keyword 'Image' and/or 'File' have been missed. This will be repaired on the next run.

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikiquotarians (usuários registrados)
A = Wikiquotarians que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikiquotarians que editaram pelo menos dez vezes desde que chegaram
C = Wikiquotarians que contribuíram cinco vezes ou mais este mês
D = Wikiquotarians que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  5  1  3  5  10  1  3  5  10  25  5  10 
dez 2018                
nov 2018                
out 2018         2      
set 2018                
ago 2018                
jul 2018                
jun 2018                
mai 2018                
abr 2018                
mar 2018                
fev 2018                
jan 2018                
dez 2017                
nov 2017                
out 2017                
set 2017                
ago 2017                
jul 2017                
jun 2017                
mai 2017                
abr 2017                
mar 2017                
fev 2017         1      
jan 2017                
out 2018         2      
jul 2018                
abr 2018                
jan 2018                
out 2017                
jul 2017                
abr 2017                
jan 2017                
out 2016                
jul 2016                
abr 2016                
jan 2016                
out 2015              1 
jul 2015     1   1      
abr 2015       111      
jan 2015     1          
out 2014                
jul 2014                
abr 2014                
jan 2014         1      
out 2013                
jul 2013                
abr 2013                
jan 2013     1   3      
out 2012         51   1 
jul 2012         51   1 
abr 2012     11  411    
jan 2012211       511    
out 201111       6      
jul 2011    11   521    
abr 2011         411    
jan 20111        3      
out 2010         1      
jul 2010                
abr 2010     1   321    
jan 2010     1   1111   
out 20091111      1      
jul 2009         1      
abr 20091   11   411  11
jan 2009         211    
out 20081    1   322    
jul 2008                
abr 2008                
jan 2008         1      
out 2007         1      
jul 200711111     11111  
abr 2007                
jan 2007                
out 2006         1      
jul 2006                
abr 2006                
jan 2006                
out 2005                
jul 2005                
abr 2005                

 

Distribuição de edições de artigos por wikiquotarians
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikiquotariansEdições total
115100.0%250100.0%
3746.7%23794.8%
10320.0%21586.0%
32320.0%21586.0%

 

15 wikiquotarians recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
Chùn-hiànUC184jun 20, 20074211jun 13, 20093487
SULUC276mai 16, 20093515jun 10, 20093490
AnankeBotUC355dez 18, 20083664out 28, 20112620
VolkovBotUC49abr 08, 20093553jul 01, 20093469
CarsracBotUC55jan 19, 20122537jan 30, 20122526
LaaknorBotUC64jan 24, 20093627jan 01, 20122555
MerlIwBotUC74jul 27, 20122347out 10, 20122272
A-lú-mihUC83out 27, 20083716ago 31, 20112678
ArthurBotUC93nov 12, 20093335dez 02, 20093315
KoavfUC102ago 01, 20064534ago 01, 20064534
?UC111fev 07, 20055074fev 07, 20055074
AstroviolinUC121abr 20, 20093541abr 20, 20093541
FiriBotUC131jan 09, 20112912jan 09, 20112912
LexusunsUC141jan 28, 20122528jan 28, 20122528
ChobotUC151nov 14, 20122237nov 14, 20122237

  

