Estatísticas da Wikipédia galego

Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Articles per size range / Records per namespace / Most edited articles / Zeitgeist
  Dec 2017: WMF Analytics Team is happy to announce the first release of Wikistats 2

  Wikistats has been redesigned for architectural simplicity, faster data processing, and a more dynamic and interactive user experience. The data used in the reports will also be made available for external processing.  

  First goal is to match the numbers of the current system, and to provide the most important reports, as decided by the Wikistats community (see survey).  
  Over time, we will continue to migrate reports and add new ones that you find useful. We can also analyze the data in new and interesting ways, and look forward to hearing your feedback and suggestions.  

  You can go directly to Wikipedia galego


Most metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.

Some metrics have been collected from the full archive dump which runs on lower frequency than the usual monthly cycle.
These metrics are columns F,I,J,K,M,N,O,P,Q,R from the first table.

See also metrics definitions

Monthly counts & Quarterly rankings: junho 2018
DataWikipedistasArtigosBase de dadosLigações
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
jun 20180% -21%-22%+1% +10%    -0%      +1%
mai 2018+1% +20%-3%+1% +4%    -18%      +1%
abr 2018+1% +3%+14%+1% -7%    -21%      +1%
mar 2018+1% +17%+12%+1% +7%    +79%      +1%
fev 2018+1% -5%-4%+1% +8%    -39%      +1%
jan 20180% +6%0%+1% -33%    +12%      +1%
jun 20182343119625149 k 3225,6   19 k      63 k
mai 201823322812132148 k 2925,6   19 k      62 k
abr 201823042510133148 k 2825,6   24 k      62 k
mar 20182279189829147 k 3025,6   30 k      61 k
fev 20182261138426146 k 2825,6   17 k      60 k
jan 2018224898827145 k 2625,6   27 k      60 k
dez 20172239128327144 k 3925,5   24 k      59 k
nov 20172227138224143 k 2525,6   23 k      58 k
out 20172214138125142 k 3025,6   19 k      57 k
set 2017220168226141 k 2225,6   46 k      56 k
ago 20172195138823141 k 1925,4   21 k      55 k
jul 20172182117926140 k 1425,3   26 k      55 k
jun 20172171119225140 k 1925,2   31 k      54 k
mai 201721601910823139 k 1925,1   39 k      54 k
abr 20172141209828138 k 2424,9   23 k      53 k
mar 20172121127825138 k 4424,9   48 k      53 k
fev 2017210997727136 k 3124,8   23 k      52 k
jan 20172100137729135 k 2724,8   28 k      52 k
dez 20162087158328135 k 2524,7   23 k      51 k
nov 2016207267528134 k 2624,7   24 k      50 k
out 20162066148127133 k 1924,7   31 k      50 k
set 2016205297726133 k 1624,5   23 k      49 k
ago 20162043126923132 k 2124,5   17 k      48 k
jul 20162031107626131 k 2324,5   27 k      48 k
jun 2016202188125131 k 1724,4   19 k      47 k
mai 20162013109628130 k 1624,3   21 k      47 k
abr 201620032111531130 k 2624,3   53 k      46 k
mar 20161982199831129 k 2724   28 k      46 k
fev 20161963197624128 k 2723,9   16 k      45 k
jan 20161944149029127 k 2024   35 k      45 k
dez 2015193087523127 k 2423,8   17 k      44 k
nov 20151922138521126 k 1723,8   26 k      43 k
out 20151909148826125 k 1423,7   17 k      43 k
set 20151895117626125 k 2023,6   24 k      43 k
ago 20151884118022124 k 2123,6   24 k      42 k
jul 20151873106824124 k 2323,5   19 k      42 k
jun 20151863198724123 k 2323,5   20 k      41 k
mai 20151844159223122 k 1923,4   20 k      41 k
abr 201518293112923122 k 3123,4   19 k      40 k
mar 20151798158125121 k 2423,4   28 k      40 k
fev 20151783188822120 k 2123,3   14 k      39 k
jan 20151765107224119 k 2023,3   19 k      39 k
dez 20141755107422119 k 2623,3   18 k      38 k
nov 20141745199720118 k 2623,3   16 k      38 k
out 2014172697424117 k 2423,3   20 k      37 k
set 2014171797022116 k 2623,3   12 k      37 k
ago 20141708107422116 k 2523,3   13 k      36 k
jul 20141698116926115 k 2823,4   16 k      36 k
jun 20141687198520114 k 2923,4   13 k      35 k
mai 20141668199529113 k 3123,5   27 k      35 k
abr 20141649128428112 k 2723,4   21 k      35 k
mar 201416372710827111 k 2923,4   18 k      34 k
fev 20141610139130111 k109 k3223,5234377%33%16 k369 Mb46,2 M2,8 M15 k6,0 k182 k34 k
jan 201415971610028110 k108 k3623,5233677%33%21 k365 Mb45,6 M2,8 M16 k6,0 k178 k33 k
dez 20131581117422108 k107 k2723,6233577%33%13 k359 Mb45,0 M2,8 M16 k6,1 k175 k33 k
nov 20131570147624108 k106 k3523,6233577%33%13 k356 Mb44,6 M2,8 M16 k6,2 k173 k33 k
out 20131556107826107 k105 k2023,7233677%33%13 k352 Mb44,1 M2,7 M16 k6,2 k171 k32 k
set 20131546137327106 k104 k2523,7233077%33%14 k348 Mb43,6 M2,7 M16 k6,0 k168 k32 k
ago 20131533117824105 k104 k3823,8232577%33%27 k344 Mb43,1 M2,7 M17 k6,0 k166 k31 k
jul 20131522126931104 k102 k3223,8232477%33%17 k339 Mb42,5 M2,6 M23 k5,7 k163 k31 k
jun 20131510116731103 k101 k2623,9231477%32%22 k334 Mb41,8 M2,6 M24 k5,5 k159 k30 k
mai 20131499118928102 k101 k2623,8232076%32%19 k329 Mb41,2 M2,6 M25 k5,3 k156 k30 k
abr 20131488199324101 k100 k2523,8230876%32%20 k324 Mb40,6 M2,5 M27 k4,9 k153 k29 k
mar 201314692012331101 k99 k4423,8230476%32%96 k320 Mb40,2 M2,5 M39 k4,6 k151 k29 k
fev 20131449451413299 k98 k7423,2231076%32%41 k360 Mb39,6 M2,5 M1,9 M3,9 k148 k28 k
jan 2013140418913097 k96 k7123,3231876%32%36 k354 Mb38,9 M2,4 M1,9 M2,8 k143 k28 k
dez 2012138615802695 k93 k6823,4233376%32%30 k347 Mb38,2 M2,4 M1,8 M2,3 k138 k27 k
nov 20121371281002893 k91 k5323,6234475%32%25 k340 Mb37,5 M2,3 M1,8 M2,0 k134 k26 k
out 2012134311832391 k90 k2723,8234775%32%29 k334 Mb36,9 M2,3 M1,8 M1,7 k130 k26 k
set 201213327692991 k89 k3223,7234175%32%35 k330 Mb36,4 M2,3 M1,8 M1,4 k127 k26 k
ago 2012132513722790 k88 k3323,5233575%32%34 k324 Mb35,8 M2,2 M1,8 M765124 k25 k
jul 201213126612789 k87 k3323,4233075%32%52 k319 Mb35,3 M2,2 M1,7 M587121 k25 k
jun 2012130614712987 k86 k5623,1232675%32%74 k314 Mb34,8 M2,2 M1,7 M444118 k24 k
mai 2012129214882486 k84 k3322,7233575%32%37 k308 Mb34,2 M2,1 M1,7 M396115 k24 k
abr 2012127832942485 k83 k3522,5233175%32%35 k303 Mb33,7 M2,1 M1,7 M223113 k24 k
mar 2012124626952884 k82 k3822,4232174%32%44 k297 Mb33,1 M2,1 M1,6 M119110 k23 k
fev 2012122014722583 k81 k3522,2231374%31%32 k291 Mb32,4 M2,1 M1,6 M829107 k23 k
jan 2012120615722982 k80 k5222,1230674%31%32 k286 Mb31,9 M2,0 M1,6 M712105 k22 k
dez 2011119114683180 k78 k7522,1230374%31%34 k279 Mb31,1 M2,0 M1,6 M492102 k22 k
nov 2011117712652378 k76 k3522,3231975%31%29 k272 Mb30,4 M1,9 M1,5 M39498 k21 k
out 2011116510682477 k75 k3022,3231574%31%38 k268 Mb29,9 M1,9 M1,5 M25696 k20 k
set 2011115511662076 k74 k3522230874%31%27 k263 Mb29,4 M1,9 M1,5 M17694 k20 k
ago 2011114415701975 k73 k3022230574%31%29 k258 Mb28,9 M1,8 M1,5 M2,7 k92 k20 k
jul 201111298532274 k72 k3221,8230374%31%27 k254 Mb28,4 M1,8 M1,5 M2,6 k90 k19 k
jun 2011112113722273 k71 k3721,8228274%30%27 k248 Mb27,7 M1,8 M1,4 M2,6 k87 k19 k
mai 2011110822791972 k70 k2321,7226474%30%23 k242 Mb27,1 M1,7 M1,4 M2,5 k84 k19 k
abr 2011108611601871 k69 k2821,6225074%30%22 k238 Mb26,6 M1,7 M1,4 M2,5 k82 k19 k
mar 2011107522852570 k68 k5121,6224774%30%31 k234 Mb26,2 M1,7 M1,4 M2,5 k80 k18 k
fev 2011105311692068 k67 k3821,6225174%30%22 k229 Mb25,6 M1,6 M1,4 M2,3 k78 k18 k
jan 2011104221742667 k66 k4221,6226074%30%31 k225 Mb25,3 M1,6 M1,3 M2,3 k76 k18 k
dez 201010219532066 k64 k4121,6226574%30%25 k221 Mb24,8 M1,6 M1,3 M2,2 k73 k17 k
nov 2010101217641965 k63 k3121,6228674%30%28 k217 Mb24,4 M1,6 M1,3 M2,2 k71 k17 k
out 201099515711864 k62 k2721,5229373%30%24 k214 Mb24,1 M1,5 M1,3 M2,3 k69 k17 k
set 20109808592063 k61 k3121,4230173%30%27 k211 Mb23,8 M1,5 M1,3 M2,5 k67 k16 k
ago 201097215761562 k60 k2921,3230773%30%26 k208 Mb23,5 M1,5 M1,2 M2,5 k66 k16 k
jul 201095721731661 k59 k2621,2231773%30%20 k205 Mb23,2 M1,5 M1,2 M2,6 k64 k16 k
jun 201093623872760 k58 k3521,1231773%30%30 k202 Mb22,8 M1,5 M1,2 M2,6 k63 k16 k
mai 201091311732459 k57 k3721231672%30%28 k197 Mb22,3 M1,4 M1,2 M2,5 k61 k15 k
abr 201090214832558 k56 k4621232072%30%31 k193 Mb21,9 M1,4 M1,2 M2,4 k59 k15 k
mar 201088826852157 k55 k3120,9232272%29%30 k187 Mb21,3 M1,3 M1,1 M2,2 k56 k14 k
fev 201086213662456 k54 k2920,7231172%29%26 k183 Mb20,8 M1,3 M1,1 M2,2 k53 k14 k
jan 201084918772255 k53 k3020,6231272%29%23 k179 Mb20,4 M1,3 M1,1 M2,2 k51 k13 k
dez 200983116752354 k52 k4320,5230472%29%23 k175 Mb19,9 M1,3 M1,1 M2,3 k50 k13 k
nov 200981515711953 k51 k3220,6230671%29%21 k170 Mb19,4 M1,2 M1,1 M2,2 k47 k13 k
out 200980014781652 k50 k1920,6230271%28%21 k166 Mb19,0 M1,2 M1,1 M2,4 k46 k13 k
set 200978622732051 k49 k2420,4230871%28%23 k164 Mb18,7 M1,2 M1,0 M2,4 k45 k12 k
ago 200976410651850 k48 k1520,2230870%28%21 k161 Mb18,4 M1,1 M1,0 M2,8 k43 k12 k
jul 200975411671950 k48 k2620230870%28%29 k159 Mb18,2 M1,1 M1,0 M2,9 k43 k12 k
jun 200974319861649 k47 k3619,7232168%28%24 k156 Mb17,8 M1,1 M983 k2,8 k42 k12 k
mai 2009724241001848 k46 k4519,7232768%28%23 k152 Mb17,4 M1,1 M961 k2,5 k41 k11 k
abr 200970020932147 k44 k4419,8235068%28%24 k148 Mb17,0 M1,0 M939 k2,5 k39 k11 k
mar 200968025731945 k43 k3219,8236268%28%33 k143 Mb16,5 M1,0 M914 k2,4 k38 k11 k
fev 200965515711444 k42 k3119,5237868%28%20 k140 Mb16,2 M990 k895 k2,3 k37 k10 k
jan 200964014761744 k41 k2419,5238668%28%23 k138 Mb15,9 M968 k882 k2,2 k36 k10 k
dez 200862613762243 k40 k4419,3237867%28%29 k135 Mb15,6 M948 k864 k1,9 k35 k10 k
nov 200861314671641 k39 k3819,2239367%29%21 k131 Mb15,2 M920 k849 k3,6 k33 k10,0 k
out 20085999661540 k38 k2719,2240367%29%21 k128 Mb14,8 M896 k832 k3,4 k32 k9,6 k
set 20085909671739 k37 k2019,1241367%29%17 k125 Mb14,6 M879 k814 k3,1 k32 k9,5 k
ago 200858112581639 k36 k2819241667%29%23 k123 Mb14,4 M866 k801 k3,0 k31 k9,3 k
jul 200856914671838 k35 k3318,8243068%29%33 k121 Mb14,1 M850 k783 k3,0 k30 k9,1 k
jun 200855512622337 k34 k5018,4243268%29%27 k118 Mb13,7 M825 k764 k2,7 k29 k8,9 k
mai 20085439591936 k33 k3218,5243868%29%26 k113 Mb13,2 M793 k744 k2,4 k28 k8,7 k
abr 200853412702034 k32 k2718,2244568%29%22 k110 Mb12,9 M770 k722 k2,2 k26 k8,5 k
mar 200852211742034 k31 k2618241968%28%23 k106 Mb12,4 M743 k702 k1,8 k25 k8,2 k
fev 200851112851933 k30 k3517,7240067%28%23 k103 Mb12,0 M719 k677 k1,3 k24 k8,0 k
jan 200849914852332 k29 k3917,6238667%28%22 k99 Mb11,6 M692 k650 k1,0 k23 k7,8 k
dez 200748521862831 k28 k3217,6237067%27%37 k94 Mb11,1 M661 k624 k50322 k7,5 k
nov 200746425892730 k27 k3816,9234167%27%77 k90 Mb10,6 M631 k587 k1,9 k20 k7,3 k
out 200743924831929 k26 k4014,9232266%27%31 k86 Mb10,1 M601 k544 k25 k19 k6,6 k
set 200741511702327 k25 k2914,4226966%26%27 k81 Mb9,5 M570 k514 k24 k17 k5,9 k
ago 200740419682526 k24 k3413,9216165%25%19 k75 Mb8,8 M526 k494 k22 k16 k5,6 k
jul 200738515771825 k23 k2513,7208864%24%18 k70 Mb8,2 M490 k474 k19 k15 k5,3 k
jun 200737017761625 k22 k3113,4200163%23%23 k66 Mb7,6 M455 k453 k18 k14 k5,1 k
mai 200735317801624 k21 k2812,9196562%23%24 k62 Mb7,2 M434 k435 k17 k13 k4,8 k
abr 200733619791723 k21 k2412,4191961%22%16 k59 Mb6,8 M411 k418 k16 k12 k4,4 k
mar 200731717641622 k20 k2212,1186460%22%21 k56 Mb6,4 M387 k402 k15 k12 k4,2 k
fev 200730015531121 k19 k1911,5180059%21%13 k52 Mb6,0 M366 k380 k14 k11 k4,0 k
jan 20072858541221 k19 k2311,2177458%20%18 k50 Mb5,7 M352 k365 k13 k10 k3,8 k
dez 200627713611720 k18 k3410,7174457%20%18 k48 Mb5,5 M336 k345 k13 k9,7 k3,6 k
nov 20062647571219 k17 k2510,3171856%20%15 k44 Mb5,1 M314 k319 k12 k8,9 k3,4 k
out 200625711631218 k16 k219,9169756%19%19 k42 Mb4,8 M299 k303 k11 k8,4 k3,2 k
set 200624612521118 k16 k209,2169355%19%21 k40 Mb4,6 M284 k282 k10 k8,0 k3,0 k
ago 200623418631017 k15 k238,3167555%18%13 k38 Mb4,4 M270 k262 k9,0 k7,5 k2,9 k
jul 20062166531016 k14 k247,9162054%18%12 k35 Mb4,1 M252 k246 k7,9 k6,9 k2,7 k
jun 20062105441216 k14 k177,5160554%18%9,3 k33 Mb3,8 M236 k218 k7,1 k6,6 k2,4 k
mai 200620521621015 k13 k167,1159153%17%9,2 k32 Mb3,7 M226 k204 k6,6 k6,3 k2,3 k
abr 200618422531015 k13 k286,7159052%17%8,1 k30 Mb3,5 M216 k182 k6,3 k6,0 k2,1 k
mar 20061628501014 k12 k426,5162953%17%6,9 k29 Mb3,4 M209 k172 k6,1 k5,7 k2,1 k
fev 20061541341812 k11 k326,7168457%18%7,5 k28 Mb3,2 M200 k164 k5,8 k5,5 k1,8 k
jan 20061416301012 k10 k426,5169258%18%6,6 k26 Mb3,0 M187 k154 k5,5 k4,9 k1,7 k
dez 200513510351010 k9,0 k166,7168561%18%5,8 k23 Mb2,7 M167 k138 k4,7 k4,3 k1,5 k
nov 2005125533109,8 k8,5 k256,5162960%17%5,7 k21 Mb2,5 M156 k132 k4,4 k3,9 k1,4 k
out 20051201032119,0 k7,7 k306,4154659%16%6,1 k19 Mb2,1 M137 k119 k4,0 k3,4 k1,3 k
set 200511073088,1 k6,9 k196,4142557%15%6,7 k16 Mb1,8 M115 k100 k3,4 k2,8 k1,2 k
ago 200510372357,6 k6,4 k265,9133055%14%6,1 k14 Mb1,5 M101 k88 k3,0 k2,5 k1,1 k
jul 20059692666,8 k5,7 k275,7122654%13%5,2 k12 Mb1,3 M85 k74 k2,5 k2,1 k985
jun 200587103145,9 k4,9 k195,7114452%12%2,9 k9,5 Mb1,0 M70 k61 k2,0 k1,6 k837
mai 200577102985,3 k4,4 k245,8112152%11%4,5 k8,5 Mb907 k61 k57 k1,5 k1,5 k727
abr 20056772394,6 k3,8 k265,7112653%11%5,4 k7,2 Mb780 k51 k44 k1,2 k1,2 k629
mar 20056021673,8 k3,1 k135,5114456%11%2,3 k6,1 Mb655 k43 k36 k9341,1 k394
fev 20055821463,4 k2,8 k145,4111155%10%3,1 k5,4 Mb568 k36 k34 k702889350
jan 20055632163,0 k2,3 k135,1106550%10%2,9 k4,6 Mb479 k31 k30 k635693324
dez 20045351972,6 k2,0 k234,894139%9%3,5 k3,6 Mb377 k25 k23 k485595309
nov 20044861551,9 k1,2 k164,893737%10%2,4 k2,5 Mb277 k18 k15 k268461197
out 2004423911,4 k92944,793238%10%8561,8 Mb207 k14 k7,9 k109326143
set 2004394721,3 k82724,585737%9%6361,5 Mb174 k13 k6,4 k94252135
ago 2004351411,3 k77734,278835%8%4621,3 Mb154 k11 k6,2 k80193123
jul 20043415 1,1 k69214,175033%8%2851,2 Mb134 k10 k5,5 k42182112
jun 200433716 1,1 k6583475033%8%4081,1 Mb128 k9,7 k3,5 k37176104
mai 2004263911,0 k59323,973132%8%3151,0 Mb115 k8,7 k3,3 k3016288
abr 200423916195453133,972430%8%369930 kb106 k7,7 k3,0 k2413284
mar 200414614186346783,972730%8%1,2 k836 kb95 k7,0 k2,5 k2311576
fev 2004813162529743,568724%7%463559 kb66 k4,4 k1,3 k177858
jan 2004736150624383,472125%8%1,2 k481 kb56 k3,5 k984126753
dez 20034 2 266121 259221%6%53199 kb22 k1,3 k176 5531
nov 20034113 25311931,957921%6%203186 kb21 k1,2 k107 5229
out 20033   1749311,760925%5%47140 kb15 k72697 921
set 20033 1 14889 1,669630%6%14136 kb15 k65497 918
ago 2003312 14185 1,671630%6%32133 kb14 k63697 818
jul 20032   12674 1,664229%5% 107 kb10 k47178 516
jun 20032   12674 1,664229%5% 107 kb10 k47178 516
mai 20032   12674 1,664229%5% 107 kb10 k47178 516
abr 20032 1 1267421,664229%5%87107 kb10 k47178 516
mar 2003221 724421,554729%4%10943 kb5,4 k32374 54
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternas

> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
The following table ranks this project in relation to projects in other languages with 1000+ articles
abr 20184738423047 3678   36      278
jan 20184656483647 4478   36      278
out 20174544473647 3879   46      278
jul 20174548463647 6180   39      278
abr 20174443423547 4884   39      278
jan 20174353503446 4285   39      278
out 20164350473346 5586   34      278
jul 20164348473446 5188   38      278
abr 20164142373246 4089   28      278
jan 20164151463645 5495   35      278
out 20154148413545 6098   44      278
jul 20154150473545 44103   39      278
abr 20154136373545 41106   42      278
jan 20154155493646 54106   41      278
out 20144153433747 49107   41      278
jul 20144148433347 42106   43      278
abr 20144153453447 52106   40      278
jan 20144051453645413710948764238473936399746278
out 20134052443444425010946754046463936409648278
jul 20134050443244414411348744042453936379647278
abr 201340454235444250116477440534539363810148277
jan 201340474332413927112427342474336344212545277
out 201240504035413949110397139504235344314645277
jul 201240604532413943110387135344235344119043277
abr 201240374035413934115376833404235354122343277
jan 201240484533423936112366534424236344117444277
out 201140564736424045108366133394336334121645277
jul 201139574937413845109365832454136344011244277
abr 201139504540413849110385432474237334011246277
jan 201139434436403739102355229443935344011344277
out 20103944414241384098355128413835333911044277
jul 20103938424341384191325127483835333910044277
abr 20103944393540383587325227443735343810244277
jan 20103939393940394382325130423736353810744277
out 20093943394040384878325232403736353810144277
jul 2009394841383938457131553238373535389143277
abr 2009394039384138356627573241373435389643277
jan 2009394539414139476225543040373434389543276
out 2008394741404139425822562941383434377943274
jul 2008394040384036345520492535383433358042273
abr 2008394340373939435219482241373534358644273
jan 20083943393438373350185024413735343610644269
out 2007393839373838335718492538373534373344267
jul 2007393939383836505122502638373534363344262
abr 2007393939383635494925502640373534373243257
jan 2007394640413533485226512938373534373143254
out 2006394539403433495026482837373433373242251
jul 2006405139413333405926522940373434363440238
abr 2006393637373333346224493040373233353539233
jan 2006394542383534295417312540353130353037215
out 2005353537323332285020243037343130383035213
jul 2005353736383232234733253336363331393034202
abr 2005333438283333233631233927373333403337195
jan 2005304230293535313627193328353235363541191
out 2004284041484242423325312645444139475049189
jul 2004255243513938512929282551444036454852159
abr 2004252023373739373737373742413832424650142
jan 2004332026303538262828282822393433393577126
out 2003383541223333322020202035373734373953101
jul 200340363721282929151515155232323129324388
abr 200327272514242419131313132425262620212771
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
 WikipedistasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikipedistas (usuários registrados)
A = Wikipedistas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikipedistas que editaram pelo menos dez vezes desde que chegaram
C = Wikipedistas que contribuíram cinco vezes ou mais este mês
D = Wikipedistas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Artigos que contêm pelo menos uma ligação interna e 200 caracteres de texto legível, não contando códigos wiki e html,
      ligações ocultas, etc.; títulos também não contam (outras colunas são baseadas no método oficial de contagem)
G = Novos artigos por dia no mês passado
H = Número médio de revisões por artigo
I = Tamanho médio dos artigos em bytes
J = Porcentagem de artigos com pelo menos 0,5 kb de texto legível (veja F)
K = Porcentagem de artigos com pelo menos 2 kb de texto legível (veja F)

Base de dados
L = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
M = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
N = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

O = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
P = Total de ligações para outras wikipédias
Q = Total de imagens apresentadas
R = Total de ligações para outros sítios
S = Total de páginas de redirecionamento

Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  2500  5  10  100  1000  10000  1  3  5  10  25  100  250  5  10  100  1000  1  3  5  10  25  100  250  1000  2500  5  10  100  1000  10000 
jun 2018280128966542252051444  4824181262 11  764230191252  5511 
mai 2018311163121774732196 33   5126211493 111 915037261562  331  
abr 2018307137101795933165 3311 6030241771 111 855345311852  441  
mar 2018301126986851292192551  673429211251111 126694426201051 431  
fev 201826911684604426135 22   593223161021111 834430231873  331  
jan 20182461118857422715614321 61292415112 111110644352318731 442  
dez 201722710883584027167 4411 4926201692 33117037282316104  542  
nov 20172671188255392418413311 62332918124222  784837251492  221  
out 20172301128155382517413311 6031281882 111 794836251482  331  
set 201722510282613926166 441114929221692 331 663630251562114321 
ago 201725811988674123155 3311 5932271791 222 734034251653  4411 
jul 201723111179584226117 3311 54272217711111 824634221382  431  
jun 2017253110926244251561431116130221761 111 864938271494  43   
mai 2017302151108785023165 331115732221391 11  9445352616103  54   
abr 201726712698664328196 3321 483025181011221177423528221052 441  
mar 2017245113785741252112 33111533426211441111 815139302313721542  
fev 20172349477554127205 5421 57292416123 111 81483731211383 551  
jan 201724910477574029185 4421 5128211591 111 77383628211161 443  
dez 20162181078361472820513311 4526201361 221 72443627199521432  
nov 201622610175584328204 4411 50332315103 111 7440383216931 55   
out 201623511281563627185 331114726201371 22  664435231783  331  
set 201621110177594126157 3321 4530251482111  674232221251  431  
ago 20161949169534223152 4411 532719149  111 633727201541  22   
jul 201624310376574326155 33111553120136  11  603827181261  521  
jun 201622110781523625154 3311 3922181371 11  553525171473  32   
mai 201627112596684928173 4411 512719159  111 7642382615731 431  
abr 2016326152115865731233 66311713227141151322 9752412821941 4411 
mar 20162761219872523119513311 7332211072 222 118846630181061 431  
fev 201622710076564324172 3311 50262013101 211 7143382720741 32   
jan 2016258127906141291832331115132261693 111 7843352919951 22   
abr 2018307137101795933165 3311 6030241771 111 855345311852  441  
jan 20182461118857422715614321 61292415112 111110644352318731 442  
out 20172301128155382517413311 6031281882 111 794836251482  331  
jul 201723111179584226117 3311 54272217711111 824634221382  431  
abr 201726712698664328196 3321 483025181011221177423528221052 441  
jan 201724910477574029185 4421 5128211591 111 77383628211161 443  
out 201623511281563627185 331114726201371 22  664435231783  331  
jul 201624310376574326155 33111553120136  11  603827181261  521  
abr 2016326152115865731233 66311713227141151322 9752412821941 4411 
jan 2016258127906141291832331115132261693 111 7843352919951 22   
out 201524811988684526154 22   54282315721111 8043363020631 21   
jul 20152399768543924126 3311 4018131071 111 6639292215751 32   
abr 2015320162129854523163 4411 60312215611222212269473318931 431  
jan 20152349872493424134 542  54302114102 11  754233221674  22   
out 2014231100745032241362542  5027161261 11  773832241432  11   
jul 201421897695239261531221  46251565  1   664534241892  11   
abr 2014245122846041281552222  5025191593     764335261854  11   
jan 2014254126100734928174 4311 66372821113     1005141322385  11   
out 201322611178543626142 221  5021161051     8744402517411 31   
jul 20132169369554131154 973  4828221511      7240322922112  431  
abr 201326612393664324161 7652 6832211594 1   8245362720105  6531 
jan 201331112891614330192 3331155 493021147  1   804432271762  191682 
out 201230512383533623152 3328135 5025211581 1   933629241882  221741 
jul 20122428261433027182139341461472319139  1   653326221162  232081 
abr 20122981229470422417314038184 60302216101     944639261552  28205  
jan 201225510372513929223 3835154 452620148  111 974739311751  19165  
out 201124510268503524174 3632236 5422141062     9343372319821 261911  
jul 201121684534328229213329164 441512821     844637251321  17135  
abr 20112359860493118111 2927153 6033251461     803631231622  15126  
jan 20112759974573826153 3231204 72292317113     94433126224   17148  
out 2010245957149321814213128123 603123141021    794134231963  21166  
jul 2010243957344261612  2726173 5629211372     864033211274  14106  
abr 201024210583573825144 3029174 673024131041    1035037251773  13123  
jan 201026611277543722111 2524164 61343022112     7543332417611 1182  
out 20092411067851301672 3126174 6327171293     823930181342  12112  
jul 20092148367443219142 3633174 5027221294     7735312013821 12104  
abr 200927212493704121102 3228185 64292319111     974637281875  13104  
jan 200923210576523017101 3030154 7636261491     954032231782  13115  
out 20082219266422615101 3428144 5527221581     11544282113621 1183  
jul 2008205896747331891 3325164171322017101 11  983930221662  1393  
abr 20081488770493420101 2421174 61322615102     774330221581  872  
jan 20081611088566462382 2424193 79453423133     744632231382  127   
out 200716810983684419122 2322154 67363025185     1064841302094  13112  
jul 2007129947758421851 151393 6128231461     643527231041  642  
abr 200713395795739177  141384 5226201561     633929171251  762  
jan 2007109695443281261 141252 37221893      5326231592   542  
out 2006120786346311261 121163 4627191252     64292017943  331  
jul 20069760533822107  9942 35201710711    51272318114   53   
abr 200610263533823101  4421 30121072      4116127421       
jan 200663403025201031 4331 25171473      3919151051   21   
out 20055737322818114  3321 301413115      3822181132   11   
jul 2005463226201464  984  16111062      25139431   21   
abr 2005513123201495  332  191710971     35171210531  1    
jan 2005282221161263  221  1510975      16121210632       
out 200419119551   111  63331      9531          
jul 2004106543        4211       411           
abr 2004261816621        53311      115311         
jan 200417964111       54311      741111        
out 20031                                    
jul 2003                                     
abr 200311111                                 


Distribuição de edições de artigos por wikipedistas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...

Edições >=WikipedistasEdições total


50 wikipedistas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias

 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
30 dias
30 dias
30 dias
30 dias
MiguelferigUC1 0143,4481,2116,36582abr 25, 201126221,54538--
Breogan2008UC2 0120,8623,85211,963109ago 18, 201028726,387419--
HombreDHojalataUC3 0105,7061,57341,234421out 11, 200835482,47634--
EstevoaeiUC4 088,67282515,417101mai 30, 2006441310,19159--
Alfonso MárquezUC5 083,6966753,84424abr 21, 200740874,44314--
XasUC6 073,61829613,38511mar 20, 200741194,85215--
Chairego apcUC7 057,6391,45726,598468fev 26, 201126802,32536--
ElisardojmUC9 047,4901,50123,145349out 31, 200642593,54841--
Xabier CidUC10 044,9251313,7981mai 22, 200644212,246---
BeninhoUC11 044,30946711,21850mar 11, 200644935,97690--
ImxavitoohUC12 041,383764,251-mai 06, 200933411,4539--
Servando2UC13 040,5811304,54417dez 10, 200545845,40613--
AdorianUC14 038,149396,9679set 06, 20083583519---
Norrin strangeUC16 035,902117,921-mai 13, 200644303,720---
LameiroUC17 034,7528016,48017fev 24, 200741432,0284--
AtobarUC18 030,652709,99040fev 07, 200934294373--
KriskoUC20 028,752272,3643mar 25, 200644794,9791--
AMPERIOUC21 027,90053410,257257nov 01, 200931621,32321--
JglamelaUC22 021,4313581,43422set 04, 2013175959619--
NachonionUC24 018,94522,298-mar 01, 20122311621---
XoioUC26 018,844351,6754out 11, 201028181,0465--
Albert galizaUC27 015,38937,635-jan 13, 200645503861--
PiquitoUC29 014,8861799,75472mai 18, 2010296429834--
FendetestasUC31 013,2672792198mai 27, 2013185983047--
HacheDous=0UC32 013,0153711,74450dez 05, 2014130225913--
LmbugaUC35 012,207625,475-ago 09, 200547071921--
Xoán Carlos FragaUC36 011,88611,792-jun 13, 20054764377---
FleaRHCPUC38+111,5253142,68921dez 23, 2008347526919--
SobreiraUC40 010,980294,821-jan 04, 200549241,0057--
MoedagalegaUC44+19,26830470-jan 28, 201688327223--
Ramiro TorresUC45-19,217856-jan 21, 2011271610---
Xosé AntonioUC46 08,972143,4451jul 26, 201125301,184---
JonnyJonnyUC48 08,147392,3907nov 15, 201027831482--
AgremonUC50 07,72952,9632ago 02, 200354456401--
CastelaoUC52 07,5653241,088146jan 24, 20122348251--
RubenWGAUC56 06,23012,6911nov 24, 2016582209---
MAGHOIUC58+15,60526884219dez 09, 200931241648--
XosemaUC59-15,583110246-mar 22, 2009338699412--
Nonso91UC65 04,372931291dez 17, 200834817---
Mgl.brancoUC74 02,90061931jul 27, 20083624501---
LlesUC83+182,24761944673jan 19, 201816110426--
NicoleUC84+72,23716143-abr 13, 20122268122--
Força do BarbantinhoUC85-22,2311198-abr 20, 2014153169---
Ogalego.galUC93-12,0874359-jun 01, 201511241821--
PementaUC111+31,4416863-mar 26, 20131921----
TfelizUC115 01,3471466-dez 29, 200931042---
Maria zaosUC116+111,27726458933nov 08, 2014132914---
AlmaffiUC119-11,1952141-abr 23, 2011262456---
VitoriaogandoUC121+211,172427271abr 21, 2017434101--
AndalcantUC124-11,075574-dez 13, 201412941---


20 wikipedistas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

  Primeira ediçãoúltima edição
BanjoUC852,855nov 25, 20064234mai 25, 201835
PrevertUC1536,974out 01, 20045019mai 18, 2017407
XoacasUC1928,817out 06, 20083553mai 30, 201830
Anton45UC2320,000ago 11, 20112514fev 13, 2018136
AngeldomcerUC2518,907fev 20, 20093416ago 13, 2017320
ToliñoUC2815,165mai 09, 20074069dez 22, 2016554
Hugo22UC3013,439ago 15, 20064336fev 17, 20131958
RocasteloUC3312,604dez 11, 20044948set 17, 20073938
VivaelceltaUC3412,242nov 01, 20083527mai 27, 201833
XoséUC3711,617jan 06, 20054922mar 19, 20083754
PepedoCoutoUC3911,503jan 13, 20083820ago 10, 20141419
Isili0nUC4110,420set 06, 20151027jan 07, 2018173
CalqUC4210,105abr 28, 20112619abr 04, 201886
GallaecioUC439,438ago 06, 20073980abr 01, 201889
JaviP96UC478,624out 03, 20122095fev 28, 20141582
LansbricaeUC498,038nov 17, 20064242out 22, 20083537
Martinho12UC517,586jun 15, 20083666mai 12, 201848
UnhanovaUC536,883abr 07, 2016813jan 18, 2018162
ParadantaUC546,858jan 20, 20103082jan 25, 2018155
Xabier CancelaUC556,507mar 21, 20083752mar 10, 2018111


Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 169.898 edições foram feitas por usuários anônimos, de um total de 3817.597 edições ( 4e %)

50 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
BanjoBot 2.0UC1303,466fev 11, 20151234mar 04, 2018117147-
TXiKiBoTUC2116,358jun 03, 20064409jan 09, 201319971,399-
BotDHojalataUC398,510abr 06, 20112641jun 13, 20181652-
EmausBotUC495,217jun 10, 20102941jun 29, 2018-379-
Luckas-botUC590,810jul 12, 20083639jun 23, 20122197834-
SieBotUC674,193mai 21, 20074057jan 25, 2011271252-
XqbotUC768,359mai 03, 20093344mai 26, 201834116-
AddbotUC861,784mar 06, 20131941ago 27, 20131767--
BanjoBotUC958,381set 22, 20073933mar 23, 200933857-
XoseBotUC1050,786abr 24, 20054814mar 21, 200837523,029-
VolkovBotUC1148,791jan 12, 20074186mar 04, 20131943384-
MerlIwBotUC1242,358abr 05, 20112642ago 09, 2013178528-
PrebotUC1341,207abr 30, 20054808fev 28, 20174864,583-
Thijs!botUC1438,945jul 28, 20064354out 15, 20122083251-
EscarbotUC1536,424jun 17, 20064395mar 21, 201810091-
ZéroBotUC1629,302dez 30, 20102738mar 07, 20131940114-
JAnDbotUC1727,534ago 17, 20064334jul 03, 20131822122-
WikitanvirBotUC1826,484ago 12, 20102878mai 15, 201222365-
ArthurBotUC1926,161dez 28, 20083470nov 05, 201220627-
YurikBotUC2020,910jul 31, 20054716set 04, 200643163-
MelancholieBotUC2120,888mar 30, 20083743nov 28, 2009313510-
LovelessUC2215,548jun 05, 20074042out 04, 201220948-
ChuispastonBotUC2315,215out 03, 20102826abr 28, 201222537-
CommonsDelinkerUC2412,667set 27, 20064293jun 30, 2018-98635
ToloBotUC2512,005set 17, 20112477ago 03, 2013179110-
AlleborgoBotUC2610,991jun 15, 20074032ago 08, 20102882--
TobeBotUC2710,338set 13, 20093211set 14, 20102845--
PtbotgourouUC289,952set 04, 20083585mar 06, 2013194139-
Rembiapo pohyiete (bot)~glwikiUC299,825jul 20, 20054727dez 29, 200642005-
Rei-botUC308,977nov 12, 20064247nov 07, 200931567-
Idioma-botUC318,965ago 03, 20073983mar 07, 2013194058-
KLBot2UC328,783jun 06, 20122214jul 03, 2013182251-
KamikazeBotUC338,028jul 03, 20102918jan 27, 201319794-
DragonBotUC347,913out 05, 20073920fev 04, 2013197137-
RedBotUC357,597jan 22, 20122350ago 24, 20122135108-
MalafayaBotUC367,260set 24, 20073931fev 16, 20131959--
LucienBOTUC376,963jan 30, 20093437ago 23, 201125024-
ShydeUC386,537out 25, 20141343jun 01, 201828--
TjBotUC396,451nov 21, 20093142mar 06, 2013194126-
FlaBotUC406,243mai 23, 20064420set 17, 2010284259-
RubinbotUC416,234mai 18, 20093329mar 05, 201319429-
Makecat-botUC426,020jun 16, 20122204mar 06, 201319413-
SynthebotUC435,624mar 29, 20074110jan 31, 2013197512-
JackieBotUC445,105jul 29, 20102892fev 04, 201751012-
AmirobotUC454,940jul 24, 20083627nov 25, 2011240845-
BotMultichillUC464,460jun 09, 20074038abr 17, 20112630--
CarsracBotUC474,277mai 22, 20083690mar 01, 201319464-
ChlewbotUC484,209dez 09, 20054585dez 31, 20064198--
MastiBotUC494,158dez 06, 20093127mar 04, 201319432-
BOTarateUC503,885jan 07, 20083826fev 21, 20122320--


