Statistiques Wikipédia

Barres       Zoom          
Vue d'ensemble Données pour les derniers mois

  May 2016: The major overhaul of Wikistats reports has entered a new phase.  

  First phase focused on migrating the traffic analysis reports to our new infrastructure. Those are operational now.  
  The Analytics Team will now proceed to also migrate data collection and reporting about wiki content and contributors.  
  First results are expected later this year.  

  More info at this announcement
  You can see the first wireframes for Wikistats 2.0 and comment on the design here.

Moyenne = nombre moyen durant les mois affichés  |  Progression = progression mensuelle moyenne durant les mois affichés (formule)   
Articles - Base de données - Liens - Utilisations par jour    »
Wikipédiens - Contributeurs Wikipédiens - Contributeurs Wikipédiens - Contributeurs Wikipédiens - Contributeurs
   1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74  
  toutes les langues allemand français portuguais suédois arabe finnois thaï hébreu grec bulgare catalan lituanien slovène serbo-croate armenian tamil basque espéranto norvégien (nynorsk) urdu telugu cebuano kannada scots  luxembourgish
  anglais espagnol chinois polonais tchèque coréen turc vietnamien norvégien roumain croate estonien hindî malais letton azéri bengali belarusian macédonien marathi uzbek islandais mongolian gallois nepali  
    russe japonais italien néerlandais farsi indonésien ukrainien hongrois danois serbe simple english slovaque kazakh tagalog géorgien bosniaque afrikaans albanais galicien cantonese malayalam latin egyptian arabic breton min nan
aoüt 2017                                                                                                                                     15827   20577   20119   21374   11161   16090   19972   15939    8380    9207   14541   16007   17464    9448    8832    9234    6892    7683    5119    5838   13759    4131    4522    3890    2467    1474    5692    2588      865              2001    1599    2580    3045    1121    2426    2283      833    1998    1201    1634    2689    1777    2088    1276      901    1541      760      363    1723    1157    1356    1483      355      743      324      992      654      550      301      469      181      616
 juil 2017239257011639898519416840812705294947126122525767031042794367833661723380157742033319966212401107016041199441583983209118144861594117417941887949202685376515098581313724411344963869243914635668254185710531991159325293020111524082260828199211911626268017712080127089615227463561713115313521480340741321985647545298464178610
juin 2017238120111590908477816796912642494454125549521516997742603366923647023299157162004619823211001098815996199061573882679038144321584517378939287459164680776165071578113662409544703850239814545654251385210481982158724842980111119202235823198611741614267217662073126789214937413511697114813481474334736315981640542295458174607
mai 2017236983111541708437216750112577293892124927517636965542418365613635723228156451977319680209421090115954198671559782028947143751572317337936986919123676075575054574913599408044353839237414485641249684710401974157924352908110617202213822197011691607266217562063126488314737343501680114313451466324736314976631541293451174603
avr 2017235703811482928388516702512505693330124218514086928142206364313619423140155731954219525207981081215900198401538781248853142801558517293933486279087666875215036571813495403244183819234714425616247583910311963156923882826110416702189810194611571596265217472049126187514447263501664114013401456315729312972626541292449171603
Progression              1%1%1%1%  1%1%1% 1%  1% 1%1% 1% 1%1% 1%1% 1%1%   2%2% 10%1%1%1%1%1%    1%2%1%1%1%   3% 1%1%1% 1%1%1%1%
 Javascript not available or not active. Charts can not be shown. 
Articles - Base de données - Liens - Utilisations par jour   «    »
Wikipédiens - Nouveaux wikipédiens Wikipédiens - Nouveaux wikipédiens Wikipédiens - Nouveaux wikipédiens Wikipédiens - Nouveaux wikipédiens
aoüt 2017                                                                                                                                         53      244      153      134       91       49       28      100       60       89       55       66       47       30       38       32       39       32       21       25       35       18       26       21       28       11       24       47         8                 10         6       51       25         6       18       23         5         6       10         8         9         6         8         6         5       19       14         7       10         4         4         3       15         2         3         7         7         5         3         5         3         6
 juil 201711369489941643962849357342533319191147815828714314082453810153805496392649384635273262182619419142855964540448825561712857342955165466564733643
juin 20171137049204064686525626223883221851311137171273143158874239141659157122412354414759173263153511246131758884972520022116571010103920711753810 159127 4
mai 2017127935878487476716562709355374212130163887223115514489542721078949513844356436923618311044817202762521891110478225024122412111091438298 16351097245 123 
avr 2017132516157486484716566791416369317131163847824120313687641271578169691065150584348332530705628173311239911613385131437139111110815618209414413581413211533
 Javascript not available or not active. Charts can not be shown. 
