Estatísticas da Wikipédia choctaw
Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Articles per size range / Records per namespace / Most edited articles / Zeitgeist
 
Monthly counts & Quarterly rankings
 
DataWikipedistasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia		médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P____Q____R____S__
fev 20113   206 1016110  10 kb46419259(14)  
jan 20113   206 1016110  10 kb46419259(14)  
dez 20103   206 1016110  10 kb46419259(14)  
nov 20103   206 1016110  10 kb46419259(14)  
out 20103   206 1016110  10 kb46419259(14)  
set 20103   206 1016110  10 kb46419259(14)  
ago 20103   206 1016110  10 kb46419259(14)  
jul 20103   206 1016110  10 kb46419259(14)  
jun 20103   206 1016110  10 kb46419259(14)  
mai 20103   206 1016110  10 kb46419259(14)  
abr 20103   206 1016110  10 kb46419259(14)  
mar 20103   206 1016110  10 kb46419259(14)  
fev 20103   206 1016110  10 kb46419259(14)  
jan 20103   206 1016110  10 kb46419259(14)  
dez 20093   206 1016110  10 kb46419259(14)  
nov 20093   206 1016110  10 kb46419259(14)  
out 20093   206 1016110  10 kb46419259(14)  
set 20093   206 1016110  10 kb46419259(14)  
ago 20093   206 1016110  10 kb46419259(14)  
jul 20093   206 1016110  10 kb46419259(14)  
jun 20093   206 1016110  10 kb46419259(14)  
mai 20093   206 1016110  10 kb46419259(14)  
abr 20093   206 1016110  10 kb46419259(14)  
mar 20093   206 1016110  10 kb46419259(14)  
fev 20093   206 1016110 110 kb46419259(14)  
jan 20093   206 9,916410 111 kb49120275(14)  
dez 20083   207 9,918110  11 kb54020275(14)6 
nov 20083   207 9,918110  11 kb54020275(14)6 
out 20083   207 9,918110  11 kb54020275(14)6 
set 20083   207 9,918110  11 kb54020275(14)6 
ago 20083   207 9,918110  11 kb54020275(14)6 
jul 20083   207 9,918110  11 kb54020275(14)6 
jun 20083   207 9,918110  11 kb54020275(14)6 
mai 20083   207 9,918110  11 kb54020275(14)6 
abr 20083   207 9,918110  11 kb54020275(14)6 
mar 20083   207 9,918110  11 kb54020275(14)6 
fev 20083   207 9,918110  11 kb54020275(14)6 
jan 20083   207 9,918110  11 kb54020275(14)6 
dez 20073   207 9,918110  11 kb54020275(14)6 
nov 20073 1 207 9,918110 1711 kb54020275(14)6 
out 2007315 186 10,118311 749,1 kb48019208(13)6 
set 20072   102 10,7102  14,6 kb1634101(8)6 
ago 20072   101 10,666   4,0 kb991101(7)1 
jul 20072 1 101 10,666  64,0 kb991101(7)1 
jun 2007211 82 12,5123  193,5 kb157438(6)6 
mai 20071   32 27306  62,1 kb146436(2)7 
abr 20071   32 25306  122,1 kb146435(2)7 
mar 20071   22 31,5374  131,5 kb124424(1)6 
fev 20071   22 25370  101,5 kb122424(1)6 
jan 20071   22 20370  11,5 kb122423( )6 
dez 20061   22 19,5370  21,4 kb122419( )6 
nov 20061   22 18,5370   1,3 kb122414( )6 
out 20061   22 18,5370  61,3 kb122414( )6 
set 20061   22 15,549250 12,0 kb156316( )23 
ago 20061   22 15363  21,3 kb121316( )6 
jul 20061   11 28332  1439 50 3( )  
jun 20061   22 13,5362  11,3 kb121315( )6 
mai 20061   22 1347550 11,7 kb158315( )6 
abr 20061   22 12,5362  51,3 kb121315( )6 
mar 20061   22 10362   1,3 kb121313( )6 
fev 20061   22 10362  21,3 kb121313( )6 
jan 20061 1 22 9362  51,3 kb121313( )6 
dez 20051   22 6,5370   2,0 kb1213106( )7 
nov 20051   22 6,5370   2,0 kb1213106( )7 
out 20051   22 6,5370   2,0 kb1213106( )7 
set 20051   22 6,5370  32,0 kb1213106( )7 
ago 20051   11 10376   1,6 kb681106( )7 
jul 20051   11 10376  11,6 kb681106( )7 
jun 20051   11 9376  31,6 kb681107( )7 
mai 20051   11 6225  41,5 kb25 106( )7 
abr 20051   11 2445   1,9 kb82 106( )9 
mar 20051   11 2445   1,9 kb82 106( )9 
fev 20051   11 2445   1,9 kb82 106( )9 
jan 20051   11 2445   1,9 kb82 106( )9 
dez 20041   11 2445   1,9 kb82 106( )9 
nov 20041   11 2445  11,9 kb82 106( )9 
out 20041   11 1445   1,8 kb77 106( )9 
set 200411  11 1445  11,8 kb77 106( )9 
 totalnovosediçõescontagemnovos
por dia		médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
 WikipedistasArtigosBase de dadosLigações