Artigos que contêm pelo menos uma ligação interna e .. caracteres de texto legível, não contando códigos wiki e html,
ligações ocultas, etc.; títulos também não contam  (excluindo páginas de redirecionamento)

 < 32 ch< 64 ch< 128 ch< 256 ch< 512 ch< 1 k ch< 2 k ch< 4 k ch< 8 k ch< 16 k ch< 32 k ch< 64 k ch
mai 20102.9%6.2%6.8%12.1%32.2%51.8%72.1%86.9%94.8%98.3%99.5%99.9%
abr 20102.8%5.9%6.5%12.1%32.2%51.8%72.1%86.9%94.8%98.3%99.6%100.0%
mar 20102.6%5.6%6.2%12.0%31.8%51.7%72.2%86.9%94.9%98.3%99.6%100.0%
fev 20102.4%5.2%5.9%11.8%31.6%51.6%72.2%86.9%94.8%98.2%99.4%99.8%
jan 20102.3%5.0%5.7%11.8%31.7%51.7%72.3%87.0%94.9%98.3%99.6%100.0%
dez 20092.1%4.5%5.2%11.4%31.5%51.6%72.3%86.9%94.7%98.2%99.4%99.8%
nov 20092.0%4.3%5.0%11.4%31.5%51.7%72.5%87.0%94.8%98.3%99.5%99.9%
out 20091.9%4.0%4.7%11.1%31.5%51.7%72.5%86.8%94.6%98.1%99.3%99.7%
set 20091.6%3.6%4.3%10.9%31.7%51.7%72.5%86.8%94.7%98.3%99.6%100.0%
ago 20091.4%3.2%3.9%10.7%31.9%51.8%72.4%86.6%94.5%98.1%99.4%99.8%
jul 20091.3%3.0%3.7%10.7%32.3%52.1%72.6%86.8%94.6%98.2%99.5%99.9%
jun 20090.9%2.5%3.3%10.6%33.1%52.1%72.5%86.8%94.7%98.3%99.6%100.0%
mai 20090.7%1.9%2.7%10.3%33.2%52.1%72.4%86.7%94.6%98.2%99.5%99.9%
abr 20090.5%1.3%2.1%10.0%32.6%51.8%72.1%86.6%94.6%98.3%99.6%100.0%
mar 20090.3%0.8%1.6%9.7%32.3%51.6%71.8%86.4%94.5%98.2%99.5%99.9%
fev 20090.1%0.4%1.2%9.6%32.1%51.3%71.5%86.2%94.4%98.2%99.5%99.9%
jan 20090.1%0.4%1.3%9.8%32.3%51.3%71.5%86.2%94.5%98.3%99.6%100.0%
dez 20080.1%0.4%1.3%9.9%32.3%51.3%71.4%86.1%94.3%98.1%99.4%99.8%
nov 20080.1%0.4%1.3%10.1%32.3%51.4%71.3%86.0%94.3%98.2%99.5%100.0%
out 20080.1%0.4%1.4%10.4%32.4%51.3%71.3%86.0%94.4%98.3%99.6%100.0%
set 20080.1%0.5%1.6%10.7%32.4%51.1%71.1%85.8%94.2%98.1%99.4%99.9%
ago 20080.1%0.5%1.6%10.9%32.3%51.1%71.1%85.8%94.2%98.1%99.4%99.9%
jul 20080.1%0.5%1.6%11.3%32.0%50.9%71.0%85.7%94.2%98.2%99.6%100.0%
jun 20080.1%0.5%1.7%11.5%31.9%50.9%71.0%85.7%94.1%98.1%99.4%99.9%
mai 20080.1%0.5%1.7%10.6%31.1%50.5%70.8%85.5%93.9%97.9%99.3%99.8%
abr 20080.1%0.6%1.9%10.7%31.2%50.6%71.0%85.6%94.0%98.1%99.5%100.0%
mar 20080.1%0.6%1.8%10.8%31.6%51.0%71.3%85.9%94.2%98.2%99.6%100.0%
fev 20080.1%0.7%2.0%11.1%32.2%51.5%71.6%85.9%94.2%98.2%99.6%100.0%
jan 20080.1%0.7%2.0%10.9%32.2%51.7%71.8%85.9%94.2%98.2%99.5%99.9%
dez 20070.1%0.7%2.1%10.9%32.4%52.1%72.1%85.9%94.1%98.1%99.4%99.8%
nov 20070.0%0.8%2.2%11.1%32.8%52.5%72.5%86.2%94.3%98.2%99.5%99.9%
out 20070.0%1.1%2.9%11.8%33.4%52.9%72.8%86.3%94.3%98.1%99.4%99.8%
set 20070.0%1.1%3.3%12.3%34.1%53.6%73.5%86.6%94.4%98.1%99.4%99.8%
ago 20070.0%1.2%3.7%12.8%35.2%55.0%74.8%87.5%94.9%98.3%99.5%99.9%
jul 20070.0%1.2%4.0%13.2%36.3%56.2%75.8%88.0%95.2%98.5%99.6%99.9%
jun 20070.0%1.3%4.2%13.6%37.3%57.3%76.8%88.7%95.7%98.6%99.6%99.9%
mai 20070.1%1.6%4.6%14.2%38.8%58.9%77.2%88.9%95.8%98.6%99.6%99.9%
abr 20070.1%1.9%5.0%14.8%40.0%59.9%77.9%89.2%95.9%98.6%99.6%99.9%
mar 20070.1%2.1%5.3%15.3%41.1%61.0%78.7%89.6%96.2%98.8%99.8%100.0%
fev 20070.1%2.2%5.6%15.8%42.1%61.9%79.3%89.9%96.2%98.7%99.6%99.9%
jan 20070.1%2.3%6.1%16.3%42.9%62.7%79.8%90.1%96.2%98.7%99.6%99.9%
dez 20060.2%2.7%6.8%16.9%43.7%63.3%80.3%90.5%96.5%98.9%99.8%100.0%
nov 20060.2%2.9%7.2%17.3%44.4%63.9%80.7%90.7%96.4%98.8%99.7%100.0%
out 20060.2%3.0%7.5%17.5%44.8%64.2%81.0%90.9%96.6%98.9%99.8%100.0%
set 20060.2%1.5%6.3%16.6%44.7%64.2%81.1%90.9%96.5%98.8%99.7%100.0%
ago 20060.8%1.4%6.5%16.7%45.1%64.5%81.5%91.1%96.6%98.9%99.8%100.0%
jul 20060.8%1.5%6.8%16.9%45.8%65.2%82.0%91.4%96.8%99.0%99.9%100.0%
jun 20060.8%1.5%6.7%16.7%45.9%65.4%82.2%91.5%96.7%98.9%99.8%100.0%
mai 20060.8%1.6%7.0%17.0%46.5%65.9%82.6%91.7%96.7%98.9%99.8%100.0%
abr 20060.2%1.0%6.5%16.7%47.0%66.4%83.0%91.9%96.9%99.1%100.0%100.0%
mar 20060.2%1.0%4.3%14.6%45.8%65.5%82.4%91.4%96.5%98.8%99.8%100.0%
fev 20060.2%1.1%4.2%14.7%43.7%64.2%81.8%91.1%96.5%98.8%99.8%100.0%
jan 20060.2%1.2%4.6%15.8%41.9%63.5%81.7%91.0%96.4%98.8%99.8%100.0%
dez 20050.3%1.8%5.9%18.4%39.5%62.5%81.7%91.1%96.5%98.7%99.7%99.9%
nov 20050.3%1.9%6.4%19.2%40.0%63.2%82.5%91.6%96.7%98.7%99.7%99.9%
out 20050.4%2.1%6.8%20.3%41.9%64.7%83.7%92.1%96.9%98.8%99.8%99.9%
set 20050.5%2.5%6.8%20.5%43.0%66.1%84.8%92.8%97.5%99.3%100.0%100.0%
ago 20050.5%2.7%7.5%22.2%45.2%67.9%85.8%93.2%97.6%99.2%99.8%99.9%
jul 20050.5%3.0%7.8%22.6%46.6%69.6%87.3%94.1%98.1%99.4%99.9%100.0%
jun 20050.6%2.0%7.3%23.6%48.2%70.8%88.5%94.9%98.5%99.6%100.0%100.0%
mai 20050.8%2.4%8.0%24.9%48.3%71.1%89.1%95.2%98.7%99.7%100.0%100.0%
abr 20050.5%2.2%8.3%25.3%47.3%69.7%89.3%95.3%98.4%99.5%99.9%99.9%
mar 20050.7%2.9%9.5%24.0%44.7%67.9%89.6%95.3%98.5%99.6%100.0%100.0%
fev 20050.8%3.4%10.5%25.8%45.9%68.4%90.0%95.4%98.3%99.4%99.9%99.9%
jan 20051.2%4.3%12.8%28.8%50.2%72.0%90.3%95.6%98.4%99.5%100.0%100.0%
dez 20041.4%4.9%14.6%41.4%61.5%78.5%90.8%95.9%98.5%99.4%99.9%99.9%
nov 20042.1%7.6%20.2%44.8%63.7%79.0%90.2%95.7%98.5%99.7%100.0%100.0%
out 20042.2%8.5%23.7%43.5%63.1%79.6%90.3%96.1%98.7%99.7%100.0%100.0%
set 20042.1%9.0%25.2%45.6%64.4%80.9%91.3%96.7%98.7%99.5%99.9%100.0%
ago 20042.1%9.2%26.2%47.3%65.9%81.5%91.9%97.2%99.1%99.7%100.0%100.0%
jul 20042.2%9.9%27.1%49.1%67.9%82.8%92.2%97.2%99.2%99.7%100.0%100.0%
jun 20042.3%9.9%27.6%49.4%68.2%83.1%92.2%97.1%99.1%99.6%99.9%99.9%
mai 20042.3%10.3%28.9%50.7%69.4%83.6%92.5%97.4%99.2%99.7%100.0%100.0%
abr 20042.1%10.5%29.7%52.1%71.0%84.9%92.5%97.3%99.2%99.7%100.0%100.0%
mar 20042.1%11.7%31.5%52.6%70.8%84.6%92.4%97.4%99.1%99.7%100.0%100.0%
fev 20042.4%13.7%36.2%59.6%77.3%88.3%93.2%97.5%98.9%99.7%100.0%100.0%
jan 20045.8%17.4%35.0%58.3%75.9%87.9%92.4%96.9%98.6%99.4%100.0%100.0%
dez 20032.7%10.9%32.0%56.2%76.9%90.2%94.1%97.6%99.2%100.0%100.0%100.0%
nov 20032.5%9.1%30.5%55.2%77.0%90.6%94.3%98.0%99.2%100.0%100.0%100.0%
out 20031.8%7.1%25.3%47.7%73.0%90.6%94.7%98.2%98.8%100.0%100.0%100.0%
set 20031.4%7.0%16.0%40.3%68.1%88.9%93.8%98.0%98.7%100.0%100.0%100.0%
ago 20031.5%6.6%14.7%39.0%67.7%89.0%93.4%97.8%98.5%100.0%100.0%100.0%
jul 20030.9%4.4%12.4%36.3%66.4%89.4%94.7%98.2%99.1%100.0%100.0%100.0%
jun 20030.9%4.4%12.4%36.3%66.4%89.4%94.7%98.2%99.1%100.0%100.0%100.0%
mai 20030.9%4.4%12.4%36.3%66.4%89.4%94.7%98.2%99.1%100.0%100.0%100.0%
abr 20030.9%4.4%12.4%36.3%66.4%89.4%94.7%98.2%99.1%100.0%100.0%100.0%
mar 20030.0%0.0%9.0%38.9%67.3%92.7%95.7%100.0%100.0%100.0%100.0%100.0%


Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.

See also Category Overview Complete (1.9 Mb!), Concise (108 kb)