Articles - Base de données - Liens - Utilisations par jour   «    »
Wikipédiens - Wikipédiens actifs Wikipédiens - Wikipédiens actifs Wikipédiens - Wikipédiens actifs Wikipédiens - Wikipédiens actifs
aoüt 2017                                                                                                                                        518      961      756      676      405      412      210      741      326      402      440      668      347      212      240      184      223      252      126      118      343      122      140       95      120       38       96      133       32                 69       50      240      171       34      128      142       35       52       74       43       91       39       80       36       43      103       48       19       66       43       16       24       30       14       10       29       36       17       12       37       15       22
 juil 2017 295253247461838263443439226472428119012011117625530994714655435404202742348381446700297208266179233230125128367105121861232490104303974652412213379814437587753823774332810739137847143727171330401511271420
juin 2017 29057320046343802344045732481236611631212107561252396361769337639619779335738244875631118926520425125012311541010414080114298779273571692402753142811432786036784287304087381183471834281292937177231320
mai 201771966315473300488340053682464524542479124412541109673564866676673423440203985392417504815344209308210346220135128489197121881194111281333777672092573216113345998352874999353097391482421841252682328138181018
avr 201771735317773313484838533612474224552365129012091063663541847753661471435565855366347450665373210278190241207126113417201123871174210474313383851991742988152241018550824084357479391682403633303592325156261623
Progression             -1%3%1%1%-3%-1%-15%-3%-3%4% 1%-1%1%-3% 1%5% 2%-4%-8%4%3%1%3%-1%17%2% -4%-12%5%3%4%62% 18%-15%-1%1%3%1% 1%-1%8%6%8%-5%2%-15%-5%1%-14% 6%10%5% 13%  
 Javascript not available or not active. Charts can not be shown. 
Articles - Base de données - Liens - Utilisations par jour   «    »
Wikipédiens - Wikipédiens très actifs Wikipédiens - Wikipédiens très actifs Wikipédiens - Wikipédiens très actifs Wikipédiens - Wikipédiens très actifs
aoüt 2017                                                                                                                                         88      116      122       98       45       97       45      160       45       45       95      138       69       38       42       30       48       47       17       11       71       27       13       14       14         4       15       15         8                 14       14       45       37         7       27       21       11       23       19         6       15         9       22         8         5       12       10                   7       14         2         7         2         2         4         3       12         9         2         2         5         5
 juil 2017 342659473053327275738635817624318610693106104110478441138485610014163374532444418168428181517515145417184650674201019207181122971212 1112291734852434
juin 2017 33795587285292627533673371702271849910310095100477639142415296132673442334235201677261414215131646121645544322212152151814249891011214382 13662345
mai 201710476349857977054929276535936616926719110910283113103558748164525510113369315232423418137427191520314165515203049112421141322419132157161221318392424542427
avr 20171041834695417855183037573573711842561821169710411611549737615454471071236933563140421414743020142351416561824303571722101828417122668121021714393436642324
Progression             -2%4%2%-4%-2%8%-10%2%-3% -3%3% 4%-6%-1%5%4%6%-4%-1%-2%-7% -11% 2%-1%  -3%-12%12%4% 36%-1% 9%-9% -3% -3%      2%            
 Javascript not available or not active. Charts can not be shown. 