Counts for image links are based on keyword(s) found in the message file for this language: (Image).
Note that image links based on default keyword 'Image' and/or 'File' have been missed. This will be repaired on the next run.

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

Wikipedistas (usuários registrados)
A = Wikipedistas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikipedistas que editaram pelo menos dez vezes desde que chegaram
C = Wikipedistas que contribuíram cinco vezes ou mais este mês
D = Wikipedistas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Artigos que contêm pelo menos uma ligação interna e 200 caracteres de texto legível, não contando códigos wiki e html,
      ligações ocultas, etc.; títulos também não contam (outras colunas são baseadas no método oficial de contagem)
G = Novos artigos por dia no mês passado
H = Número médio de revisões por artigo
I = Tamanho médio dos artigos em bytes
J = Porcentagem de artigos com pelo menos 0,5 kb de texto legível (veja F)
K = Porcentagem de artigos com pelo menos 2 kb de texto legível (veja F)

Base de dados
L = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
M = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
N = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
O = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
P = Total de ligações para outras wikipédias
Q = Total de imagens apresentadas
R = Total de ligações para outros sítios
S = Total de páginas de redirecionamento
 

Edit activity levels of registered users and bots per group of namespaces

Namespaces: Articles = 0   Talk = 1,3,5,7,9,..   Other = 2,4,6,8,..

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 5  10  5  5  5  5  10  5 
fev 2011        
jan 2011        
dez 2010        
nov 2010        
out 2010        
set 2010        
ago 2010        
jul 2010        
jun 2010        
mai 2010        
abr 2010        
mar 2010        
fev 2010        
jan 2010        
dez 2009        
nov 2009        
out 2009        
set 2009        
ago 2009        
jul 2009        
jun 2009        
mai 2009        
abr 2009        
mar 2009        
fev 2009        
jan 2009        
dez 2008        
nov 2008        
out 2008        
set 2008        
ago 2008        
jul 2008        
jun 2008        
mai 2008        
abr 2008        
mar 2008        
fev 2008        
jan 2008        
dez 2007        
nov 2007111  1  
out 200751   2  
set 2007        
ago 2007        
jul 20071       
jun 200711      
mai 2007     111
abr 2007     21 
mar 2007     1 1
fev 2007        
jan 2007        
dez 2006        
nov 2006        
out 2006     1  
set 2006        
ago 2006        
jul 2006        
jun 2006        
mai 2006        
abr 2006        
mar 2006        
fev 2006        
jan 20061    1  
dez 2005        
nov 2005        
out 2005        
set 2005        
ago 2005        
jul 2005        
jun 2005        
mai 2005        
abr 2005        
mar 2005        
fev 2005        
jan 2005        
dez 2004        
nov 2004        
out 2004        
set 2004        

 

Distribuição de edições de artigos por wikipedistas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikipedistasEdições total
124100.0%127100.0%
3833.3%10179.5%
1028.3%5644.1%
3214.2%4636.2%

 

20 wikipedistas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesPrimeira ediçãoúltima edição
 posiçãototaldatadias
atrás		datadias
atrás
Kanon6917146mar 02, 20071458nov 11, 20071204
Drini210mar 29, 20071431out 08, 20071238
Johannes_Rohr39fev 12, 20071476mai 14, 20071385
Brenda_Xiong_Hmong_fucks_Drini!49out 08, 20071238out 08, 20071238
Brendahmong58out 02, 20071244out 02, 20071244
Jorunn68out 03, 20071243out 03, 20071243
Yegoyan76jul 01, 20071337set 09, 20071267
Benjamin85jan 13, 20061871jan 24, 20061860
Thogo93fev 12, 20071476fev 12, 20071476
Perkele103abr 24, 20071405abr 24, 20071405
Narek113jun 30, 20071338jun 30, 20071338
Jon_Harald_Søby122abr 17, 20061777abr 17, 20061777
Erwan_Jouon132mar 29, 20071431mar 29, 20071431
Az1568142mar 29, 20071431mar 29, 20071431
Tangotango152jun 13, 20071355jun 13, 20071355
?161set 22, 20042349set 22, 20042349
Angela171jun 09, 20052089jun 09, 20052089
Proofreader181abr 18, 20061776abr 18, 20061776
AAA191ago 05, 20061667ago 05, 20061667
Pill201out 30, 20061581out 30, 20061581