categorizados 1
jun 2018212 k4,3 k4,7 k35 k70618 k11657 k2,5 k1     29633 k269281201,5 k577620
mai 2018210 k4,3 k4,6 k35 k70618 k11657 k2,5 k1     29633 k269281201,5 k577620
abr 2018209 k4,3 k4,6 k35 k70618 k11657 k2,4 k1     29633 k269281201,5 k576620
mar 2018207 k4,3 k4,5 k35 k70618 k11556 k2,4 k1     29633 k269281201,5 k576620
fev 2018204 k4,2 k4,5 k35 k70518 k11456 k2,3 k1     29633 k269281201,5 k576620
jan 2018202 k4,1 k4,4 k35 k70118 k11455 k2,2 k1     29633 k269281201,5 k576620
dez 2017199 k4,1 k4,4 k35 k70118 k11454 k2,2 k1     29633 k269281191,5 k576619
nov 2017196 k4,1 k4,3 k35 k69118 k11454 k2,2 k1     29632 k269271191,5 k576618
out 2017194 k4,0 k4,3 k35 k69118 k11453 k2,2 k1     29632 k269271191,5 k576618
set 2017191 k4,0 k4,3 k35 k68818 k6853 k2,2 k1     29632 k269271191,5 k576618
ago 2017189 k4,0 k4,2 k35 k68817 k6852 k2,2 k1     29632 k269271141,5 k576518
jul 2017188 k4,0 k4,2 k35 k68817 k6852 k2,1 k1     29632 k269271141,5 k576518
jun 2017187 k3,9 k4,2 k35 k68417 k6651 k2,0 k1     29632 k269271141,4 k570518
mai 2017185 k3,9 k4,2 k35 k68417 k6551 k1,9 k1     29632 k268271141,4 k570518
abr 2017184 k3,9 k4,1 k34 k68417 k6350 k1,9 k1     29331 k268271101,4 k565418
mar 2017182 k3,9 k4,1 k32 k68317 k6349 k1,8 k1     29330 k268271031,4 k56445
fev 2017180 k3,9 k4,1 k30 k68117 k6247 k1,8 k1     29228 k26822931,4 k55934
jan 2017178 k3,8 k4,0 k30 k68116 k6245 k1,8 k1     29227 k26816761,4 k55931
dez 2016176 k3,8 k4,0 k28 k68115 k6245 k1,7 k1     29226 k26816751,4 k55331
nov 2016173 k3,8 k3,9 k26 k67815 k6043 k1,6 k1     29124 k26616751,3 k49231
out 2016172 k3,8 k3,9 k26 k67315 k6043 k1,5 k1     28724 k26516751,3 k49221
set 2016170 k3,7 k3,9 k26 k67314 k6042 k1,4 k1     28724 k26516751,3 k49221
ago 2016169 k3,7 k3,8 k26 k67114 k6042 k1,4 k1     28724 k26516751,3 k49221
jul 2016168 k3,7 k3,8 k26 k66814 k6042 k1,4 k1     28723 k26416751,3 k49221
jun 2016166 k3,7 k3,8 k25 k66714 k5942 k1,3 k1     28623 k26416751,3 k49221
mai 2016165 k3,7 k3,8 k25 k66414 k5941 k1,3 k1     28623 k26416751,3 k49221
abr 2016164 k3,7 k3,7 k25 k66114 k5941 k1,3 k1     28623 k26416751,3 k49221
mar 2016162 k3,7 k3,7 k25 k64914 k5940 k1,2 k1     28623 k26416751,3 k49221
fev 2016160 k3,6 k3,6 k25 k63913 k5739 k8931     28623 k26416751,3 k49211
jan 2016159 k3,6 k3,5 k25 k63413 k5739 k7531     28623 k26416751,3 k49211
dez 2015158 k3,5 k3,5 k25 k62013 k5738 k7451     28623 k26416751,3 k49211
nov 2015156 k3,5 k3,5 k25 k61913 k5738 k7381     28523 k26416641,3 k47211
out 2015155 k3,5 k3,4 k25 k61613 k5638 k7381     28523 k26416631,3 k47211
set 2015154 k3,5 k3,4 k25 k61412 k5637 k7381     28523 k26416631,3 k471 1
ago 2015152 k3,5 k3,3 k25 k61412 k5537 k7381     28523 k26416631,3 k471 1
jul 2015150 k3,5 k3,3 k25 k61412 k5536 k7381     28523 k26416631,3 k470 1
jun 2015148 k3,4 k3,3 k25 k61112 k5435 k7341     28523 k26415631,3 k465 1
mai 2015147 k3,4 k3,2 k24 k60712 k5234 k7291     28522 k26415631,3 k465 1
abr 2015145 k3,4 k3,2 k24 k60411 k5234 k7281     28522 k26415631,3 k465  
mar 2015144 k3,4 k3,2 k24 k58111 k5033 k7271     28522 k26415611,3 k463  
fev 2015143 k3,3 k3,1 k24 k57011 k4633 k7261     28522 k26415611,3 k463  
jan 2015141 k3,3 k3,1 k24 k57011 k4632 k7241     28522 k26415611,3 k463  
dez 2014140 k3,3 k3,1 k24 k56911 k4432 k7231     28522 k26415611,3 k462  
nov 2014139 k3,3 k3,0 k24 k56911 k4431 k7231     28522 k26415601,3 k462  
out 2014137 k3,2 k3,0 k24 k56911 k4431 k7121     28522 k26415411,3 k462  
set 2014136 k3,2 k3,0 k23 k56711 k4430 k7121     28522 k26415361,3 k462  
ago 2014134 k3,2 k3,0 k23 k56710 k4430 k7121     28521 k26415351,3 k460  
jul 2014133 k3,2 k3,0 k23 k56710 k4429 k7101     28521 k26415351,3 k457  
jun 2014132 k3,2 k2,9 k23 k56510 k4429 k7071     28521 k26415341,3 k457  
mai 2014131 k3,1 k2,9 k23 k56510 k4428 k7051     28521 k26415341,3 k457  
abr 2014128 k3,1 k2,9 k23 k56410 k4427 k7051     28521 k26415341,2 k454  
mar 2014126 k3,1 k2,9 k22 k56410 k4426 k7031     28520 k26415341,2 k453  
fev 2014125 k3,1 k2,8 k22 k5649,9 k4426 k6771    1466128520 k26415341,2 k452  
jan 2014124 k3,0 k2,8 k22 k5639,6 k4425 k6561    1700328320 k26415341,2 k450  
dez 2013122 k3,0 k2,8 k22 k5639,3 k4425 k6491    1219328320 k26415341,2 k447  
nov 2013120 k3,0 k2,7 k22 k5619,2 k4424 k6201    1173428120 k26415241,2 k447  
out 2013119 k3,0 k2,7 k22 k5619,2 k4324 k5501    1237028120 k26415191,2 k447  
set 2013118 k3,0 k2,7 k21 k5618,9 k4324 k4991    1266128120 k26415161,2 k447  
ago 2013117 k2,9 k2,7 k21 k5618,7 k4324 k4511    1410528119 k26415161,2 k444  
jul 2013115 k2,9 k2,6 k21 k5618,7 k4323 k4141    1477518119 k26415161,2 k441  
jun 2013114 k2,9 k2,6 k21 k5618,7 k4323 k3201    1854418119 k26415111,2 k439  
mai 2013112 k2,9 k2,6 k21 k5608,5 k4221 k2581    1501518119 k26415111,2 k437  
abr 2013111 k2,9 k2,6 k21 k5568,4 k4221 k2231    1313318119 k26415111,2 k437  
mar 2013110 k2,8 k2,5 k20 k5558,2 k4220 k1191    1725618019 k26415111,2 k437  
fev 2013108 k2,8 k2,5 k20 k5488,2 k4219 k81     1852618018 k26415111,2 k428  
jan 2013106 k2,7 k2,5 k20 k5488,1 k4219 k81     1640718018 k26415111,1 k428  
dez 2012103 k2,7 k2,5 k20 k5488,1 k4218 k81     1492318018 k26415111,1 k428  
nov 2012101 k2,7 k2,5 k20 k5488,1 k4217 k81     1229118018 k26415111,1 k428  
out 201299 k2,7 k2,5 k20 k5488,0 k4217 k78     1132118018 k26415111,1 k428  
set 201298 k2,6 k2,4 k20 k5468,0 k4217 k50     1703618018 k26415111,1 k427  
ago 201297 k2,6 k2,4 k20 k5448,0 k4216 k50     1760018018 k26415111,1 k427  
jul 201295 k2,6 k2,4 k19 k5447,9 k4216 k50     1382118018 k26415111,1 k426  
jun 201294 k2,6 k2,4 k19 k5447,9 k4116 k50     1890018017 k2639111,1 k423  
mai 201292 k2,6 k2,3 k19 k5407,9 k4116 k50     1783218017 k2639111,1 k423  
abr 201291 k2,5 k2,3 k18 k5407,9 k4115 k50     1553418017 k2639111,1 k413  
mar 201287 k2,5 k2,3 k18 k5407,8 k4115 k50     1831218017 k2579111,1 k412  
fev 201285 k2,4 k2,3 k18 k5407,7 k4114 k50     15697 8016 k2579111,1 k411  
jan 201283 k2,4 k2,3 k18 k5407,7 k4014 k50     17930 8016 k2579111,1 k411  
dez 201181 k2,4 k2,2 k18 k5397,7 k4013 k50     18626 7916 k2579111,0 k405  
nov 201178 k2,4 k2,2 k18 k5397,7 k4013 k50     14162 7816 k2579111,0 k402  
out 201177 k2,3 k2,2 k17 k5387,6 k4013 k50     15240 7816 k257991,0 k400  
set 201176 k2,3 k2,2 k17 k5377,6 k3912 k50     9269 7816 k257981,0 k399  
ago 201175 k2,3 k2,1 k17 k5367,6 k3912 k50     11300 7716 k257761,0 k399  
jul 201174 k2,3 k2,1 k17 k5287,5 k3912 k50     11381 7715 k257461,0 k398  
jun 201174 k2,2 k2,1 k17 k5287,5 k3912 k50     10644 7715 k257161,0 k398  
mai 201173 k2,2 k2,1 k17 k5267,5 k3912 k50     8222 7715 k257 61,0 k398  
abr 201172 k2,2 k2,1 k17 k5267,4 k3912 k50     8880 7715 k257 51,0 k398  
mar 201171 k2,1 k2,0 k16 k5267,4 k3911 k50     14396 7715 k257 51,0 k398  
fev 201170 k2,1 k2,0 k16 k5257,3 k3711 k50     9350 7715 k257 51,0 k398  
jan 201169 k2,1 k2,0 k16 k5257,3 k3711 k50     13331 7415 k257 51,0 k397  
dez 201068 k2,0 k2,0 k16 k5177,3 k3610 k50     10733 7415 k257 51,0 k393  
nov 201066 k2,0 k1,9 k16 k5177,3 k369,9 k50     14628 7114 k257 51,0 k221  
out 201065 k2,0 k1,9 k16 k5167,2 k359,4 k50     11024 7114 k257 51,0 k209  
set 201064 k2,0 k1,9 k15 k5167,2 k359,1 k50     10202 7114 k257 51,0 k209  
ago 201063 k1,9 k1,9 k15 k5157,2 k358,7 k50     7596 7114 k257 51,0 k209  
jul 201062 k1,9 k1,8 k15 k5157,1 k358,3 k50     7996 7114 k257 51,0 k209  
jun 201061 k1,9 k1,7 k15 k5157,0 k358,2 k50     12740 7113 k257 51,0 k208  
mai 201060 k1,9 k1,7 k14 k5157,0 k348,1 k50     13651 7113 k257 51,0 k205  
abr 201058 k1,8 k1,7 k14 k5156,9 k348,0 k50     13797 7113 k257 51,0 k205  
mar 201056 k1,8 k1,6 k14 k5156,9 k347,7 k50     13318 7113 k256 5998192  
fev 201055 k1,8 k1,6 k13 k5156,8 k187,4 k50     9229 7112 k255 5991121  
jan 201054 k1,7 k1,6 k12 k5106,8 k186,8 k50     9498 7111 k238 5981116  
dez 200953 k1,7 k1,5 k11 k5106,8 k186,4 k50     10352 719,8 k238 5980113  
nov 200952 k1,7 k1,5 k11 k5106,6 k186,1 k50     8592 699,4 k238 5971113  
out 200950 k1,7 k1,5 k10 k5036,4 k186,0 k50     7447 699,3 k238 5962113  
set 200949 k1,6 k1,5 k10 k5036,0 k185,9 k50     9434 659,1 k237 5960101  
ago 200948 k1,6 k1,4 k9,8 k5035,8 k185,7 k50     5678 628,7 k 1 595199  
jul 200948 k1,6 k1,3 k9,3 k5035,6 k185,4 k50     9930 618,2 k 1 593989  
jun 200946 k1,6 k1,3 k7,9 k5035,2 k185,1 k50     10416 606,9 k 1 593266  
mai 200945 k1,5 k1,3 k7,9 k5014,9 k185,1 k50     8756 596,8 k 1 592966  
abr 200944 k1,5 k1,3 k7,8 k5014,8 k184,9 k50     9814 596,8 k 1 592666  
mar 200943 k1,5 k1,2 k7,8 k5014,7 k184,7 k50     9919 596,7 k 1 592365  
fev 200942 k1,4 k1,2 k7,3 k5004,3 k184,2 k50     8177 596,3 k 1 580664  
jan 200942 k1,4 k1,2 k7,1 k5004,1 k184,1 k50     7206 596,1 k 1 580363  
dez 200841 k1,4 k1,2 k7,0 k5004,0 k184,0 k50     9134 596,1 k 1 580363  
nov 200839 k1,3 k1,1 k6,6 k5003,8 k183,8 k50     8603 465,8 k 1 574352  
out 200839 k1,3 k1,1 k6,3 k5003,5 k183,7 k50     6929 465,5 k 1 574047  
set 200838 k1,2 k1,1 k5,5 k4983,3 k183,5 k50     5987 234,7 k    68437  
ago 200837 k1,2 k1,1 k4,7 k4933,2 k183,4 k50     7253 124,0 k    61632  
jul 200837 k1,2 k1,1 k4,6 k4933,1 k183,3 k50     7745 123,9 k    60732  
jun 200836 k1,1 k1,0 k4,5 k4933,1 k173,2 k50     9293 123,9 k    60532  
mai 200835 k1,1 k1,0 k4,4 k4933,0 k173,2 k50     7655 123,8 k    60128  
abr 200834 k1,0 k9793,9 k4923,0 k173,0 k50     8232 123,3 k    55828  
mar 200833 k1,0 k9463,8 k4912,8 k173,0 k50     7598 123,2 k    55828  
fev 200831 k9999163,7 k4912,6 k172,8 k50     7715 123,1 k    55622  
jan 200830 k9698773,6 k4912,6 k172,8 k50     9562 123,0 k    55421  
dez 200729 k9428353,5 k4912,4 k152,7 k50     10149 122,9 k    55021  
nov 200728 k9047873,4 k4902,4 k152,5 k50     10239 122,8 k    54720  
out 200724 k8517161,9 k4901,3 k131,7 k39     10234 41,4 k    53019  
set 200722 k7916261,9 k4891,2 k131,6 k39     8411 41,4 k    52618  
ago 200721 k7535731,9 k4571,1 k111,5 k39     8232 41,3 k    52418  
jul 200720 k7215651,8 k4561,1 k101,5 k33     7693 41,3 k    52315  
jun 200719 k7005171,8 k4531,1 k101,5 k33     5823 41,2 k    51915  
mai 200718 k6774991,7 k4491,0 k101,5 k33     6836 41,2 k    51813  
abr 200716 k6404471,7 k44396481,4 k      6517 41,2 k    51810  
mar 200716 k5964281,7 k43093071,4 k      6059 41,1 k    5187  
fev 200715 k5703981,6 k41690371,3 k      4817 41,1 k    5174  
jan 200714 k5503791,6 k41689051,3 k      6703 41,1 k    5151  
dez 200613 k5343661,6 k40986551,2 k      6803 41,1 k    5111  
nov 200612 k5053601,6 k38283551,1 k      4790 41,1 k    5041  
out 200612 k4833511,6 k38082251,1 k      5524 41,1 k    5031  
set 200611 k4503301,6 k38080051,0 k      4881 31,1 k    4951  
ago 200610 k4293161,5 k3807654959      5050 31,0 k    4951  
jul 20069,6 k3943051,5 k3757514955      4558 31,0 k    4921  
jun 20069,0 k3652941,5 k3617294950      4061 3991    4871  
mai 20068,5 k3452821,4 k3596973910      3626 3957    4631  
abr 20068,0 k2932621,4 k3516733849      3050 3932    457   
mar 20067,6 k2792509363356683836      3484  486    450   
fev 20067,1 k2502379283326673802      3430  478    450   
jan 20066,6 k2362249203276633786      4241  473    447   
dez 20056,2 k2142049033236173777      3614  467    436   
nov 20055,7 k1961748043166013752      3367  370    434   
out 20055,2 k1761497823115913735      3671  350    432   
set 20054,7 k1641087733095753700      2712  347    426   
ago 20054,3 k1481026982955253680      3332  297    401   
jul 20053,8 k141985512914133606      3183  150    401   
jun 20053,3 k131965132503913576      2488  113    400   
mai 20052,9 k117944912483143514      3141  94    397   
abr 20052,5 k96904562482433471      4139  59    397   
mar 20051,9 k77864322481833413      2098  45    387   
fev 20051,7 k72774142481382299      2760  30    384   
jan 20051,5 k6570397248452101      2413  15    382   
dez 20041,4 k61621924829188      3006  7    12   
nov 20041,1 k53491617315128      1941  6    10   
out 200497044421117310 2      467  2    9   
set 20048834241817310           2    6   
ago 20048403638817310           2    6   
jul 20047553335317310           2    1   
jun 20047223135317310           2    1   
mai 2004633283431669           2    1   
abr 200459325273827           2    1   
mar 200455119233827           2    1   
fev 20044051217382            2    1   
jan 2004351816282            1    1   
dez 200314533 82                     
nov 2003134 3                       
out 200387 2                       
set 200359 2                       
ago 200359 1                       
jul 200350 1                       
jun 200350 1                       
mai 200350 1                       
abr 200350 1                       
mar 200325 1                       


Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons



For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

mar 2003: 1 1 Coitelo

abr 2003: 1 1 Trastornos da linguaxe

ago 2003: 1 1 XIX

set 2003: 1 1 Unidade

out 2003: 1 1 Enerxía

nov 2003: 1 4 T , 2 4 P , 3 4 C , 4 3 I , 5 2 Z , 6 2 Teoría de cordas , 7 2 Titanic (homónimos) , 8 2 R , 9 2 Ribadeo , 10 2 Pintura , 11 2 Linux , 12 2 G , 13 1 Costa

dez 2003: 1 2 Isaac Asimov , 2 1 Ciencias Naturais

jan 2004: 1 3 A , 2 2 Astrofísica , 3 2 Electricidade , 4 2 Sistema Internacional de Unidades , 5 2 Efecto Lenard , 6 2 Electricidade atmosférica , 7 2 Electrólise , 8 2 Magnetismo , 9 2 Cinemática , 10 2 Galileo , 11 2 Ecuacións de Maxwell , 12 2 Electrodinámica clásica , 13 2 Electrodinámica cuántica , 14 2 Péndulo , 15 2 Dinámica , 16 2 Metro , 17 2 Historia do Brasil , 18 2 América Latina , 19 2 Brasil , 20 2 Colombia , 21 2 Velocidade , 22 2 Hernán Naval Parapar , 23 2 Andrés Gaos Berea , 24 2 Cavitación , 25 2 Cronómetro

fev 2004: 1 2 Eiffel , 2 2 Cantares gallegos , 3 2 Follas novas , 4 2 Flandres , 5 2 Franco belga , 6 2 Peseta , 7 2 Escudo (homónimos) , 8 2 Interlingua (lingua artificial) , 9 2 México , 10 2 Electróns , 11 2 Cometa , 12 2 Aritmética , 13 2 Internet , 14 2 Mundo (homónimos) , 15 2 Partícula , 16 1 Altura (magnitude)

mar 2004: 1 4 Engativá , 2 4 Brasil , 3 4 Ar , 4 4 T , 5 4 C , 6 4 A , 7 3 Comuna de García Rovira , 8 3 Custodio Garcia Rovira , 9 3 Lista de países , 10 3 24 de abril , 11 3 Santander, Colombia , 12 3 San Gil, Colombia , 13 3 Soto, Colombia , 14 3 Guanentá , 15 3 España , 16 3 Economía , 17 3 R , 18 3 L , 19 3 Informática , 20 3 H , 21 3 Deporte , 22 3 Cine , 23 3 Astronomía , 24 2 Francés , 25 2 Astrofísica

abr 2004: 1 5 Deporte , 2 4 Mitoloxía , 3 2 Antigo Réxime , 4 2 Santiago de Compostela , 5 2 1122 , 6 2 1152 , 7 2 4 de marzo , 8 2 Pontecesures , 9 2 Software , 10 2 Servidor , 11 2 Wáter-polo , 12 2 Honduras , 13 2 Venezuela , 14 2 Hobbit , 15 2 1419 , 16 2 Aeroporto de Palonegro , 17 2 Comuna de García Rovira , 18 2 Lebrija, Colombia , 19 2 Peseta , 20 1 2004

mai 2004: 1 3 Lingua inglesa , 2 3 1268 , 3 2 2004 , 4 2 SIDA , 5 2 Violadores del Verso , 6 2 Densidade , 7 2 Estreito de Xibraltar , 8 2 Mar Mediterráneo , 9 2 Comunismo (homónimos) , 10 2 Radio , 11 2 1968 , 12 2 Filipe I de Savoia , 13 2 Jacques-Yves Cousteau , 14 2 Charles Robert Darwin , 15 2 Patente , 16 2 Vigo , 17 2 Marie Curie , 18 2 Mercurio (elemento) , 19 1 Contido libre

jun 2004: 1 4 Xeoloxía , 2 3 J. R. R. Tolkien , 3 3 Orlando Bloom , 4 3 Anatexia , 5 3 Neutrón , 6 3 Protón , 7 3 Música , 8 3 Bioloxía , 9 2 Suevos , 10 2 Besta do Gévaudan , 11 2 Hiénidos , 12 2 Grunge , 13 2 Elijah Wood , 14 2 Valquiria , 15 2 Termómetro , 16 2 Lei de Stefan-Boltzmann , 17 2 Meninxite , 18 2 Vibráfono , 19 2 Droga , 20 2 Marimba , 21 2 Sill , 22 2 Pegmatita , 23 2 Basalto , 24 2 Glockenspiel , 25 2 Membranófono

jul 2004: 1 2 Núcleo , 2 2 Ética , 3 2 Dario Fo , 4 2 MNL , 5 2 CIG , 6 2 Unidade imaxinaria , 7 2 Identidade de Euler , 8 2 Fósforo (elemento) , 9 2 Carlos Fuentes , 10 2 Pablo Neruda , 11 2 Lei potencial , 12 2 Circunferencia , 13 2 Vesta (deusa) , 14 2 Saturno (deus) , 15 2 Constante de Planck , 16 2 Principio de indeterminación de Heisenberg , 17 2 Saturno , 18 2 Radio , 19 2 Número e , 20 2 Bélxica , 21 1 Metafísica

ago 2004: 1 2 Troll , 2 2 Troll (Terra Media) , 3 2 Alfredo Di Stéfano , 4 2 Francisco Javier González Pérez , 5 2 Garrincha , 6 2 Franz Beckenbauer , 7 2 Lev Iashin , 8 2 Burato negro , 9 2 Océano , 10 2 Mitoloxía , 11 2 Medicina , 12 1 Cromosoma

set 2004: 1 2 Arnaut Daniel , 2 2 27 de febreiro , 3 2 Ferrol , 4 2 Thomas Alva Edison , 5 2 Mexillón , 6 2 Ada (informática) , 7 2 MIT , 8 2 Proxecto Apollo , 9 2 Sistema operativo , 10 2 UNIX , 11 2 GNIX , 12 2 AGNIX , 13 2 Proxecto Trasno , 14 2 Camelle, Camariñas , 15 2 Camariñas , 16 2 Xosé Manuel Beiras , 17 2 Oviedo , 18 2 Abeleira , 19 2 Software , 20 2 Hardware , 21 2 26 de febreiro , 22 2 Paleontoloxía , 23 2 Vigo , 24 2 X , 25 1 Xunta de Galicia

out 2004: 1 3 Humphrey Bogart , 2 3 Sempre Xonxa , 3 3 Televisión de Galicia , 4 3 Hollywood , 5 3 Mamasunción , 6 3 Super 8 , 7 3 Chano Piñeiro , 8 3 Cine galego , 9 3 Bill Gates , 10 3 Galicia , 11 2 Antoni Gaudí , 12 2 Electrónica , 13 2 Sobrado , 14 2 Rem Koolhaas , 15 2 Le Corbusier , 16 2 GIMP , 17 2 Volkswagen , 18 2 Dire Straits , 19 2 GNOME , 20 2 Matthias Ettrich , 21 2 Copérnico , 22 2 Nicolao Copérnico , 23 2 Perihelio , 24 2 Capitalismo , 25 2 Christopher Reeve

nov 2004: 1 5 Colombia , 2 4 Grecia , 3 4 Paraguai , 4 4 Estados Unidos de América , 5 4 Sistema operativo , 6 4 Vigo , 7 3 Álvaro Cunqueiro , 8 3 ESA , 9 3 George S. Patton , 10 3 Países Baixos , 11 3 Europa , 12 3 Angola , 13 3 Albania , 14 3 Estonia , 15 3 Haití , 16 3 Afganistán , 17 3 Manuel Curros Enríquez , 18 3 Perú , 19 3 Río Amazonas , 20 3 Estado do Amazonas, Brasil , 21 3 Acerbaixán , 22 3 Brasilia , 23 3 Taiwán , 24 3 Cuba , 25 3 Octeto