Wikipédiens - Base de données - Liens - Utilisations par jour   «    »
Articles - Nombre d'articles (officiel) Articles - Nombre d'articles (officiel) Articles - Nombre d'articles (officiel) Articles - Nombre d'articles (officiel)
aoüt 2017                                                                                                                                     388 K   573 K   538 K   396 K   410 K   420 K   297 K   717 K   119 K   1,2 M   415 K   211 K   474 K   231 K   136 K   377 K   355 K   233 K   177 K   127 K   553 K   160 K   219 K   183 K   123 K   224 K   157 K   304 K    81 K              79 K   117 K   229 K   126 K    75 K   121 K    52 K    47 K   283 K   146 K    74 K   241 K    91 K   140 K   134 K    49 K    57 K   125 K   129 K    53 K    67 K    44 K   127 K   5,2 M    20 K    17 K    22 K    92 K    63 K    47 K    33 K   220 K    50 K
 juil 201745,7 M5,4 M1,4 M2,1 M1,3 M1,1 M1,9 M955 K1,4 M971 K1,2 M1,9 M3,8 M386 K570 K533 K392 K408 K418 K296 K708 K118 K1,2 M413 K210 K472 K230 K134 K377 K354 K232 K177 K127 K550 K159 K219 K182 K123 K223 K157 K302 K75 K440 K78 K117 K226 K125 K75 K120 K52 K46 K282 K145 K72 K241 K90 K140 K134 K49 K56 K124 K129 K53 K67 K44 K127 K4,9 M20 K17 K22 K92 K63 K46 K33 K219 K50 K
juin 201745,4 M5,4 M1,4 M2,1 M1,3 M1,1 M1,9 M948 K1,4 M968 K1,2 M1,9 M3,8 M384 K554 K526 K387 K406 K416 K294 K702 K118 K1,2 M412 K208 K471 K227 K132 K376 K353 K231 K175 K126 K546 K159 K218 K182 K122 K223 K157 K295 K72 K439 K78 K116 K224 K123 K75 K108 K51 K46 K281 K144 K72 K240 K90 K139 K134 K48 K55 K124 K129 K52 K67 K43 K127 K4,8 M19 K17 K22 K91 K62 K46 K33 K216 K50 K
mai 201744,9 M5,4 M1,4 M2,1 M1,3 M1,1 M1,9 M943 K1,4 M965 K1,2 M1,9 M3,8 M381 K543 K521 K383 K405 K414 K293 K697 K117 K1,2 M410 K206 K469 K226 K131 K375 K351 K231 K174 K125 K544 K158 K218 K182 K122 K223 K156 K294 K70 K439 K77 K116 K221 K119 K75 K104 K51 K45 K280 K144 K71 K240 K90 K139 K133 K48 K54 K123 K129 K51 K67 K43 K127 K4,6 M19 K17 K22 K91 K62 K45 K33 K212 K49 K
avr 201744,5 M5,4 M1,4 M2,1 M1,3 M1,1 M1,9 M939 K1,4 M962 K1,2 M1,9 M3,8 M379 K538 K517 K380 K402 K413 K291 K691 K116 K1,2 M408 K205 K466 K225 K130 K375 K348 K230 K174 K124 K541 K157 K218 K182 K121 K223 K156 K289 K68 K439 K77 K115 K219 K117 K74 K101 K50 K45 K280 K143 K71 K239 K90 K138 K133 K48 K53 K123 K129 K51 K67 K42 K126 K4,3 M19 K17 K22 K91 K62 K45 K33 K205 K49 K
Progression             1%2%1%1%1% 1%1%1%  1% 1%1%   1%1%1%1%     1%4% 1% 1%2% 5%1%1%  1%    1%2%1% 1% 1% 4%1%1%   1% 2%1%
 Javascript not available or not active. Charts can not be shown. 
Wikipédiens - Base de données - Liens - Utilisations par jour   «    »
Articles - Nombre d'articles (alternatif) Articles - Nombre d'articles (alternatif) Articles - Nombre d'articles (alternatif) Articles - Nombre d'articles (alternatif)
 Javascript not available or not active. Charts can not be shown. 