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 66 edições foram feitas por usuários anônimos, de um total de 200 edições ( 33e %)
  

3 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesPrimeira ediçãoúltima edição
 posiçãototaldatadias
atrás		datadias
atrás
SieBot15nov 14, 20071201nov 14, 20071201
Thijs!bot21dez 17, 20061533dez 17, 20061533
Escarbot31mai 30, 20071369mai 30, 20071369

 

Artigos que contêm pelo menos uma ligação interna e .. caracteres de texto legível, não contando códigos wiki e html,
ligações ocultas, etc.; títulos também não contam  (excluindo páginas de redirecionamento)

DataArtigos
 < 32 ch< 64 ch< 128 ch< 256 ch< 512 ch< 1 k ch< 2 k ch< 4 k ch< 8 k ch< 16 k ch< 32 k ch< 64 k ch
fev 201150.0%60.0%70.0%70.0%90.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
jan 201150.0%60.0%70.0%70.0%90.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
dez 201050.0%60.0%70.0%70.0%90.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
nov 201050.0%60.0%70.0%70.0%90.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
out 201050.0%60.0%70.0%70.0%90.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
set 201050.0%60.0%70.0%70.0%90.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
ago 201050.0%60.0%70.0%70.0%90.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
jul 201050.0%60.0%70.0%70.0%90.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
jun 201050.0%60.0%70.0%70.0%90.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
mai 201050.0%60.0%70.0%70.0%90.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
abr 201050.0%60.0%70.0%70.0%90.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
mar 201050.0%60.0%70.0%70.0%90.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
fev 201050.0%60.0%70.0%70.0%90.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
jan 201050.0%60.0%70.0%70.0%90.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
dez 200950.0%60.0%70.0%70.0%90.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
nov 200950.0%60.0%70.0%70.0%90.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
out 200950.0%60.0%70.0%70.0%90.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
set 200950.0%60.0%70.0%70.0%90.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
ago 200950.0%60.0%70.0%70.0%90.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
jul 200950.0%60.0%70.0%70.0%90.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
jun 200950.0%60.0%70.0%70.0%90.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
mai 200950.0%60.0%70.0%70.0%90.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
abr 200950.0%60.0%70.0%70.0%90.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
mar 200950.0%60.0%70.0%70.0%90.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
fev 200950.0%60.0%70.0%70.0%90.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
jan 200950.0%60.0%65.0%70.0%90.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
dez 200850.0%60.0%65.0%65.0%90.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
nov 200850.0%60.0%65.0%65.0%90.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
out 200850.0%60.0%65.0%65.0%90.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
set 200850.0%60.0%65.0%65.0%90.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
ago 200850.0%60.0%65.0%65.0%90.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
jul 200850.0%60.0%65.0%65.0%90.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
jun 200850.0%60.0%65.0%65.0%90.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
mai 200850.0%60.0%65.0%65.0%90.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
abr 200850.0%60.0%65.0%65.0%90.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
mar 200850.0%60.0%65.0%65.0%90.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
fev 200850.0%60.0%65.0%65.0%90.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
jan 200850.0%60.0%65.0%65.0%90.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
dez 200750.0%60.0%65.0%65.0%90.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
nov 200750.0%60.0%65.0%65.0%90.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
out 200750.0%61.1%66.7%66.7%88.9%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
set 200760.0%70.0%80.0%80.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
ago 200760.0%70.0%90.0%90.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
jul 200760.0%70.0%90.0%90.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
jun 200750.0%62.5%75.0%75.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
mai 20070.0%0.0%33.3%33.3%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
abr 20070.0%0.0%33.3%33.3%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
mar 20070.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
fev 20070.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
jan 20070.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
dez 20060.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
nov 20060.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
out 20060.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
set 20060.0%0.0%0.0%0.0%50.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
ago 20060.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
jul 20060.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
jun 20060.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
mai 20060.0%0.0%0.0%0.0%50.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
abr 20060.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
mar 20060.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
fev 20060.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
jan 20060.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
dez 20050.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
nov 20050.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
out 20050.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
set 20050.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
ago 20050.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
jul 20050.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
jun 20050.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
mai 20050.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
abr 20050.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
mar 20050.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
fev 20050.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
jan 20050.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
dez 20040.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
nov 20040.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
out 20040.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
set 20040.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1		Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110GifJpg
fev 2011217552110 6      10%11
jan 2011217552110 6      10%11
dez 2010217552110 6      10%11
nov 2010217552110 6      10%11
out 2010217552110 6      10%11
set 2010217552110 6      10%11
ago 2010217552110 6      10%11
jul 2010217552110 6      10%11
jun 2010217552110 6      10%11
mai 2010217552110 6      10%11
abr 2010217552110 6      10%11
mar 2010217552110 6      10%11
fev 2010217552110 6      10%11
jan 2010217552110 6      10%11
dez 2009217452110 6      10%11
nov 2009217452110 6      10%11
out 2009217452110 6      10%11
set 2009217452110 6      10%11
ago 2009217452110 6      10%11
jul 2009217452110 6      10%11
jun 2009217452110 6      10%11
mai 2009217452110 6      10%11
abr 2009217452110 6      10%11
mar 2009217452110 6      10%11
fev 2009217252110 6      10%11
jan 2009217252110 6      10%11
dez 2008217252110 6      10%11
nov 2008217252110 6      10%11
out 2008217252110 6      10%11
set 2008217252110 6      10%11
ago 2008217252110 6      10%11
jul 2008217252110 6      10%11
jun 2008217252110 6      10%11
mai 2008217252110 6      10%11
abr 2008217252110 6      10%11
mar 2008217252110 6      10%11
fev 2008217252110 6      10%11
jan 2008217252110 6      10%11
dez 2007217252110 6      10%11
nov 2007217252110 6      10%11
out 200719705219 4      11%11
set 200711654117 4      10% 1
ago 200711624117 4      10% 1
jul 200711624117 4      10% 1
jun 20079604117 4      12% 1
mai 200735941 7 4      33% 1
abr 200735641 3 4      33% 1
mar 20072493  3 4      50%  
fev 20072403  3 4      50%  
jan 20072372  3 4      50%  
dez 20062362  3 4      50%  
nov 20062322  3 4      50%  
out 20062312  3 4      50%  
set 20062232  3 3      50%  
ago 20062232  3 3      50%  
jul 20062212  3 3      100%  
jun 20062202  3 3      50%  
mai 20062192  2 2      50%  
abr 20062192  2 2      50%  
mar 20062172  2 2      50%  
fev 20062152  2 2      50%  
jan 20062152  2 2      50%  
dez 2005210     2      50%  
nov 200529     2      50%  
out 200525     2      50%  
set 200524     2      50%  
ago 200514     1      0%  
jul 200514     1      0%  
jun 200514               
mai 200513               
abr 200513               
mar 200511               
fev 200511               
jan 200511               
dez 200411               
nov 200411               
out 20041                
set 20041                