dez 2004: 1 6 Alemaña , 2 6 Bélxica , 3 6 Dinamarca , 4 5 Irlanda , 5 5 España , 6 4 Suecia , 7 4 Abashiri , 8 4 Hungría , 9 4 1887 , 10 4 Noruega , 11 4 Países Baixos , 12 4 Volkswagen , 13 4 1 de xaneiro , 14 4 2000 , 15 4 Francia , 16 4 Suíza , 17 4 Colombia , 18 4 Albert Einstein , 19 3 Camboxa , 20 3 Eslovaquia , 21 3 Francisco de Moure , 22 3 Chipre , 23 3 17 de xaneiro , 24 3 Xeografía de Alemaña , 25 3 Austria

jan 2005: 1 4 Abadín , 2 4 2 de xaneiro , 3 4 Vigo , 4 3 Castelo de Lobeira , 5 3 Couto Mixto , 6 3 Abomei , 7 3 India , 8 3 Limón , 9 3 A Arnoia , 10 3 Vilanova de Arousa , 11 3 Baleira , 12 3 Baltar , 13 3 Calvos de Randín , 14 3 Sandiás , 15 3 Comarca da Limia , 16 3 1990 , 17 2 Ramón Verea , 18 2 Gregorio Aglipay , 19 2 Axenor , 20 2 19 de abril , 21 2 Vorbis , 22 2 Martín, Baleira , 23 2 13 de febreiro , 24 2 Nanotecnoloxía , 25 2 Nanobiosensor

fev 2005: 1 5 Clítoris , 2 4 São Paulo , 3 4 Filloa , 4 3 Abadexo , 5 3 Basilio o Grande , 6 3 Akita , 7 3 Akashi , 8 3 A Marronda , 9 3 Ernest Shackleton , 10 3 Adamstown , 11 3 Ramirás , 12 3 Abadín , 13 3 Dominio de primeiro nivel , 14 3 2 de xaneiro , 15 3 Lista de países , 16 3 Lugo , 17 3 Santander, Colombia , 18 3 Rosalía de Castro , 19 3 Galicia , 20 3 Mercurio (elemento) , 21 3 Historia do Brasil , 22 3 Alfabeto , 23 2 Ahmedabad , 24 2 Matamá, Vigo , 25 2 Troll

mar 2005: 1 4 Hórreo , 2 4 Ferrol , 3 4 28 de marzo , 4 4 Historia de España , 5 4 España , 6 3 Pandeireta , 7 3 Lista ordenada de elementos químicos , 8 3 Eros , 9 3 Caos , 10 3 Andoriña , 11 3 Xenebra, Suíza , 12 3 Jisaburo Ozawa , 13 3 Abruñeiro , 14 3 Abrótano macho , 15 3 Lawrence Alma-Tadema , 16 3 Rato (informática) , 17 3 Basilio o Grande , 18 3 ADSL , 19 3 5 de xaneiro , 20 3 Guerra fría , 21 3 4 de xaneiro , 22 3 Países Baixos , 23 3 Camilo José Cela , 24 3 Rato , 25 3 Nós

abr 2005: 1 6 Cataluña , 2 6 Galicia , 3 5 Canadá , 4 5 Partido dos Socialistas de Galicia , 5 5 España , 6 4 Identidade Galega , 7 4 Digamma , 8 4 Cruzadas , 9 4 C (linguaxe de programación) , 10 4 Alberte I de Mónaco , 11 4 Billarda , 12 4 28 de abril , 13 4 3 de xaneiro , 14 4 Dinamarca , 15 3 Pandeireta , 16 3 Tony Blair , 17 3 Dseta , 18 3 Abraham Lincoln , 19 3 Delta (letra) , 20 3 Praia de Riazor , 21 3 Navegador web , 22 3 Emilio Pérez Touriño , 23 3 Anxo Quintana , 24 3 Sofía de Prusia , 25 3 Constantino I de Grecia

mai 2005: 1 5 CORBA , 2 4 Dolmen , 3 4 Ribadeo, Ribadeo , 4 4 Illa de San Martiño, O Vicedo , 5 3 Frédéric Mistral , 6 3 Pataca , 7 3 Raíz cadrada , 8 3 Vilasobroso, Mondariz , 9 3 Turcomenistán , 10 3 Mar Caspio , 11 3 Romaría das Cruces , 12 3 A Ponte, Arante, Ribadeo , 13 3 Sudán , 14 3 Osvobodilna Fronta , 15 3 France Prešeren , 16 3 Compoñente de software , 17 3 Unidade Galega (coalición) , 18 3 Partido Galeguista (1978) , 19 3 Esquerda Galega , 20 3 Partido Obreiro Galego , 21 3 Peer-to-peer , 22 3 Object Management Group , 23 3 XML , 24 3 Partido Popular Galego , 25 3 Partido Galego Social Demócrata

jun 2005: 1 4 Vaca , 2 4 Francia , 3 3 Final Fantasy , 4 3 Apple Inc. , 5 3 Batman , 6 3 Ana Paula Arósio , 7 3 Thor (banda deseñada) , 8 3 Disco ríxido , 9 3 Casto Sampedro Folgar , 10 3 Zen , 11 3 Final Fantasy VII , 12 3 Monte Etna , 13 3 Cataluña , 14 3 Kitesurf , 15 3 Os doce traballos de Hércules , 16 3 Frauta doce , 17 3 Mariola (xogo) , 18 3 Convento de San Francisco do Val de Deus , 19 3 Gaita galega , 20 3 Portocubelo, Lira, Carnota , 21 3 Ramón Armada Teixeiro , 22 3 Reintegracionismo , 23 3 Escocia , 24 3 Partido Popular de Galicia , 25 3 A Pobra do Caramiñal

jul 2005: 1 4 Estatuto de autonomía de Galicia de 1981 , 2 4 Vilalba , 3 4 A Coruña , 4 4 Wiki , 5 3 Xunta de Galicia , 6 3 Massachusetts , 7 3 Guerra dos Seis Días , 8 3 Mendinho , 9 3 Tigre , 10 3 Trinidad e Tobago , 11 3 Xabier Barreiro Liz , 12 3 Niccolò Paganini , 13 3 Wolfgang Amadeus Mozart , 14 3 Giuseppe Verdi , 15 3 Alexandre o Grande , 16 3 Sun Tzu , 17 3 Trotskismo , 18 3 Montevideo , 19 3 Illas Ashmore e Cartier , 20 3 Mahatma Gandhi , 21 3 Bosnia - Hercegovina , 22 3 Ext3 , 23 3 Proxecto Apollo , 24 3 Elemento químico , 25 3 Santiago de Compostela

ago 2005: 1 4 A Coruña , 2 3 Quioto , 3 3 Lista de papas , 4 3 Monte Pindo , 5 3 Tomate , 6 3 Historia de México , 7 3 Laborie, Santa Lucía , 8 3 Cáncer , 9 3 Ponferrada , 10 3 Rondonia , 11 3 Bretaña , 12 3 Figura estilística , 13 3 Río Xallas , 14 3 Asterix , 15 3 Río Tambre , 16 3 Mahoma , 17 3 Luar na lubre , 18 3 As Burgas , 19 3 Culleredo , 20 3 Castropol , 21 3 Amazonas , 22 3 Ría de Arousa , 23 3 Lago , 24 3 Galicia , 25 3 Pesca

set 2005: 1 5 Silva, Pol , 2 4 Lingua galega , 3 3 Silano , 4 3 Milladoiro , 5 3 Encoro , 6 3 Illa da Altura , 7 3 Regato de Saímes , 8 3 Silva , 9 3 Silva, Silva, Pol , 10 3 Muralla de Lugo , 11 3 Arco (arquitectura) , 12 3 Nova Orleáns , 13 3 Fuji , 14 3 Papiro , 15 3 Imperio Romano , 16 3 Roma antiga , 17 3 Milladoiro (grupo musical) , 18 3 Río Ulla , 19 3 William Shakespeare , 20 3 1 , 21 3 Touro , 22 3 Lingua latina , 23 3 Luz , 24 2 Sete marabillas do mundo , 25 2 Microsoft Office

out 2005: 1 5 Palestina (rexión) , 2 4 Ramón Sampedro , 3 4 Ribadeo , 4 3 Ponte dos Santos , 5 3 Ourizo cacho , 6 3 Período helenístico , 7 3 Rapa das bestas , 8 3 Illa Jarvis , 9 3 Curitiba , 10 3 Trastorno bipolar , 11 3 Castelo de area , 12 3 Folión dos carros , 13 3 Shiatsu , 14 3 Mar de Mármara , 15 3 Texas , 16 3 Marguerite Duras , 17 3 Lei de Grimm , 18 3 Antífrase , 19 3 Luar na lubre , 20 3 Gripe aviaria , 21 3 4 de novembro , 22 3 Marín , 23 3 Microsoft Windows , 24 3 Ferrol , 25 3 América

nov 2005: 1 5 Chile , 2 5 Galicia , 3 4 Lista de volcáns , 4 4 Idade Media , 5 3 Muro de Berlín , 6 3 Canedo, Ourense , 7 3 A Galicia feudal , 8 3 Sacaúntos , 9 3 Catro , 10 3 Conflitos e sublevacións no Brasil , 11 3 Bésta , 12 3 Historia da pintura en Creta , 13 3 Smog gris , 14 3 Grecia antiga , 15 3 Afonso II de Asturias , 16 3 Castros de Punta Neixón , 17 3 Felicidade , 18 3 Carmina Burana , 19 3 Bamiro, Vimianzo , 20 3 Michelangelo , 21 3 Nova Jersey , 22 3 Estado de Washington , 23 3 Trigonometría , 24 3 Volcán , 25 3 Armenia

dez 2005: 1 5 Ribadeo , 2 4 Estados dos Estados Unidos de América , 3 4 Suráfrica , 4 4 Ribeira , 5 4 Baiona , 6 4 Literatura , 7 3 Lingua galó , 8 3 Bacallau , 9 3 Chihuahua (can) , 10 3 Declaración Universal dos Dereitos Humanos , 11 3 Os Picapedra , 12 3 John Ford , 13 3 Xéneros e formas literarias , 14 3 Autodefensas Unidas de Colombia , 15 3 Seúl , 16 3 Quebec , 17 3 Hawai , 18 3 Tíbet , 19 3 Quilogramo , 20 3 20 de decembro , 21 3 31 de decembro , 22 3 A Estrada , 23 3 Armenia , 24 3 BitTorrent , 25 3 California

jan 2006: 1 4 Galiza Nova , 2 4 Lista de filmes con versión en galego , 3 4 Lobo , 4 4 Alfabeto Fonético Internacional , 5 4 Miguel de Cervantes , 6 4 Galicia , 7 4 Música , 8 3 Xosé Luís Méndez Ferrín , 9 3 O planeta dos simios , 10 3 Avant Browser , 11 3 Publio Cornelio Escipión o Africano , 12 3 Tarragona , 13 3 Comités Abertos de Faculdade , 14 3 ATI Technologies , 15 3 Desenvolvemento sustentábel , 16 3 Álvaro Cunqueiro , 17 3 Lista de emperadores romanos , 18 3 Gala Placidia , 19 3 Anicio Olibrio , 20 3 Anicio Boecio , 21 3 Linguas crioulas , 22 3 Escrita cuneiforme , 23 3 Dinastía Omeia , 24 3 Francis Drake , 25 3 Galia

fev 2006: 1 4 Bloque Nacionalista Galego , 2 4 Galicia , 3 3 Canedo , 4 3 San Clodio, Leiro , 5 3 Centros de Formación e Recursos , 6 3 Devasa (informática) , 7 3 Futbolín , 8 3 Catedral de Santiago de Compostela , 9 3 Safari (navegador) , 10 3 Ceilán , 11 3 Gaza , 12 3 PowerPC , 13 3 Lucía Aldao , 14 3 GameCube , 15 3 Aníbal Cavaco Silva , 16 3 Pastafarismo , 17 3 Caudal (fluído) , 18 3 Tenerife , 19 3 Grego capadocio , 20 3 Estremadura , 21 3 Genghis Khan , 22 3 System of a down , 23 3 Novela , 24 3 Al Qaida , 25 3 Faixa de Gaza

mar 2006: 1 4 Aeroportos de Galicia , 2 4 José Ricardo Díaz Pardeiro , 3 4 Atentados do 11 de marzo de 2004 en Madrid , 4 4 Bandeira de Galicia , 5 4 Galicia , 6 3 Run , 7 3 Uxío Novoneyra , 8 3 Altofalante , 9 3 A arte da guerra , 10 3 Sniffer , 11 3 Topoloxía de rede , 12 3 Cataluña , 13 3 Xeorxia , 14 3 Acerbaixán , 15 2 Porto do Son , 16 2 Orella , 17 2 C. J. Cherryh , 18 2 1399 , 19 2 1400 , 20 2 1401 , 21 2 1402 , 22 2 1403 , 23 2 1404 , 24 2 1405 , 25 2 1406

abr 2006: 1 6 País Vasco , 2 6 Filloa , 3 5 Galicia , 4 4 Mugardos , 5 3 Galería de imaxes de Mugardos , 6 3 Galería de imaxes de Lugo , 7 3 Six Feet Under , 8 3 Castela-A Mancha , 9 3 Celestino I, papa , 10 3 Cracker , 11 3 JPEG , 12 3 Extraterrestre , 13 3 Clima , 14 3 Cataluña , 15 3 Comunidade Valenciana , 16 3 Café , 17 3 Nós-Unidade Popular , 18 3 Camboxa , 19 3 Alemaña , 20 3 Real Academia Galega , 21 2 Francisco Franco , 22 2 Interface gráfica de usuario , 23 2 Buenaventura Durruti , 24 2 Radioactividade , 25 2 Porto do Son

mai 2006: 1 7 Galicia , 2 6 Vigo , 3 5 Enric Miralles , 4 5 Carlos V, Sacro Emperador Romano-Xermánico , 5 5 Ith , 6 5 Batalla de Pavía , 7 4 Petra , 8 4 Heart of Midlothian F.C. , 9 4 Rangers F.C. , 10 4 Cámara de Faraday , 11 4 Moebius , 12 4 Batalla de Salamina , 13 4 Sebastianismo , 14 4 Muiñeira , 15 4 Nerva , 16 4 Vitelio , 17 4 Porto do Son, Noal, Porto do Son , 18 4 Manuel Lugrís Freire , 19 4 Ghana , 20 4 Costa Rica , 21 4 Serbia e Montenegro , 22 4 Albany, Nova York , 23 4 17 de maio , 24 3 Porto do Son , 25 3 Tomé de Aquino

jun 2006: 1 8 Galicia , 2 6 Cataluña , 3 5 Lingua aragonesa , 4 5 Irlanda , 5 5 Cuba , 6 5 Portugal , 7 4 Partido Popular , 8 4 Nacionalismo vasco , 9 4 Partido Nacionalista Vasco , 10 4 Arpa , 11 4 Caracalla , 12 4 Parque Arqueolóxico da Arte Rupestre , 13 4 Iparralde , 14 4 Cataluña do Norte , 15 4 Estreleira , 16 4 New Deal , 17 4 Cristina Pato , 18 4 FC Bayern München , 19 4 Irán , 20 4 Segunda guerra mundial , 21 4 Europa , 22 4 A Coruña , 23 3 Polbo , 24 3 Estalactita , 25 3 UCI ProTour

jul 2006: 1 7 Óscar Pereiro , 2 5 Treboniano Galo , 3 5 Galicia , 4 4 Día Nacional de Galicia , 5 4 House (serie de televisión) , 6 4 Parque Nacional de Mu Co Chan , 7 4 Praia da Lavanqueira , 8 4 Gordiano I , 9 4 Agora é sempre , 10 4 Alexandre Severo , 11 4 Rosalía de Castro , 12 4 Vigo , 13 3 Daniel Kessler , 14 3 Emanuel Lasker , 15 3 Ana Guevara , 16 3 Galieno , 17 3 Henrique V (teatro) , 18 3 Moscovita , 19 3 Petroloxía , 20 3 Ágreda , 21 3 Valeriano , 22 3 Pardo de Cela , 23 3 Emiliano , 24 3 House , 25 3 Decio

ago 2006: 1 5 Guerra civil española , 2 5 Galicia , 3 4 Manuel Godoy , 4 4 Fascismo , 5 4 El Gran Wyoming , 6 4 Santiago Casares Quiroga , 7 4 Barbantesa , 8 4 Castelo do Castrodouro , 9 4 Mario , 10 4 Pardo de Cela , 11 4 House (serie de televisión) , 12 4 Miguel de Cervantes , 13 4 2006 , 14 4 Matemáticas , 15 4 Deportivo da Coruña , 16 4 Historia de España , 17 4 Astronomía , 18 3 Galiza Nova , 19 3 Buenaventura Durruti , 20 3 Cladoxénese , 21 3 Fernando VII , 22 3 Píllara riscada , 23 3 Isabel II de España , 24 3 Armée Révolutionnaire Bretonne , 25 3 Estanislao Figueras

set 2006: 1 5 Lingua galega , 2 4 Metallica , 3 4 Nomenclátor de Galicia , 4 4 Hórreo , 5 4 Outeiro de Rei , 6 4 Editorial Galaxia , 7 4 Galicia , 8 3 País Vasco , 9 3 Mirón , 10 3 Curtametraxe , 11 3 Álex de la Iglesia , 12 3 Coia, Vigo , 13 3 Adarga , 14 3 Thrash metal , 15 3 Dios ke te crew , 16 3 Río San Lázaro , 17 3 A Ponte Maceira, Portor, Negreira , 18 3 Xaime Quintanilla Martínez , 19 3 Miguel Barros , 20 3 Xosé Luís Barreiro Rivas , 21 3 Diego Xelmírez , 22 3 Historia da Coruña , 23 3 Comunidade autónoma , 24 3 Gaélico irlandés , 25 3 Tourón

out 2006: 1 4 Marco Antonio , 2 4 Castro das Grobas , 3 4 Lingua telugúa , 4 4 Aquiles , 5 4 Cova do Rei Cintolo , 6 4 Nós-Unidade Popular , 7 4 Deportivo da Coruña , 8 3 Comunicación síncrona , 9 3 Iguanodonte , 10 3 Parlamento escocés , 11 3 Lista de extensións de ficheiros , 12 3 CSS , 13 3 Amílcar Barca , 14 3 Paul Gauguin , 15 3 Paul Cézanne , 16 3 Zaphod Beeblebrox , 17 3 Björk , 18 3 Dresden , 19 3 Cegoña negra , 20 3 Fuenlabrada , 21 3 Leganés , 22 3 Copa Galiza de fútbol , 23 3 Harpo Marx , 24 3 Xénova , 25 3 Lista de concellos de Ourense

nov 2006: 1 4 Teorema de Thévenin , 2 4 Wii , 3 4 Atentados do 11 de setembro de 2001 , 4 4 Lingua galega , 5 3 Serra da Enciña da Lastra , 6 3 Wilhelm Röntgen , 7 3 Canguro , 8 3 Afluente , 9 3 Xoguetes para un tempo prohibido , 10 3 ReNova Galiza , 11 3 Casa dos Toubes , 12 3 Osmo, Cenlle , 13 3 Cenlle, Cenlle, Cenlle , 14 3 A Quintá, Cenlle, Cenlle , 15 3 Cenlle, Cenlle , 16 3 Vulgarismo , 17 3 Pano de aceiro , 18 3 2062 Atón , 19 3 Julian Barnes , 20 3 433 Eros , 21 3 Economía de Chile , 22 3 Roger Federer , 23 3 Lista de extensións de ficheiros , 24 3 Carlos Velo , 25 3 Jimbo Wales