Wikipédiens - Base de données - Liens - Utilisations par jour   «    »
Articles - Nouveaux articles par jour Articles - Nouveaux articles par jour Articles - Nouveaux articles par jour Articles - Nouveaux articles par jour
aoüt 2017                                                                                                                                         70      109      141      140       66       75       47      290       19       29       60       48       56       28       68       26       34       34       21       20      110       27       11         9       21         7       17       82      216                 14       13       97       41       13       28       18       15       31       21       57       19         7       17         6       11       31       31         1         7         4         2         4    7330         4         5         3       19       12       19         3       36         4
 juil 20171036567122229919013430120524099148777972505242158666463182193651525297371848355131102261411156822693915165769438520212518282210171383919116346392895368135907
juin 201714317646229276185122307164223921398276753791641105152431632347545763263728652628279033118179717551313211231272135181833212622101915111815139630585223148820415812
mai 2017135916682022732031282891432379317995598815312411997594018630376158832635218032221982331172110111765412101943791410419162326721102089411621575574124336613321219
avr 201712723731226307202123299191240121144917566454264100146557317626266345642735194031262190331492813262338141735524414258211122598211124121823561335646564763663432110
Progression             3%8%-4%11%-13%9%-4%16%-6%6%-1%3%-1%50%23%13%7%4%9%3%5%-4%-4% -4%  439%62%  -20%45%13% 16%-3%12%12%-18% -2% -8%  30%3%     15%       197% 
 Javascript not available or not active. Charts can not be shown. 
Wikipédiens - Base de données - Liens - Utilisations par jour   «    »
Articles - Rédactions par article Articles - Rédactions par article Articles - Rédactions par article Articles - Rédactions par article
aoüt 2017                                                                                                                                         28    23,2    29,5    35,2    21,7    29,2    42,1    20,8    41,2       17    29,6    57,6    28,9    28,6    35,6    19,8    35,4    26,9       21    29,5    28,1    22,1    21,6    22,7    17,1         8    22,2      9,9    15,6              24,4    18,9    18,1    20,5    22,6       14    32,6    26,6    15,2       14    16,9    20,6    19,4    24,8    16,2    21,4    13,6    12,1    11,2    25,5       24    25,1    20,5      2,8    16,8    26,6    18,6    28,4    21,2      7,9    12,2      5,8    31,1
 juil 2017 95,743,14857,545,550,131,547,431,729,919,58,8282329,43521,729,24220,941,11729,557,428,828,63619,834,226,821,129,528,222,121,622,717,1822,39,916,990,324,418,918,220,522,61432,726,715,213,917,220,619,424,716,221,413,712,111,225,623,825,120,52,816,826,718,525,721,17,912,25,730,8
juin 2017 95,543,14857,345,450,131,447,231,629,919,48,82823,229,43521,629,242,120,94116,929,557,228,628,836,119,633,326,821,229,628,222,121,622,717,1822,21017,490,424,518,718,120,722,615,132,626,815,213,917,420,619,424,716,321,413,81211,225,723,625,120,52,91726,918,523,721,27,912,25,630,8
mai 2017 95,2434857,245,35031,247,231,629,819,38,72823,429,33521,729,24220,940,916,929,556,928,628,836,119,53026,721,229,728,222,121,622,717822,29,917,890,524,518,618,221,122,615,532,72715,113,917,520,619,424,516,321,413,91211,226,123,325,620,531726,918,522,521,2812,25,531
avr 2017 94,942,947,95745,35031,14731,529,819,38,62823,429,33521,729,241,920,840,916,929,456,828,628,835,619,52926,721,229,728,222,121,622,617822,210,118,190,524,518,618,121,322,715,832,927,115,113,817,520,719,424,416,321,414,11211,226,223,125,720,5317,126,918,521,121,2812,25,731,2
Progression                             5%          -1%-4%    -1% -3%    -1%     -1%  -1%1%-1% -2%   8%     
 Javascript not available or not active. Charts can not be shown. 
Wikipédiens - Base de données - Liens - Utilisations par jour   «    »
Articles - Octets par article Articles - Octets par article Articles - Octets par article Articles - Octets par article
 Javascript not available or not active. Charts can not be shown. 