4 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
EleferenBotUC115fev 13, 20103242jan 03, 20132187--
DinybotUC29set 08, 20074131dez 15, 20074033--
AvicBotUC39jul 11, 20112729set 07, 20112671--
AvocatoBotUC41abr 17, 20122448abr 17, 20122448--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110
dez 20186725913 217 27       
nov 20186725913 217 27       
out 20186725913 217 27       
set 20186725813 217 27       
ago 20186725813 217 27       
jul 20186725813 217 27       
jun 20186725813 217 27       
mai 20186725813 217 27       
abr 20186725813 217 27       
mar 20186725813 217 27       
fev 20186725813 217 27       
jan 20186725813 217 27       
dez 20176725813 217 27       
nov 20176725813 217 27       
out 20176725813 217 27       
set 20176725813 217 27       
ago 20176725813 217 27       
jul 20176725813 217 27       
jun 20176725813 217 27       
mai 20176725813 217 27       
abr 20176725813 217 27       
mar 20176725813 217 27       
fev 20176725813 217 27       
jan 20176725713 217 27       
dez 20166725713 217 27       
nov 20166725713 217 27       
out 20166725713 217 27       
set 20166725713 217 27       
ago 20166725713 217 27       
jul 20166725713 217 27       
jun 20166725713 217 27       
mai 20166725713 217 27       
abr 20166725613 217 27       
mar 20166725613 217 27       
fev 20166725613 217 27       
jan 20166725613 217 27       
dez 20156725613 217 27       
nov 20156725613 217 27       
out 20156725613 217 27       
set 20156725613 210 27       
ago 20156725613 210 27       
jul 20156725613 29 27       
jun 20156725513 29 27       
mai 20156725513 29 27       
abr 20156725513 29 27       
mar 20156725413 29 27       
fev 20156725413 29 27       
jan 20156725213 29 27       
dez 20146725213 29 27       
nov 20146725213 29 27       
out 20146725113 29 27       
set 20146725113 29 27       
ago 20146725113 29 27       
jul 20146725013 29 27       
jun 20146725013 29 27       
mai 20146725013 29 27       
abr 20146725013 29 27       
mar 20146725013 29 27       
fev 20146725013 29 27       
jan 20146724913 29 27       
dez 20136724813 29 27       
nov 20136724813 29 27       
out 20136724813 29 27       
set 20136724813 29 27       
ago 20136724613 29 27       
jul 20136724613 29 27       
jun 20136724613 29 27       
mai 20136724513 29 27       
abr 20136724513 29 27       
mar 20136724513 29 27       
fev 20136724413 29 27       
jan 20136724113 29 27       
dez 20126724113 19 27       
nov 20126723313 19 27       
out 20126723213 19 27       
set 20126722813 19 27       
ago 20126722513 19 27       
jul 20126722113 19 27       
jun 20126721813 19 27       
mai 20126721113 19 27       
abr 20126720813 19 27       
mar 20126720113 19 27       
fev 20126720013 19 27       
jan 20126719213 19 27       
dez 20116718713 19 27       
nov 20116718513 19 27       
out 20116717613 18 27       
set 20116717113 18 27       
ago 20116716713 18 27       
jul 20116616413 18 27       
jun 20116615713 18 27       
mai 20116615313 18 27       
abr 20116614913 18 27       
mar 20116614313 18 27       
fev 20116614213 18 27       
jan 20116613713 18 27       
dez 20106613413 18 27       
nov 20106613213 18 27       
out 20106613013  8 27       
set 20106612913  8 27       
ago 20106612413  8 27       
jul 20106611213  8 27       
jun 20106611213  8 27       
mai 20106610313  8 27       
abr 20106610213  8 27       
mar 2010669711  8 27       
fev 2010669511  8 27       
jan 2010669211  8 27       
dez 2009668211  8 27       
nov 2009668111  8 27       
out 2009668011  8 27       
set 2009668010  8 27       
ago 2009667610  8 27       
jul 2009667610  8 27       
jun 2009667510  8 27       
mai 200964758  7 23       
abr 200931718  5 21       
mar 200931628  5 21       
fev 200931608  5 21       
jan 200931568  5 21       
dez 200831558  5 21       
nov 200831528  5 21       
out 200831388  5 21       
set 200830288  5 20       
ago 200830288  5 20       
jul 200830268  5 20       
jun 200830268  5 20       
mai 200830258  5 20       
abr 200830208  5 20       
mar 200830208  5 20       
fev 200830148  5 20       
jan 200830148  5 20       
dez 200730138  5 20       
nov 200726128  5 20       
out 20072698  3 20       
set 20072698  3 20       
ago 20072677  3 20       
jul 20072366  3 16       
jun 2007263  3         
mai 200726   1         
abr 200726   1         
mar 200726   1         
fev 200724   1         
jan 200724   1         
dez 200624   1         
nov 200624   1         
out 200623   1         
set 200623             
ago 200621             
jul 200611             
jun 200611             
mai 200611             
abr 200611             
mar 200611             
fev 20061              
jan 20061              
dez 20051              
nov 20051              
out 20051              
set 20051              
ago 20051              
jul 20051              
jun 20051              
mai 20051              
abr 20051              
mar 20051              
fev 20051              

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

fev 2005: 1 1 Thâu-ia̍h

ago 2006: 1 1 Main Page

jun 2007: 1 1 Thâu-ia̍h

jul 2007: 1 1 Leo Tolstoy

ago 2007: 1 1 Isaac Newton

set 2007: 1 1 Isaac Newton

dez 2007: 1 1 Sek-sî Hiân-bûn

out 2008: 1 1 Bill Gates

abr 2009: 1 1 Thâu-ia̍h

mai 2009: 1 1 Count Leo Tolstoi

jun 2009: 1 1 Goethe

set 2009: 1 1 Bill Gates

out 2009: 1 1 Bill Gates

jan 2011: 1 1 Francis Bacon

fev 2011: 1 1 Johann Wolfgang von Goethe

mar 2011: 1 1 Leo Tolstoy

ago 2011: 1 1 Tō͘ Chhong-bêng

out 2011: 1 1 Julius Caesar

jan 2012: 1 2 Bill Gates

nov 2012: 1 1 Julius Caesar

Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Sexta-feira, 1 de fevereiro 2019 02:29 (final run)

Dump file zh-min-nanwikiquote-20190101-stub-meta-history.xml.gz (edits only), size 70 kb as gz -> 477 kb
Dump processed till Dec 31, 2018, on server stat1007, ready at Sun-06/01/2019-09:14 after 3 sec.

Autor:Erik Zachte (2002-Jan 2019) (Sítio web)
Endereço:erikzachte@### (no spam: ### = infodisiac.com)
Documentation / Scripts / CSV files: About WikiStats

You can download the English version of these reports here (also download common_files.zip)
You can download aggregated data here

All data and images on this page are in the public domain.