dez 2006: 1 5 Edvard Munch , 2 5 Wassily Kandinsky , 3 5 O lapis do carpinteiro , 4 5 Cabanas , 5 4 Veiga, A Pobra do Brollón , 6 4 Automobilismo , 7 4 Postimpresionismo , 8 4 Premio Xerais , 9 4 Cádavos, A Mezquita , 10 4 Canguro , 11 4 Miranda, Castroverde , 12 4 Castros de Galicia , 13 4 Heredeiros da Crus , 14 4 Fidel Castro , 15 4 A Pobra de Trives , 16 4 Marín , 17 4 Bloque Nacionalista Galego , 18 4 Moscova , 19 4 As Pontes de García Rodríguez , 20 3 Cidade Ho Chi Minh , 21 3 Louis Pasteur , 22 3 Cloroplasto , 23 3 Ferreiros, A Pobra do Brollón , 24 3 A Ferreirúa, A Pobra do Brollón , 25 3 Piño, A Pobra do Brollón

jan 2007: 1 5 Aerosmith , 2 4 Francisco Fernández del Riego , 3 4 Cruceiro , 4 4 House (serie de televisión) , 5 4 Premio Nobel de Literatura , 6 4 Fernando Vázquez , 7 4 Vía Nova , 8 3 Johán Carballeira , 9 3 Pelota vasca , 10 3 Andrés de Prada e Gómez de Santalla , 11 3 Lista de prefixos telefónicos de España , 12 3 Adam Smith , 13 3 American Beauty , 14 3 Antroponimia , 15 3 The New York Dolls , 16 3 Cantiga de amor , 17 3 Borsod-Abaúj-Zemplén , 18 3 Tolueno , 19 3 Isidro Parga Pondal , 20 3 Biduedo, Pedrafita de Camporredondo, Baralla , 21 3 Condados de Hungría , 22 3 Ryszard Kapuściński , 23 3 Miliario , 24 3 Asterisk , 25 3 Ana Turpin

fev 2007: 1 4 Xulio Nepote , 2 4 Pascal (unidade) , 3 4 Avito , 4 4 Valentiniano II , 5 4 Pedro Madruga , 6 4 Diego Armando Maradona , 7 3 Philipp Lenard , 8 3 Lauburu vasco , 9 3 Ron , 10 3 Brandy , 11 3 Patricio de Irlanda , 12 3 Stéphane Mallarmé , 13 3 Chip , 14 3 Ciclo de desenvolvemento , 15 3 Lábaro , 16 3 Valentín de Terni , 17 3 Panteras Grises , 18 3 Panteras Negras , 19 3 Maioriano , 20 3 Albino Núñez Domínguez , 21 3 Petronio Máximo , 22 3 Castelo da Rocha Forte , 23 3 Stephen Jay Gould , 24 3 Bacanal , 25 3 Lupercais

mar 2007: 1 6 IES Lamas de Castelo , 2 6 Literatura galega do século XX , 3 5 Lingua leonesa , 4 4 Tornado , 5 4 Bioestratinomía , 6 4 Lista de reis de Portugal , 7 4 Azor , 8 4 Castelo de Tebra , 9 4 Lingua mirandesa , 10 4 Biblos , 11 4 Merlín , 12 4 Prodemar , 13 4 Piscifactoría , 14 4 Castelo de Sobroso , 15 4 Pedro Madruga , 16 4 Batalla das Termópilas , 17 4 Lingua galesa , 18 4 Los Tamara , 19 4 Lingua portuguesa , 20 3 Literatura galega dos Séculos Escuros , 21 3 Ribosoma , 22 3 Fritz Strassmann , 23 3 Piñeiro (homónimos) , 24 3 Citoesqueleto , 25 3 Xenética molecular

abr 2007: 1 6 Nacionalismo galego , 2 5 La Figuera , 3 4 The Simpsons , 4 4 Loita , 5 4 Moucho común , 6 4 Conservatorio Nacional de Arte Galega , 7 4 Squash , 8 4 Skate , 9 4 Principado do Pindo e de Moglena , 10 4 Bufo pequeno , 11 4 Xesús Alonso Montero , 12 4 Cesare Pavese , 13 4 René Magritte , 14 4 Pedro Froilaz de Traba , 15 4 Théophile Gautier , 16 4 Ourego , 17 4 Literatura galega dos Séculos Escuros , 18 4 Lista de encoros de Galicia , 19 4 Manuel Comellas , 20 4 Casa Grande de Lentille , 21 4 Soutomaior , 22 4 Vila de Cruces , 23 4 Lista de concellos da Coruña , 24 4 Galicia , 25 3 País Vasco

mai 2007: 1 8 María Mariño , 2 6 Literatura galega dos Séculos Escuros , 3 5 Eleccións municipais de 2007 en Galicia , 4 5 Lingua escocesa , 5 5 Nacionalismo galego , 6 5 Bloque Nacionalista Galego , 7 5 Cabalo , 8 4 Francisco Franco , 9 4 Mesa , 10 4 Ramón Campos Durán , 11 4 Pato chupón , 12 4 Literatura galega do período intersecular , 13 4 Alternativa Canguesa de Esquerdas , 14 4 Garfield e mailos seus amigos , 15 4 Velocidade de escape , 16 4 Garrucho , 17 4 Pena de morte , 18 4 Literatura galega do Rexurdimento , 19 4 Xabier P. DoCampo , 20 4 Francisco Frutos , 21 4 Hogzilla , 22 4 Gyula von Milványi-Csesznegi , 23 4 Literatura galega do século XX , 24 4 Freixo común , 25 4 O detective Conan

jun 2007: 1 6 Literatura galego-portuguesa , 2 5 Led Zeppelin IV , 3 5 Xoán Gato , 4 5 Síndrome de Down , 5 5 Xoán Caboto , 6 5 Bande , 7 5 Cadeira , 8 5 Burro , 9 4 Ielena Ielesina , 10 4 Rosa Mota , 11 4 Notario , 12 4 Vellarrón , 13 4 Tiro con arco , 14 4 Martiño Rivas , 15 4 Eleccións municipais de 2007 en Galicia , 16 4 Batasuna , 17 4 Serra do Xistral , 18 4 Pernileiro , 19 4 Estados Unidos de América , 20 3 Banco Europeo de Investimento , 21 3 Henrique II , 22 3 Biodiésel , 23 3 Roi Xordo , 24 3 Río Vaa , 25 3 Shrek

jul 2007: 1 6 Partido Independentista Portorriqueño , 2 5 Alimentación , 3 5 Rodrigo de Castro Osorio , 4 5 Club Baloncesto Breogán , 5 5 Robert Bruce , 6 5 Illas Galápagos , 7 5 Alonso I de Fonseca , 8 5 Pardo de Cela , 9 5 Prada, A Veiga , 10 5 Alfonso Daniel Rodríguez Castelao , 11 4 Mariscal , 12 4 Ganso paporrubio , 13 4 Henrique VIII de Inglaterra , 14 4 Roberto II de Escocia , 15 4 Matrimonio entre persoas do mesmo sexo , 16 4 Vexetarianismo , 17 4 Gerald Gardner , 18 4 Fiúncho , 19 4 Celtiberos , 20 4 Illa de Jersey , 21 4 Especia , 22 4 Sacro Imperio Romano Xermánico , 23 4 Hans Magnus Enzensberger , 24 4 Teoloxía , 25 4 Mosteiros e conventos de Galicia

ago 2007: 1 6 Estremadura , 2 6 Ourense , 3 6 Vigo , 4 5 2007 , 5 5 Castros de Galicia , 6 5 Roberto Somoza , 7 5 Historia de Galicia , 8 4 Quebraosos , 9 4 Museo do Louvre , 10 4 Ratatouille (filme) , 11 4 The Queen , 12 4 Galicia na Segunda República , 13 4 Cuarta Internacional , 14 4 Castro de San Cibrao de Las , 15 4 Museo de Arte Contemporánea de Vigo , 16 4 Euskadi Ta Askatasuna , 17 4 Río Sar , 18 4 Gallaecia , 19 4 Sanxenxo , 20 4 Estados Unidos de América , 21 4 1 de xaneiro , 22 4 Galicia , 23 3 Francisco Franco , 24 3 Antonio Meucci , 25 3 Frodo Bulseiro

set 2007: 1 9 Vigo , 2 6 Portada , 3 6 Leite callado , 4 6 Vuelta a España 2007 , 5 6 Fragas do Eume , 6 5 Petróglifo , 7 5 Dialecto altonavarro , 8 5 Dialecto suletino , 9 5 Emma Goldman , 10 5 Helen Keller , 11 5 Galicia na Segunda República , 12 5 Antisemitismo , 13 5 Xenocidio armenio , 14 5 Hipergaleguismo , 15 5 España , 16 5 Lingua portuguesa , 17 5 Prestige , 18 4 Francisco Franco , 19 4 Salamántiga rabilonga , 20 4 María Castaña , 21 4 Declaración dos dereitos da muller e da cidadá , 22 4 Rubén Darío , 23 4 Catarina II de Rusia , 24 4 Aras sextianas , 25 4 Teófilo Caamaño

out 2007: 1 7 Thomas Kuhn , 2 7 Fernando Alonso , 3 6 Robert Musil , 4 5 David Batista , 5 5 Val de Aosta , 6 5 Monte Medulio , 7 5 Portada , 8 5 Lewis Hamilton , 9 5 Franquismo , 10 5 José Luis Rodríguez Zapatero , 11 5 Alfonso Daniel Rodríguez Castelao , 12 5 Gato , 13 4 Moloko , 14 4 John Nash , 15 4 John Cena , 16 4 L'Hôpital-Saint-Blaise , 17 4 Os Vilares, Guitiriz , 18 4 Csesznek , 19 4 Paul Ricoeur , 20 4 Castro de Santa Trega , 21 4 Mosteiro de San Vicente do Pino , 22 4 Garfield e mailos seus amigos , 23 4 A-76 , 24 4 Literatura galega do século XX , 25 4 Pórtico da Gloria

nov 2007: 1 6 Rea (lúa) , 2 6 El Greco , 3 6 Piloto , 4 6 Fernando Fernán Gómez , 5 5 Abelardo Miguel , 6 5 Pedro Froilaz de Traba , 7 5 Historia do Reino Unido , 8 5 Castros de Galicia , 9 5 Santiago Ramón y Cajal , 10 5 Galicia , 11 4 Xeosfera , 12 4 Henry Fonda , 13 4 Tetis (lúa) , 14 4 Titán (lúa) , 15 4 Río Guadiana , 16 4 FEVE , 17 4 Pegada ecolóxica , 18 4 Era Compostelá , 19 4 Ennio Morricone , 20 4 Boris Vian , 21 4 Botellón , 22 4 Encelado (lúa) , 23 4 Federación , 24 4 Lewis Hamilton , 25 4 Castro de Santa Trega

dez 2007: 1 6 Bugallo , 2 6 Monte de San Trocado , 3 5 Resistência Galega , 4 5 Encoro de Portodemouros , 5 5 Projecto Mourente , 6 5 Ignorancia , 7 5 Teoría científica , 8 5 Fundación Carlos Casares , 9 5 Eleccións xerais de España de 2008 , 10 5 Xosé Cuíña , 11 4 País Vasco , 12 4 A Rianxeira , 13 4 Unión Progreso y Democracia , 14 4 Encoro de Caldas , 15 4 Club do Mar Ferrol , 16 4 Charly J , 17 4 Club Deportivo Choco , 18 4 Vinte mil leguas baixo dos mares , 19 4 Aegean Sea , 20 4 Sistema de posicionamento global , 21 4 Abelardo Miguel , 22 4 Mosteiro de Santa María de Aciveiro , 23 4 Lista de encoros de Galicia , 24 4 Castelo da Rocha Forte , 25 4 Castro dos Prados

jan 2008: 1 6 Tutankhamon , 2 6 Fragas do Eume , 3 6 Sada , 4 5 Estación depuradora de augas residuais , 5 5 Estación de Ourense - Empalme , 6 5 Rosa Díez , 7 5 Museos de Galicia , 8 5 Historia de Istambul , 9 5 CITES , 10 5 Rafael Mouzo , 11 5 Silleda , 12 4 Miro Casabella , 13 4 Marie Smith Jones , 14 4 Capitel , 15 4 Cabo Vilán , 16 4 Números E , 17 4 Orde , 18 4 Pobreza absoluta , 19 4 A de Carlomagno , 20 4 O holandés errante , 21 4 X-Men Evolution , 22 4 Portela da Laxe , 23 4 Antonio Carballeira Muñiz , 24 4 Amenofis III , 25 4 Cruz celta

fev 2008: 1 5 Manuel Murguía , 2 5 Vigo , 3 4 Mosteiro de Yuste , 4 4 Fedro (Platón) , 5 4 Emilio Araúxo , 6 4 Papagaio Ravachol , 7 4 Dacca , 8 4 Pazo de Meirás , 9 4 Romancero gitano , 10 4 Calendario chinés , 11 4 Emilio Mola , 12 4 Resío , 13 4 Chuvia de animais , 14 4 Clorofluorocarbonos , 15 4 Mascato , 16 4 The Legend of Zelda: A Link to the Past , 17 4 Garri Kasparov , 18 4 Lista de cidades en Portugal , 19 4 Vaca , 20 4 Xosé María Álvarez Blázquez , 21 4 Fidel Castro , 22 4 Eduardo Blanco Amor , 23 4 Alfonso Daniel Rodríguez Castelao , 24 4 Xaquín Lorenzo , 25 4 Entroido

mar 2008: 1 7 Galicia , 2 6 Galeusca , 3 6 A Coruña , 4 6 Lingua galega , 5 5 Jenseits von Gut und Böse , 6 5 Galería de bandeiras dos concellos de Galicia , 7 5 Illa de San Simón , 8 5 Historia da lingua galega , 9 5 Ferrol , 10 5 Lugo , 11 4 Curro , 12 4 David Fernández Ortiz , 13 4 Antón Arias Curto , 14 4 Ocupación de Estonia por Alemaña , 15 4 Galeusca (homónimos) , 16 4 Método D'Hondt , 17 4 Enseada de San Simón , 18 4 Río Grande de Xuvia , 19 4 Vladimir Nabokov , 20 4 José Lage Lage , 21 4 J. K. Rowling , 22 4 José Blanco , 23 4 Escola de Vela Tradicional da Illa de Arousa , 24 4 Muíño , 25 4 Manuel Lugrís Freire

abr 2008: 1 6 Unión de Mulleres Antifascistas , 2 6 Pazo de Meirás , 3 6 Redondela , 4 6 Ferrol , 5 5 Etanol , 6 5 Bebida alcohólica , 7 5 Rafael Mouzo , 8 5 Galicia , 9 4 Gando , 10 4 Santa María la Blanca , 11 4 LeBron James , 12 4 The Battle of Los Angeles , 13 4 Evil Empire , 14 4 Surf-casting , 15 4 Malice Mizer , 16 4 Aditivo , 17 4 ¡Asústate, Merche! , 18 4 María Antonia Iglesias , 19 4 Xosé Chorén , 20 4 Octógono , 21 4 Assembleia da Mocidade Independentista , 22 4 Gallia Narbonensis , 23 4 Queixo , 24 4 Ecosistema , 25 4 Belize

mai 2008: 1 7 Xosé María Álvarez Blázquez , 2 7 Galicia , 3 7 Francia , 4 6 A Voz de Vilalba , 5 5 Galería de imaxes de casas dos concellos de Galicia , 6 5 Mata do porco , 7 5 Dialogues Concerning Natural Religion , 8 5 Ría da Coruña , 9 5 O Grove , 10 5 Karl Marx , 11 4 Encontro Irmandiño , 12 4 Zur Kritik der politischen Ökonomie , 13 4 Zum ewigen Frieden , 14 4 Quiksilver , 15 4 Fernando González \"Gonzo\" , 16 4 Mouzo, Carnés, Vimianzo , 17 4 Retroceso dos glaciares desde 1850 , 18 4 Mario de Langullo , 19 4 Lista de monarcas de Galicia , 20 4 Queimada , 21 4 Queixo San Simón da Costa , 22 4 Casa do Home , 23 4 Lusismo , 24 4 Mugardos , 25 4 A Fonsagrada

jun 2008: 1 7 Galicia , 2 6 Bella ciao , 3 6 Pontevedra , 4 6 España , 5 5 A Avenida de Ordóñez, Goián, Tomiño , 6 5 COPE , 7 5 Monumento á Liberdade , 8 5 Demografía de Galicia , 9 5 Lino Gómez Canedo , 10 5 Eurocopa de Fútbol Austria/Suíza 2008 , 11 5 Noceda, Lalín , 12 5 Festival Internacional do Mundo Celta , 13 5 Goián, Tomiño , 14 5 Narón , 15 5 Santiago de Compostela , 16 5 Vigo , 17 5 Música moderna , 18 4 Anna-Maria Ravnopolska-Dean , 19 4 Lista de grupos que participaron no Festival de Ortigueira , 20 4 Atún vermello , 21 4 Vampiro , 22 4 Os tres Augustos e os cinco Emperadores , 23 4 Campionato do mundo de tríatlon 2008 , 24 4 Sara Montiel , 25 4 Cangues d'Onís

jul 2008: 1 7 Bloque Nacionalista Galego , 2 6 Lamatumbá , 3 6 Lista de universidades de España , 4 6 Vigo , 5 5 Rex, un policía diferente , 6 5 Marcelo Macías , 7 5 A muller biónica , 8 5 Discovery Channel , 9 5 Aldo Manuzio , 10 5 Bret Hart , 11 5 Philosophiæ Naturalis Principia Mathematica , 12 5 Galicia , 13 4 Golfiño (banda deseñada) , 14 4 Lee Friedlander , 15 4 Filgueira, Castro, Cerdedo-Cotobade , 16 4 Cozido à portuguesa , 17 4 César Millán , 18 4 The Matrix , 19 4 Apocalyptica , 20 4 Maria Anna Mozart , 21 4 Nelson Frazier, Jr. , 22 4 Abeto de Douglas , 23 4 Carlos I de Portugal , 24 4 Luís I de Portugal , 25 4 Sally Martin

ago 2008: 1 7 Voo 5022 de Spanair , 2 5 Pazo de Meirás , 3 5 Xogos Olímpicos de 2008 , 4 5 Goián, Tomiño , 5 4 George Steiner , 6 4 Alexandre Nerium , 7 4 Día da Independencia , 8 4 Manuel María Puga Parga , 9 4 Capadocia , 10 4 Helios Gómez , 11 4 Segunda República Española , 12 4 Betanzos , 13 4 Cambados , 14 4 Andorra , 15 4 Vigo , 16 4 Galicia , 17 4 España , 18 3 Stoner rock , 19 3 Bixkek , 20 3 Estación de Bioloxía Mariña da Graña , 21 3 Coralia e Maruxa, as irmás Fandiño , 22 3 Festa do Gaiteiro , 23 3 Bartolomeo Vanzetti , 24 3 Nicola Sacco , 25 3 Mercedes Castro Díaz