Wikipédiens - Base de données - Liens - Utilisations par jour   «    »
Articles - Articles de plus de 0.5 Ko Articles - Articles de plus de 0.5 Ko Articles - Articles de plus de 0.5 Ko Articles - Articles de plus de 0.5 Ko
 Javascript not available or not active. Charts can not be shown. 
Wikipédiens - Base de données - Liens - Utilisations par jour   «    »
Articles - Articles de plus de 2 Ko Articles - Articles de plus de 2 Ko Articles - Articles de plus de 2 Ko Articles - Articles de plus de 2 Ko
 Javascript not available or not active. Charts can not be shown. 
Wikipédiens - Articles - Liens - Utilisations par jour   «    »
Base de données - Rédactions par mois Base de données - Rédactions par mois Base de données - Rédactions par mois Base de données - Rédactions par mois
aoüt 2017                                                                                                                                      49 K   181 K   203 K   248 K    47 K    55 K    80 K   114 K    36 K   101 K    87 K   127 K    74 K    24 K    30 K    21 K   451 K    50 K   8,8 K    25 K    70 K    20 K   9,1 K    11 K    12 K   2,5 K   8,4 K    29 K    10 K             9,6 K   7,8 K    36 K    19 K   4,2 K    11 K    15 K    11 K    18 K    29 K   7,4 K   8,7 K   4,3 K    17 K   3,8 K   6,9 K   6,9 K    18 K      643   3,5 K    16 K   1,4 K   3,9 K   257 K   1,3 K   2,0 K   2,0 K   265 K   8,8 K   2,5 K   1,5 K    21 K    21 K
 juil 201710,2 M3,3 M403 K474 K533 K242 K554 K318 K495 K178 K187 K180 K303 K61 K245 K234 K161 K49 K55 K57 K109 K38 K48 K62 K130 K136 K37 K29 K67 K381 K30 K14 K14 K76 K19 K9,6 K11 K11 K1,8 K5,9 K31 K6,7 K3,4 K6,9 K23 K53 K24 K3,4 K47 K23 K9,6 K13 K11 K5,9 K8,4 K4,0 K24 K4,4 K8,5 K7,5 K12 K5146,4 K15 K1,3 K5,5 K162 K1,8 K2,0 K3,1 K189 K3,6 K2,2 K1,5 K48 K3,1 K
juin 201710,9 M3,6 M402 K493 K535 K236 K536 K294 K366 K143 K184 K128 K304 K62 K130 K180 K125 K32 K44 K71 K108 K36 K57 K54 K162 K64 K32 K28 K50 K1,2 M30 K10 K15 K92 K17 K9,6 K11 K17 K2,0 K14 K22 K6,5 K3,7 K6,4 K23 K50 K30 K2,1 K21 K13 K8,7 K25 K9,4 K5,0 K11 K4,5 K29 K5,7 K4,9 K5,4 K11 K4608,5 K23 K1,8 K5,5 K304 K8386251,9 K113 K2,9 K3,3 K1,5 K34 K2,7 K
mai 201710,7 M3,4 M416 K499 K616 K249 K601 K273 K669 K142 K193 K120 K191 K70 K115 K130 K121 K42 K52 K95 K201 K44 K79 K64 K120 K54 K23 K111 K30 K426 K32 K15 K14 K81 K20 K10 K10 K14 K2,6 K8,6 K18 K4,8 K32 K6,7 K12 K36 K28 K4,4 K17 K11 K7,2 K14 K22 K2,9 K9,5 K6,7 K37 K4,4 K5,3 K7,4 K9,8 K6336,9 K18 K1,7 K5,5 K661 K1,4 K1,3 K2,1 K129 K2,2 K2,4 K1,7 K12 K8,2 K