 

2 most edited articles (> 25 edits)
 

EdiçõesUnique usersArtigosArchived
TotalReg.Reg.Unreg.
5258%1518Main Page< 1 Mb  
4641%1226Chahta Anumpa< 1 Mb  

 

ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

set 2004: 1 1 Main Page

jun 2005: 1 1 Main Page

jan 2006: 1 1 Chahta Anumpa

abr 2006: 1 2 Chahta Anumpa

ago 2006: 1 1 Main Page

out 2006: 1 1 Main Page

fev 2007: 1 2 Main Page , 2 1 Chahta Anumpa

mar 2007: 1 3 Chahta Anumpa

abr 2007: 1 2 Cthulhu

mai 2007: 1 1 Chahta Anumpa

jun 2007: 1 2 Issi Kosoma , 2 1 Shaui

jul 2007: 1 1 Hattak

set 2007: 1 1 Main Page

out 2007: 1 5 Hattak , 2 5 Ohoyo , 3 5 Piki vba , 4 1 Aiʊlhepiesa Makosh Ʊlhpisa

nov 2007: 1 1 Chenesis

jan 2009: 1 1 Main Page

fev 2009: 1 1 Main Page

Wikipedias are initially ordered by number of speakers of the language

Speakers: Number of speakers of a language is the estimated total of primary and secondary speakers, is in many cases a very rough estimation (based on the page on the English Wikipedia about that language)
Regions are parts of the world where the language is spoken in substantial amounts (compared to total number of speakers). Regions where a language gained presence only by a recent diaspora are generally not included.
Region codes: AF:Africa, AS:Asia, EU:Europe, NA:North America, OC:Oceania, SA:South America, W:World Wide, CL:Constructed Language

Estatísticas geradas em Segunda-feira, 4 de abril 2011 a partir de cópias do banco de dados SQL de Quinta-feira, 31 de março 2011
Versão do script:2.6
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.