set 2008: 1 7 Pazo de Meirás , 2 6 Gran colisor de hadróns , 3 4 Seseo , 4 4 Ambiente de escritorio , 5 4 Eduardo Ferreirós Boullosa , 6 4 Xoán de Gante , 7 4 Organización Europea para a Investigación Nuclear , 8 4 Esterno , 9 4 A Veronza, Carballeda, Carballeda de Avia , 10 4 Reino de Galicia , 11 3 Praia de Carnota , 12 3 Flickr , 13 3 Rótula , 14 3 Kaspar Capparoni , 15 3 Bomba , 16 3 Billions and Billions , 17 3 Miguel Anxo Fernández Lores , 18 3 Roland Ratzenberger , 19 3 Dorado (homónimos) , 20 3 Coroa de Castela , 21 3 Ría de Abres (homónimos) , 22 3 Lapislázuli , 23 3 Taifa , 24 3 Guerra dos Cen Anos , 25 3 Xoán Fernández de Andeiro

out 2008: 1 7 Illa de San Simón , 2 7 Google , 3 6 Amancio Ortega , 4 5 Ramiro Fonte , 5 5 Galicia , 6 5 Lingua galega , 7 4 A morte na cultura popular galega , 8 4 Lareira , 9 4 Aparello dixestivo , 10 4 Marce, Vilar de Ortelle, Pantón , 11 4 Biotecnoloxía , 12 4 Torre da Penela , 13 4 Colombo (serie de televisión) , 14 4 Euskadi Ta Askatasuna , 15 4 Vigo , 16 3 Dumbo , 17 3 Láchar , 18 3 Watergate , 19 3 Martin Weinek , 20 3 Glándula salivar , 21 3 Parlamento de Andalucía , 22 3 Cegoñal , 23 3 Ab 18 , 24 3 Torre de Marce , 25 3 Xusto Beramendi

nov 2008: 1 6 Pazo Baión , 2 6 Carnota , 3 5 Teresa Pedrosa , 4 5 Praia América , 5 4 Eugène Ionesco , 6 4 O lobo na cultura popular galega , 7 4 James Watt , 8 4 Revolución Cubana , 9 4 Cortadeira , 10 4 Glicóxeno , 11 4 Napoleón III de Francia , 12 4 Demi Lovato , 13 4 Enxeñaría xenética , 14 4 Aria Giovanni , 15 4 Lexionario , 16 4 Independientes por Ferrol , 17 4 O porco na cultura popular galega , 18 4 Juan Camilo Mouriño , 19 4 Barack Obama , 20 4 Francisco Sampedro , 21 4 Telecinco , 22 4 Rioaveso, Vilalba , 23 4 Couto Mixto , 24 4 Castro , 25 4 Historia de Inglaterra

dez 2008: 1 7 Alfonso Daniel Rodríguez Castelao , 2 7 Galicia , 3 6 Selección de fútbol de Galicia , 4 6 Reino de Galicia , 5 5 Caudal ecolóxico , 6 5 Glicoproteína , 7 5 Ubuntu (GNU/Linux) , 8 4 El coronel no tiene quien le escriba , 9 4 A Igrexa, Chapela, Redondela , 10 4 Biótopo , 11 4 Bandeira da Comunidade Valenciana , 12 4 Licor 43 , 13 4 Serafín Martínez Acevedo , 14 4 Especie eurióica , 15 4 IES Canido , 16 4 Nivel trófico , 17 4 Confessiones , 18 4 Mikel Laboa , 19 4 Xacobeo Galicia , 20 4 Subespecie , 21 4 Jesús Vázquez Martínez , 22 4 Cataluña , 23 4 Manuel Rivas , 24 4 Burela , 25 4 Monforte de Lemos

jan 2009: 1 8 Reino de Galicia , 2 6 Francia , 3 5 Estratopausa , 4 5 Lista de concellos de España por poboación , 5 5 Arte prerrománica , 6 5 Escola Naval Militar de Marín , 7 5 A morte na cultura popular galega , 8 5 Xoán Gato , 9 5 Movemento pola Base , 10 5 Alfonso Daniel Rodríguez Castelao , 11 4 Xesús Fraga , 12 4 Lemon of Troy , 13 4 Sedimento , 14 4 Salto, Uruguai , 15 4 Transliterar , 16 4 Orbital atómico , 17 4 Mucha e Nucha , 18 4 Eleccións ao Parlamento de Galicia 2009 , 19 4 Valenciano , 20 4 Urania Mella , 21 3 Ecualizador , 22 3 Phaeophyceae , 23 3 N-536 , 24 3 Apalpador , 25 3 Deputación de Pontevedra

fev 2009: 1 9 Eleccións ao Parlamento de Galicia 2009 , 2 6 Entroido , 3 5 Bolero , 4 5 Ad libitum , 5 5 Xil Ríos , 6 5 Reino de Galicia , 7 4 Francisco Javier Cobián Salgado , 8 4 Misa , 9 4 IES Monte Carrasco , 10 4 Doutrina social da Igrexa , 11 4 Beatus ille , 12 4 Esmagamento por elefante , 13 4 José Lezama Lima , 14 4 Eurípides , 15 4 Incendiario , 16 4 Touros de Guisando , 17 4 Santa Compaña , 18 4 Sarria , 19 4 Maceda , 20 4 Francia , 21 3 Montecristo , 22 3 Victoria Abril , 23 3 Fronte cálida , 24 3 Ave, Caesar, morituri te salutant , 25 3 Tropopausa

mar 2009: 1 9 Eleccións ao Parlamento de Galicia 2009 , 2 8 Retrete , 3 6 Alberto Núñez Feijóo , 4 5 Mojinos escozíos , 5 5 Emilio Pérez Touriño , 6 5 Reino de Galicia , 7 5 Galicia , 8 5 Hip hop , 9 4 Hay alguien ahí , 10 4 Rosa Porriño , 11 4 Summum ius summa iniuria , 12 4 Praia de Area das Vacas , 13 4 Radagast , 14 4 Cómplices , 15 4 Sly Cooper , 16 4 Fracción do Exército Vermello , 17 4 Árbitro (deporte) , 18 4 Vladimir Lenin , 19 4 Afonso I de Aragón , 20 4 SpongeBob SquarePants , 21 4 Eva Perales , 22 4 Provincia marítima , 23 4 Selección de rugby de Escocia , 24 4 Doutrina social da Igrexa , 25 4 Spaßguerilla

abr 2009: 1 9 Ramón Piñeiro , 2 7 Escudo de Exipto , 3 7 Contixe, Tourón, Ponte Caldelas , 4 7 Vilarchán, Tourón, Ponte Caldelas , 5 7 Dodro , 6 6 Arturo Díaz , 7 6 Raúl Alfonsín , 8 6 Alberto Núñez Feijóo , 9 6 Partido Popular de Galicia , 10 5 Destilación fraccionada , 11 5 Lady Gaga , 12 5 Basílica do Sacré Cœur , 13 5 Twilight (filme de 2008) , 14 5 José Fernando Vila Brión , 15 5 Guillerme Vázquez , 16 5 Matalobos (serie de televisión) , 17 5 O retrato de Dorian Gray , 18 5 Ángeles González-Sinde , 19 5 Lingua leonesa , 20 5 Partido dos Socialistas de Galicia , 21 4 Xunta de Galicia , 22 4 Pro Evolution Soccer 2009 , 23 4 Gripe A (H1N1) , 24 4 Kamel Ghilas , 25 4 Portugaliza (revista)

mai 2009: 1 22 A Pobra do Caramiñal , 2 9 Futbol Club Barcelona , 3 8 Lingua galega , 4 7 Toxicidade do paracetamol , 5 7 Ramón Piñeiro , 6 6 Río Támega , 7 6 Vilarchán, Tourón, Ponte Caldelas , 8 6 Rabal, Oímbra , 9 5 Toxicidade da cocaína , 10 5 Toxicidade dos sales de litio , 11 5 Iván Costa Blanco , 12 5 Manifestación polo galego en maio de 2009 , 13 5 Alfonso Daniel Rodríguez Castelao , 14 5 Psicoloxía , 15 4 Yaracuy , 16 4 Teratóxeno , 17 4 Peito , 18 4 Torupill , 19 4 Ben falado! , 20 4 Katie Holmes , 21 4 Minaría , 22 4 Iniciativa Internacionalista , 23 4 Acceso , 24 4 Feísmo , 25 4 Arantza Quiroga

jun 2009: 1 15 A Pobra do Caramiñal , 2 7 Michael Jackson , 3 6 Aquilino Iglesia Alvariño , 4 5 Toxicidade da cocaína , 5 5 Antídoto , 6 5 Voo 447 de Air France , 7 5 Teratóxeno , 8 5 Bloque Nacionalista Galego , 9 5 Reino de Galicia , 10 5 Galicia , 11 4 Xosé Luís Méndez Ferrín , 12 4 Irmandades da Fala , 13 4 Arde Lucus , 14 4 Haluro , 15 4 Castro de Moreira , 16 4 Galicia estremeira , 17 4 Galinux-Ubuntu , 18 4 Presidente da Unión Soviética , 19 4 Intoxicación etílica , 20 4 Marcelino Pardal Pouso , 21 4 Club de Mar Ría de Aldán , 22 4 Unión Coruñesa , 23 4 Demanda Química de Osíxeno , 24 4 Lei marcial , 25 4 Toxicidade do cánnabis

jul 2009: 1 6 Robert Bosch GmbH , 2 5 Xosé Antonio Touriñán , 3 5 A sereíña , 4 5 Litografía , 5 5 Fala de Estremadura , 6 5 Gonzalo Torrente Ballester , 7 5 Moeche , 8 5 A Fonsagrada , 9 4 Iago Aspas , 10 4 Stieg Larsson , 11 4 Técnica de impresión , 12 4 Peltre , 13 4 Síndrome de Alicia no país das marabillas , 14 4 Poeta en Nueva York , 15 4 Dettifoss , 16 4 Reyðarfjörður , 17 4 Lugh , 18 4 Toxicidade da heroína , 19 4 A sereíña (estatua) , 20 4 Sardeña , 21 4 Lingua castelá , 22 4 Pitufo , 23 4 Lince ibérico , 24 4 Manuel Rivas , 25 4 Vila de Cruces

ago 2009: 1 7 Euskadi Ta Askatasuna , 2 6 Viana do Bolo , 3 5 As Meninas , 4 4 Fento , 5 4 John Hendley Barnhart , 6 4 Vanessa Paradis , 7 4 Willy DeVille , 8 4 Josefa de Bastavales , 9 4 Alfonso Vilar Lamelas , 10 4 Contra proferentem , 11 4 José Calvo Sotelo , 12 4 A Rianxeira , 13 4 Rizoma , 14 4 Guerra dos Trinta Anos , 15 4 Cangas , 16 4 Vigo , 17 3 Cindy Crawford , 18 3 Zac Efron , 19 3 Bartolomeu de Nosendo , 20 3 The Office (NBC) , 21 3 Dev Patel , 22 3 Limbo foliar , 23 3 Fronde , 24 3 Folíolo , 25 3 Equipo Crónica

set 2009: 1 8 Buño, Malpica de Bergantiños , 2 7 Ponte Lubiáns , 3 7 Lingua leonesa , 4 7 Deportivo da Coruña , 5 6 Kilt , 6 5 Oleiros de Buño , 7 5 Consello dos Estados , 8 5 Hidrografía de Galicia , 9 5 Bibimbap , 10 5 Cántigas da Terra , 11 5 As Meninas , 12 5 Historia postal , 13 5 Illas Sisargas , 14 5 Costa da Morte , 15 5 Yoshito Usui , 16 4 Castro de San Millao , 17 4 Suíza xermanófona , 18 4 Dionisio Gamallo , 19 4 Exaculación , 20 4 San Galo , 21 4 Forte da Ínsua , 22 4 Audrey Tautou , 23 4 Lírica , 24 4 Marie Fredriksson , 25 4 Río Vouga

out 2009: 1 8 Xavier Lama , 2 6 Furacán Hortensia de 1984 , 3 6 Celtismo , 4 6 Andrés Montes , 5 5 Central térmica de Meirama , 6 5 Manzaneda , 7 5 Páxina web , 8 4 Narón TV , 9 4 Monte Xalo , 10 4 Castro (automóbil) , 11 4 Citroën Visa , 12 4 Kilt , 13 4 Xiana Arias , 14 4 Valenciano , 15 4 Xavier Prado Rodríguez , 16 4 Bandeira de Galicia , 17 4 Celta , 18 4 Daniel Cortezón , 19 4 Silleda , 20 3 Os Bolechas , 21 3 La Cuadra , 22 3 Aldara de Celanova , 23 3 Soutelo, Sobreganade, Porqueira , 24 3 San Mamede de Sobreganade, Sobreganade, Porqueira , 25 3 Faramontaos, San Martiño de Porqueira, Porqueira

nov 2009: 1 8 Molly Malone , 2 8 Goto Muñiz , 3 7 Carlos Velo , 4 6 2009 , 5 5 Gaita asturiana , 6 5 Xan das Bólas , 7 5 Andrea Pirlo , 8 5 Ferentino , 9 5 Appenzell , 10 5 Reino de Nova Galicia , 11 5 Claude Lévi-Strauss , 12 5 Primeira guerra mundial , 13 5 Galicia , 14 4 Ramón Nonato , 15 4 O Rapote, Broño, Negreira , 16 4 Lista de Illas do Xapón , 17 4 Catherine Ashton , 18 4 Palacio de Buckingham , 19 4 Baserri , 20 4 Atmosfera , 21 4 Scott Cunningham , 22 4 Zlatan Ibrahimović , 23 4 Liga de Campións da UEFA 2008-09 , 24 4 Morgan Robertson , 25 4 Esparreguera

dez 2009: 1 6 Xoán Abeleira , 2 6 Ponteareas , 3 6 Galicia , 4 5 C-531 , 5 5 Asente , 6 5 Nino Bravo , 7 5 Dani Pedrosa , 8 5 Rede social , 9 5 Caldo galego , 10 4 Terry Eagleton , 11 4 Buxaina (banda) , 12 4 Literatura modernista , 13 4 RadioVoz , 14 4 Fernando I, Duque de Bragança , 15 4 Servizo de Protección da Natureza da Garda Civil , 16 4 Jorge Mira , 17 4 Pías, Ponteareas , 18 4 A Cañiza , 19 4 Lugo , 20 4 Ourense , 21 3 Incertae sedis , 22 3 Emil Constantinescu , 23 3 ¿Cuándo se come aquí? , 24 3 Grace Paley , 25 3 O Muíño, Cesullas, Cabana de Bergantiños

jan 2010: 1 8 Breogán , 2 7 Festival de Eurovisión 2010 , 3 5 Juan Francisco Ordóñez , 4 5 Panificadora de Vigo , 5 5 Radio 3 , 6 5 Serea , 7 5 Deportivo da Coruña , 8 4 IPad , 9 4 Estevesiños, Estevesiños, Monterrei , 10 4 Albarellos, Albarellos, Monterrei , 11 4 Foxo de lobo , 12 4 Salto de trampolín , 13 4 Gasterópodos , 14 4 Sarna , 15 4 MacGyver , 16 4 Dosmasunoarquitectos , 17 4 Grande Esfinxe de Gizeh , 18 4 Os Carunchos , 19 4 Isaac Alonso Estraviz , 20 4 Culto á personalidade , 21 4 Loita de guerrillas , 22 4 Donón, O Hío, Cangas , 23 4 Vidal , 24 4 Ramón Conde , 25 4 Necrópole de Gizeh

fev 2010: 1 10 Rosa Díez , 2 5 Wikipedia en éuscaro , 3 5 Luís Iglesia , 4 5 Carlos Jiménez , 5 5 Pemento de Padrón , 6 5 Praza da Ferrería , 7 5 Diego Velázquez , 8 5 Vigo , 9 4 Algoritmo de compresión con perda , 10 4 Abertal , 11 4 Carlos Aenlle , 12 4 Crónica de una muerte anunciada , 13 4 Josep Ferrater Mora , 14 4 O soño do falcón , 15 4 Furco, Arcos, Cuntis , 16 4 Xosé Manuel Sánchez Aguión , 17 4 Pía megalítica , 18 4 Grupo Brais Pinto , 19 4 Them Crooked Vultures , 20 4 Aclis ascaris , 21 4 Menhir , 22 4 Xerez Club Deportivo , 23 4 Haumea (planeta anano) , 24 4 Lady Gaga , 25 4 Reis Magos

mar 2010: 1 37 IES Francisco Aguiar , 2 12 O Mintireiro Verdadeiro , 3 11 Dumbo , 4 10 30 Seconds to Mars , 5 9 The Lion King , 6 9 Bambi , 7 8 MÁSmóvil , 8 8 Cinderella (filme de 1950) , 9 7 The Simpsons , 10 7 The Black Cauldron , 11 7 James and the Giant Peach , 12 7 The Nightmare Before Christmas , 13 7 Uxío Novoneyra , 14 7 Fútbol , 15 6 Carlos Meijide , 16 6 Reloxo de sol , 17 6 Os Teletubbies , 18 6 Family Guy , 19 6 Emilia Pardo Bazán , 20 5 Deuses celtas , 21 5 Brothers In Arms: Road to Hill 30 , 22 5 Alfonso Pérez Sánchez , 23 5 Arturo Regueiro , 24 5 Europa (mitoloxía) , 25 5 El alcalde de Zalamea

abr 2010: 1 7 Exilio galego de 1936 , 2 6 Geoffrey Hull , 3 6 Accidente do Tu-154 da Forza Aérea de Polonia , 4 6 Hórreo , 5 5 Talking Heads , 6 5 Hórreo galego , 7 5 Cabo de Cruz, Castro, Boiro , 8 5 Música tradicional galega , 9 5 Shin Chan , 10 5 Luftwaffe , 11 5 Susana Seivane , 12 5 Televisión autonómica , 13 5 Uxío Carré Aldao , 14 5 Guerra civil española , 15 5 Historia da lingua galega , 16 5 Wikipedia , 17 4 Dinastía almorábide , 18 4 Gorka Otxoa , 19 4 Localia Vigo , 20 4 Pica de gorxa rubia , 21 4 Caravasar , 22 4 Socorro García Conde , 23 4 Partido Comunista de Alemaña , 24 4 Corneta , 25 4 Eyjafjallajökull

mai 2010: 1 8 Futbol Club Barcelona , 2 8 Susana Seivane , 3 7 Club Baloncesto Breogán , 4 7 Uxío Novoneyra , 5 6 Antón Lamazares , 6 6 Gato , 7 5 Filipe V de España , 8 5 Vaca , 9 5 Vilasobroso, Mondariz , 10 5 Historia da lingua galega , 11 5 Hórreo , 12 4 Hermenexildo Aloitez , 13 4 Nuno II Mendes , 14 4 Dedo , 15 4 A Naifa , 16 4 Ronnie James Dio , 17 4 Eduardo Mondlane , 18 4 Intel 80386 , 19 4 Hórreo tipo Cedeira , 20 4 Reino de Murcia , 21 4 Reino de Córdoba , 22 4 Reino de Xaén , 23 4 Reino de Sevilla , 24 4 Reino de Toledo , 25 4 Descolonización