avr 201710,2 M3,3 M406 K518 K637 K267 K685 K264 K370 K164 K181 K112 K252 K57 K195 K186 K114 K107 K45 K142 K117 K39 K73 K58 K91 K53 K47 K33 K24 K145 K33 K9,3 K13 K76 K18 K12 K12 K14 K2,9 K9,1 K15 K4,6 K4,2 K8,2 K20 K35 K23 K4,1 K29 K24 K5,7 K11 K15 K3,4 K8,8 K6,3 K20 K3,6 K6,1 K6,4 K12 K8967,7 K12 K2,2 K4,8 K672 K2,1 K1,3 K2,5 K129 K2,1 K6,8 K1,5 K29 K3,0 K
Moyenne8,4 M2,7 M325 K395 K463 K198 K473 K229 K380 K125 K149 K108 K209 K60 K173 K187 K154 K55 K50 K89 K130 K39 K72 K65 K126 K77 K32 K47 K38 K521 K35 K11 K16 K79 K19 K10 K11 K13 K2,4 K9,2 K23 K6,6 K8,7 K7,6 K17 K42 K25 K3,6 K25 K17 K8,4 K16 K17 K4,9 K9,2 K5,2 K25 K4,4 K6,4 K6,7 K12 K6296,6 K17 K1,7 K5,0 K410 K1,5 K1,5 K2,3 K166 K3,9 K3,4 K1,6 K29 K7,8 K
Progression             -3%9%6%23%-9%6%-9%8%-1%19%13%11%22%-8%42%14%81%14%6%21%-2%4%-6%-2%-2%-1%10%20%24% 6%-3%4%-2%11%7%1%17%22%45%25% -8%4%4%9%5%12%-5%-14%11%-10%-3%-11%4%42% 24%51%-12%-1%25%180%
 Javascript not available or not active. Charts can not be shown. 
Wikipédiens - Articles - Liens - Utilisations par jour   «    »
Base de données - Taille de la base de données Base de données - Taille de la base de données Base de données - Taille de la base de données Base de données - Taille de la base de données
K=Ko, M=Mo Σenrudeesjafrzhitptplnlsvcsfaarkoidfitrukthvihuhenodaelrosrbghrsimplecaetsklthikkslmstlshlvkahyazbstabnafeubesqeomkglnnmrzh_yueuruzmlteislacebmnarzkncybrsconezh-min-nanlb
 Javascript not available or not active. Charts can not be shown. 
Wikipédiens - Articles - Liens - Utilisations par jour   «    »
Base de données - Mots Base de données - Mots Base de données - Mots Base de données - Mots
 Javascript not available or not active. Charts can not be shown. 
Wikipédiens - Articles - Base de données - Utilisations par jour   «    »
Liens - Liens internes Liens - Liens internes Liens - Liens internes Liens - Liens internes
 Javascript not available or not active. Charts can not be shown. 
Wikipédiens - Articles - Base de données - Utilisations par jour   «    »
Liens - Liens vers d'autres Wikipédias Liens - Liens vers d'autres Wikipédias Liens - Liens vers d'autres Wikipédias Liens - Liens vers d'autres Wikipédias
 Javascript not available or not active. Charts can not be shown. 
Wikipédiens - Articles - Base de données - Utilisations par jour   «    »
Liens - Images Liens - Images Liens - Images Liens - Images
 Javascript not available or not active. Charts can not be shown. 
Wikipédiens - Articles - Base de données - Utilisations par jour   «    »
Liens - Liens vers le Web Liens - Liens vers le Web Liens - Liens vers le Web Liens - Liens vers le Web
 Javascript not available or not active. Charts can not be shown. 
Wikipédiens - Articles - Base de données - Utilisations par jour   «
Liens - Redirections Liens - Redirections Liens - Redirections Liens - Redirections
aoüt 2017                                                                                                                                     247 K   1,5 M   470 K   336 K   443 K   244 K   241 K   417 K   139 K   200 K   189 K   173 K   269 K   141 K    68 K   496 K   809 K   112 K    51 K    52 K   361 K   117 K    65 K    81 K    46 K    43 K    66 K    48 K   100 K             103 K    38 K   317 K    34 K   100 K    37 K   172 K    22 K    78 K   188 K    22 K   165 K    42 K    56 K    78 K    41 K    42 K   192 K   316 K    75 K    25 K    25 K    53 K   2,6 M   6,2 K   7,3 K   6,7 K    45 K    20 K    13 K   5,0 K   209 K    12 K
 juil 201738,2 M7,9 M1,8 M1,4 M1,7 M650 K1,5 M755 K659 K748 K406 K692 K2,3 M245 K1,5 M462 K334 K439 K243 K240 K414 K138 K199 K187 K172 K267 K140 K67 K495 K613 K111 K51 K52 K359 K116 K65 K80 K46 K43 K66 K48 K100 K3,5 M100 K38 K317 K34 K100 K37 K172 K22 K77 K182 K22 K165 K42 K55 K77 K40 K42 K192 K316 K75 K25 K25 K52 K2,6 M6,1 K7,3 K6,7 K45 K20 K13 K5,0 K209 K12 K
juin 201738,1 M7,8 M1,8 M1,4 M1,7 M647 K1,5 M751 K656 K745 K405 K690 K2,3 M243 K1,5 M459 K329 K428 K242 K239 K412 K137 K198 K186 K171 K266 K139 K66 K495 K610 K111 K51 K52 K358 K116 K65 K80 K46 K43 K66 K48 K100 K3,5 M99 K37 K316 K34 K100 K36 K171 K22 K77 K181 K21 K165 K42 K55 K77 K40 K41 K191 K316 K74 K25 K24 K52 K2,6 M6,1 K7,2 K6,7 K45 K20 K13 K5,0 K208 K12 K
mai 201737,9 M7,8 M1,8 M1,4 M1,7 M645 K1,5 M746 K654 K743 K402 K689 K2,3 M241 K1,4 M457 K326 K427 K241 K238 K409 K136 K197 K186 K170 K264 K139 K66 K494 K609 K110 K50 K52 K356 K115 K64 K80 K46 K43 K66 K47 K100 K3,5 M99 K37 K313 K33 K100 K36 K171 K22 K76 K181 K21 K164 K42 K54 K77 K40 K40 K191 K316 K74 K25 K24 K52 K2,6 M6,1 K7,2 K6,6 K45 K20 K12 K5,0 K206 K12 K
avr 201737,6 M7,8 M1,8 M1,4 M1,7 M643 K1,4 M739 K652 K741 K400 K687 K2,3 M239 K1,4 M455 K322 K426 K239 K237 K407 K135 K196 K185 K169 K263 K138 K66 K493 K607 K110 K50 K51 K355 K114 K64 K80 K45 K43 K65 K47 K100 K3,5 M98 K37 K312 K33 K100 K36 K171 K22 K76 K181 K21 K164 K42 K54 K77 K39 K40 K191 K316 K74 K25 K24 K52 K2,4 M6,1 K7,2 K6,6 K45 K20 K12 K4,9 K203 K12 K
Progression             1%1%1%1%1%  1%1%  1%  1% 8% 1%  1%  1%  1%  1%  1% 1% 1%1%1%1%  1% 1%1%      2%  1%  1% 1%1%
 Javascript not available or not active. Charts can not be shown. 

Moyenne = nombre moyen durant les mois affichés = (30 x valeur[avr] + 31 x valeur[mai] + 30 x valeur[juin] + 31 x valeur[juil] + 31 x valeur[aoüt]) / 122

Progression = progression mensuelle moyenne durant les mois affichés = 100 * (31 x (valeur[mai] - valeur[avr]) / valeur[avr] + 30 x ...etc) / 153  (Wikipédias dont la valeur < 10 sont ignorés)

Wikipedias are ordered by hourly page views in recent days

Speakers: Number of speakers of a language is the estimated total of primary and secondary speakers, is in many cases a very rough estimation (based on the page on the English Wikipedia about that language)
Regions are parts of the world where the language is spoken in substantial amounts (compared to total number of speakers). Regions where a language gained presence only by a recent diaspora are generally not included.
Region codes: AF:Africa, AS:Asia, EU:Europe, NA:North America, OC:Oceania, SA:South America, W:World Wide, CL:Constructed Language

Généré le jeudi 21, septembre 2017 20:45 à partir des fichiers SQL du jeudi 31, aoû 2017

Auteur:Erik Zachte (Site Web)
Courriel:ezachte@### (no spam: ### =
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.