jun 2010: 1 10 Alfonso Daniel Rodríguez Castelao , 2 8 Galicia , 3 7 Suero Gómez de Soutomaior , 4 7 Galicia estremeira , 5 7 Paulo Carlos López , 6 6 Cegos: os meus compañeiros , 7 6 Hepatotoxicidade , 8 6 Nefrotoxicidade , 9 6 Garcilaso de la Vega , 10 6 Xoana de Habsburgo , 11 6 Mundial de Fútbol Suráfrica 2010 , 12 6 Historia da lingua galega , 13 6 Vilalba , 14 6 José Saramago , 15 5 Diario 1921 , 16 5 Sabuxo , 17 5 Tour de Francia 2006 , 18 5 A homosexualidade na historia , 19 5 Nordés (vento) , 20 5 Bugs Bunny , 21 5 Dose letal media , 22 5 Brian Joubert , 23 5 Alto alemánico , 24 5 Servizo Galego de Saúde , 25 5 Cambados

jul 2010: 1 6 Nigel Short , 2 6 Mundial de Fútbol Suráfrica 2010 , 3 6 Xabi Alonso , 4 6 Vieiros (xornal) , 5 6 Historia da lingua galega , 6 5 Xesús Palmou , 7 5 Diego López Rodríguez , 8 5 Selena , 9 5 Francisco Asorey , 10 5 Reino de Galicia , 11 5 Deportivo da Coruña , 12 4 Caxato de Asclepio , 13 4 Telemadrid SAT , 14 4 Avaliación ambiental estratéxica , 15 4 Parque do Pasatempo , 16 4 Vitalismo , 17 4 Lêdo Ivo , 18 4 Annales Regni Francorum , 19 4 Vita Karoli Magni , 20 4 A Relíquia , 21 4 O Mandarim , 22 4 Roberto Fernández Alvarellos , 23 4 Kiko da Silva , 24 4 Juan Velasco Alvarado , 25 4 Mundial de Fútbol de 2010 - Final

ago 2010: 1 6 Trastorno por déficit de atención con hiperactividade , 2 6 Historia da lingua galega , 3 5 CNN+ , 4 5 Léxico da Galiza , 5 5 António Livramento , 6 5 Casi ángeles , 7 5 Schnauzer , 8 5 Hórreo galego , 9 5 Manu Chao , 10 5 Masaru Emoto , 11 4 BBC HD , 12 4 Mediaset España Comunicación , 13 4 Xerox Corporation , 14 4 Just Dance , 15 4 Endofenotipo , 16 4 Técnica de dominación , 17 4 Fernando Avecilla Porto , 18 4 Cuac FM , 19 4 Växjö , 20 4 Anxo Lorenzo , 21 4 Francisco Franco , 22 4 José Manuel Otero Novas , 23 4 Miticultura , 24 4 Pene , 25 4 Aves

set 2010: 1 9 Ana Kiro , 2 6 Xapón , 3 5 0 de xaneiro , 4 5 Freixo de folla estreita , 5 5 José Antonio Labordeta , 6 5 Arman , 7 5 Reino de Galicia , 8 5 Historia de Galicia , 9 5 Alfonso Daniel Rodríguez Castelao , 10 4 Premio COAG de Arquitectura , 11 4 Tomás Legido Sánchez , 12 4 Chema Gagino , 13 4 Monicreque (Internet) , 14 4 Manuel Oliveira Blanco , 15 4 Xosé Oliveira Blanco , 16 4 A Duquesa da rúa do Duque , 17 4 Alfonso Armada Rodríguez , 18 4 Diáspora galega , 19 4 IB3 Televisió , 20 4 Begoña Paz , 21 4 Templo de Santalla de Bóveda , 22 4 Anselmo López Carreira , 23 4 Raúl García Carnero , 24 4 Hórreo galego , 25 4 Diego Tristán

out 2010: 1 6 Tradución automática , 2 6 Bicicleta , 3 6 Lugo , 4 6 España , 5 5 Universidade de Oviedo , 6 5 Vocabulario Científico Internacional , 7 5 Giovanni Pierluigi da Palestrina , 8 5 Luis Caruncho , 9 5 Terra Eo-Navia , 10 5 Serea , 11 5 Galicia , 12 5 Arte , 13 4 Plotino , 14 4 Husqvarna , 15 4 Denominación común internacional , 16 4 Google Translate , 17 4 Qüestió de noms , 18 4 Blanca Andreu , 19 4 Xosé Iglesias Roura , 20 4 Olaf Haraldsson , 21 4 Biffy Clyro , 22 4 Escudo de Navarra , 23 4 Alexandre Deulofeu , 24 4 Serxio Pazos , 25 4 Néstor Kirchner

nov 2010: 1 6 Abella , 2 6 Deportivo da Coruña , 3 5 Antoni van Leeuwenhoek , 4 5 Conflito en Río de Xaneiro en novembro de 2010 , 5 5 Google Translate , 6 5 Futebol Clube do Porto , 7 5 Wikipedia en éuscaro , 8 5 Francisco Martínez Bouzas , 9 5 Costa da Morte , 10 5 Lugo , 11 4 Ponte Carreira, Gafoi, Frades , 12 4 Coroa de marqués , 13 4 Goenkale , 14 4 Emanuel Bouzon , 15 4 Sporting Clube de Portugal , 16 4 Concilio de Lugo , 17 4 Circuncisión , 18 4 Xinzo de Limia , 19 4 Baiona , 20 4 Lingua catalá , 21 4 Historia de Galicia , 22 3 Luis Cadarso Rey , 23 3 Josep Anglada , 24 3 Joan Puigcercós , 25 3 Eleccións ao Parlamento de Cataluña 2010

dez 2010: 1 9 Reino de Galicia , 2 6 Naked Lunch , 3 6 O Nadal na cultura popular galega , 4 5 Diadema de Moñes , 5 5 Marcos Valcárcel , 6 4 Crise económica de 2008-2013 , 7 4 Federico Guillerme II de Prusia , 8 4 Sufismo , 9 4 Pilar Rojo , 10 4 Proba matemática , 11 4 Mahabharata , 12 4 Imre Lakatos , 13 4 Santi Domínguez , 14 4 Guerra anglo-española de 1585-1604 , 15 4 New World Translation of the Holy Scriptures , 16 4 John Draper , 17 4 Novacaixagalicia , 18 4 Eleccións ao Parlamento de Cataluña 2010 , 19 4 Zimnie zametki o letnikh vpechlatleniyakh , 20 4 Castelo de Pambre , 21 4 Saudade , 22 4 Xabier Lete , 23 4 Castelo, Culleredo , 24 4 Bacallau , 25 4 Universidade da Coruña

jan 2011: 1 9 España , 2 7 Reino de Galicia , 3 7 Lugo , 4 6 Abioxénese , 5 6 Juan López Mella , 6 6 Vaca , 7 5 Daniel Day-Lewis , 8 5 Álvaro Negredo , 9 5 Jan Baptista van Helmont , 10 5 Tetractis , 11 5 Rally Dakar , 12 4 Blanca-Ana Roig , 13 4 Plauto , 14 4 Xardín Botánico de Mérida , 15 4 Tauromaquia , 16 4 Efecto Ferranti , 17 4 Guillermina I dos Países Baixos , 18 4 Capela de San Miguel de Ribadeo , 19 4 Acueduto de Lugo , 20 4 Mosteiro de San Pedro de Rocas , 21 4 Volkswagen Race Touareg , 22 4 Antoni van Leeuwenhoek , 23 4 Teoría da xeración espontánea , 24 4 Antonio Rodríguez Salvador , 25 4 Estado soberano

fev 2011: 1 7 2011 , 2 6 Castro de Burela , 3 6 Proxecto Galicia , 4 5 Antonio Risco , 5 5 Movemento do deseño intelixente , 6 5 Viktor Frankl , 7 5 Manuel García Blanco , 8 5 Deseño intelixente , 9 5 Lucía Pérez , 10 5 Viveiro , 11 4 José María Ruiz-Mateos , 12 4 Zapatones , 13 4 Peekskill, Nova York , 14 4 Bateas (equipo de billarda) , 15 4 Audiencia (medios de comunicación) , 16 4 Universidade Aberta , 17 4 La Regenta , 18 4 Paul Newman , 19 4 In the Name of the Father , 20 4 Lei de Fourier , 21 4 Escorras , 22 4 Nicole (cantante chilena) , 23 4 Xosé Oliveira Blanco , 24 4 Futbol Club Barcelona , 25 4 Apalpador

mar 2011: 1 11 Terremoto e tsunami de Sendai de 2011 , 2 6 Praza de touros de Pontevedra , 3 6 Justin Bieber , 4 6 Manuel Oliveira Blanco , 5 6 Club Deportivo Lugo , 6 5 Torre de Bermúdez , 7 5 O chícharo psicótico , 8 5 José Fernández Canosa , 9 5 Fungato , 10 5 Parrocha , 11 5 Casnadagaia, San Mamede de Urrós, Allariz , 12 5 MagicValongo , 13 5 Sintetizador analóxico , 14 5 The Rescuers , 15 5 Charlotte's Web 2: Wilbur's Great Adventure , 16 5 Carlos Callón , 17 5 Catedral de Santiago de Compostela , 18 5 España , 19 4 Anne Philipe , 20 4 Diari Ara , 21 4 Juanjo Liñares , 22 4 Umami , 23 4 Diário Liberdade , 24 4 Rumble Fish , 25 4 Dionisio o Exiguo

abr 2011: 1 17 Barcelona , 2 10 Lois Pereiro , 3 9 Airas Bispo , 4 7 Historia da ciencia , 5 7 Wikipedia en éuscaro , 6 7 Ciencia , 7 6 Lista de monumentos da provincia de Pontevedra , 8 5 Río Corgo, río Sarela , 9 5 The Rescuers , 10 5 Luís Fábrega Coello , 11 4 Semana Santa de Viveiro , 12 4 Real Academia de Medicina e Cirurxía de Galicia , 13 4 Braña (revista) , 14 4 Grupo prostético , 15 4 Decrecemento , 16 4 Músculo pectoral menor , 17 4 Músculo subclavio , 18 4 Músculo pectoral maior , 19 4 Músculo redondo menor , 20 4 Comisario Maigret , 21 4 Hindi de Fidxi , 22 4 Ánxela Loureiro , 23 4 Demografía de Serbia , 24 4 Arte da antigüidade , 25 4 Manuel Antonio

mai 2011: 1 8 Lois Pereiro , 2 7 Luís Fábrega Coello , 3 7 Festival de Eurovisión 2011 , 4 6 J. R. R. Tolkien , 5 6 H , 6 6 G , 7 5 Nóumeno , 8 5 Droga de deseño , 9 5 Justin Bieber , 10 5 Deportivo da Coruña , 11 5 Galipedia , 12 4 Fracción , 13 4 Margaret Levi , 14 4 Evanxeo de Marcos , 15 4 Fenómeno , 16 4 José Luis Vázquez Vázquez , 17 4 Toxicoloxía do tabaco , 18 4 Declaración de Independencia dos Estados Unidos de América , 19 4 Liga de Campións da UEFA 2010-11 , 20 4 A Casiña, Arcos, Cuntis , 21 4 Converxencia 21 , 22 4 Lista de filmes con versión en galego , 23 4 Osama bin Laden , 24 4 España , 25 4 Ciencia

jun 2011: 1 5 Xinzo da Costa, Vilardecás, Maceda , 2 5 Manolo Otero , 3 5 Málaga Club de Fútbol , 4 5 Valentín Paz-Andrade , 5 5 Real Club Celta de Vigo , 6 5 Real Madrid Club de Fútbol , 7 4 Adolfo Muíños , 8 4 Historia da enfermaría , 9 4 Timgad , 10 4 Like a Rolling Stone , 11 4 Real Academia Galega de Belas Artes , 12 4 Universidade do Bío-Bío , 13 4 Mario Draghi , 14 4 Historia da cirurxía , 15 4 Lista de monumentos da provincia de Pontevedra , 16 4 Vía Televisión , 17 4 Alzamento de Pascua , 18 4 Xosé Fernández Ferreiro , 19 4 Ortiga , 20 4 Vilaboa, Valdoviño , 21 4 Canción do verán , 22 4 República Checa , 23 3 Grilo ceboleiro , 24 3 Ciclo celular , 25 3 Xeriatría

jul 2011: 1 6 Códice Calixtino , 2 5 Hipótese do mundo de ARN , 3 4 Eudoxo de Cnido , 4 4 H2O: Just Add Water , 5 4 Sociedade Deportiva Compostela , 6 4 2011 , 7 4 Vaca , 8 4 Deportivo da Coruña , 9 4 España , 10 3 Maret , 11 3 Plott hound , 12 3 Elementos de Euclides , 13 3 Pilar Prades , 14 3 Manuel Pérez Martínez \"Arenas\" , 15 3 Thomas J. Clarke , 16 3 Almaxesto , 17 3 Principio de Arquímedes , 18 3 Impulso (aerodinámica) , 19 3 Papiro Ebers , 20 3 ONCE , 21 3 Zhang Heng , 22 3 Willard Van Orman Quine , 23 3 La Plata , 24 3 Grupo Martín Códax , 25 3 ASSET

ago 2011: 1 6 Alejandro Tobar , 2 6 Catedral de Santiago de Compostela , 3 5 Historia da ciencia , 4 4 Panteón , 5 4 Solución (homónimos) , 6 4 KrioRus , 7 4 Mito da caverna , 8 4 Aparato , 9 4 Anthony Mann , 10 4 James Cameron's Avatar: The Game , 11 4 Dólar , 12 4 Ciencia , 13 3 Mestrado en administración de negocios , 14 3 Grupo Losán , 15 3 Taboleiro de madeira , 16 3 Sonoridade , 17 3 Mitoloxía galega , 18 3 Panteón (mitoloxía) , 19 3 Kevin Spacey , 20 3 Cadáver , 21 3 Antropometría , 22 3 Phoebe Tonkin , 23 3 Encoro do Eume , 24 3 Progresividade , 25 3 Tumultos en Inglaterra en 2011

set 2011: 1 5 Síndrome do aceite tóxico , 2 5 Lista de monumentos da provincia da Coruña , 3 5 Copa do Mundo de Rugby 2011 , 4 5 Traballo , 5 5 Pontevedra , 6 5 A Coruña , 7 4 Talófitas , 8 4 Pedro Benavente , 9 4 Nabo , 10 4 Cristino Álvarez Herrera , 11 4 Paciños, Requeixo de Valverde, Allariz , 12 4 Maguncia , 13 4 Illa da Toxa , 14 4 Paco Martín , 15 4 Estatuto de autonomía de Galicia de 1936 , 16 4 Nacións celtas , 17 4 Freddie Mercury , 18 4 Castrelo de Miño , 19 4 Reino de Galicia , 20 4 Vigo , 21 4 Ciencia , 22 3 Evencio Ferrero Rodríguez , 23 3 García Rodríguez de Valcarce , 24 3 Ángel Sobral , 25 3 A Nosa Terra (1977)

out 2011: 1 8 Futbol Club Barcelona , 2 8 Valentín Paz-Andrade , 3 6 Estatuto de autonomía de Galicia de 1936 , 4 6 Vigo , 5 5 Victorious , 6 5 Kesha , 7 5 Extremo , 8 5 Steve Jobs , 9 4 Alcazaba , 10 4 Aurelio Joaniquet Extremo , 11 4 Extremo, Arcos de Valdevez , 12 4 In extremis , 13 4 Colexio Compañía de María de Santiago de Compostela , 14 4 Crioxenia , 15 4 Criopreservación , 16 4 Carlos Otero Díaz , 17 4 Muamar al-Qadafi , 18 4 Nomenclatura das unidades territoriais estatísticas , 19 4 Lingua lígur (románica) , 20 4 Red Bull Racing , 21 4 Pantón , 22 4 A Pobra do Brollón , 23 4 Pontedeume , 24 4 Outeiro de Rei , 25 4 As Pontes de García Rodríguez

nov 2011: 1 7 Xesús Constela , 2 7 Estatuto de autonomía de Galicia de 1936 , 3 6 Alzamento de Pascua , 4 6 Samaín , 5 5 Fernando Mosquera Martínez , 6 5 Black Sabbath , 7 4 Suxestopedia , 8 4 Francisco Candeira , 9 4 Libro das alquimias , 10 4 As humanas proporcións , 11 4 Músculo dorsal ancho , 12 4 Severiano Martínez Anido , 13 4 Acelular , 14 4 Exposición Internacional de París de 1937 , 15 4 Olláparo (revista) , 16 4 Guernica (cadro) , 17 4 Eleccións xerais de España de 2011 , 18 4 Fernando Díaz-Castroverde , 19 4 Cidade da Cultura de Galicia , 20 4 2011 , 21 4 Roi Xordo , 22 4 Pedro Madruga , 23 4 Catedral de Santiago de Compostela , 24 4 11 de novembro , 25 4 Galipedia

dez 2011: 1 7 Real Club Celta de Vigo , 2 6 Valentín Paz-Andrade , 3 6 Lugo , 4 5 Vea cubital , 5 5 Mitoloxía galega , 6 5 Complexo dunar de Corrubedo e lagoas de Carregal e Vixán , 7 5 The Strokes , 8 5 Cortegada , 9 4 Is This It , 10 4 Room on Fire , 11 4 Angles , 12 4 Vea basílica , 13 4 Vea mediana cubital , 14 4 Volta a Burgos , 15 4 Discografía de The Strokes , 16 4 Julian Casablancas , 17 4 Arteria axilar , 18 4 Fraga , 19 4 A Ribeira , 20 4 Miguel Tranquilo , 21 4 Lista de senadores galegos desde a Transición , 22 4 Resistência Galega , 23 4 Segunda República Española , 24 4 Universidade de Santiago de Compostela , 25 4 Álvaro Cunqueiro

jan 2012: 1 9 Manuel Fraga , 2 8 Isaac Díaz Pardo , 3 6 Valentín Paz-Andrade , 4 6 Slash , 5 6 Reino de Galicia , 6 5 Parabola GNU/Linux-libre , 7 5 Unión Club Cee , 8 5 Historia de Europa , 9 5 Historia dos eslavos do sur , 10 5 Alzamento de Pascua , 11 5 Nación constituínte , 12 5 Castro Caldelas , 13 5 Lugo , 14 4 Crédito académico , 15 4 Ratatouille , 16 4 Annam , 17 4 Indochina , 18 4 Antípodas , 19 4 Castas (hinduísmo) , 20 4 Raza aria , 21 4 José Domingo Cipriano Oreiro , 22 4 Liña ecuatorial , 23 4 Matrimonio entre persoas do mesmo sexo en España , 24 4 Montserrat Caballé , 25 4 Reggaeton

fev 2012: 1 8 Galería de imaxes de casas dos concellos de Galicia , 2 5 Adele , 3 5 Pecado , 4 5 Wikilusa , 5 5 Praza Pública , 6 5 Centro Oncolóxico de Galicia , 7 5 Reggaeton , 8 4 Angrois, Sar, Santiago de Compostela , 9 4 Ty Segall , 10 4 Deposición de Cristo , 11 4 Moncef Marzouki , 12 4 Feliciano Barrera , 13 4 Estevo Dragutin , 14 4 Sergio Álvarez Moya , 15 4 Parador de turismo , 16 4 Emilio Alonso Paz , 17 4 Segunda división española 2011/12 , 18 4 Primeira división española 2011/12 , 19 4 Día da Candeloria , 20 4 Millennium Centar , 21 4 Libertalia , 22 4 Xetafe , 23 4 Castromao, A Veiga , 24 4 Morte , 25 4 Dozón

mar 2012: 1 8 Juan Antonio Posse , 2 7 Monbus , 3 7 Galería de imaxes de casas dos concellos de Galicia , 4 6 Que fermoso é vivir , 5 6 Frank Capra , 6 6 Ética para o meu fillo , 7 6 Ricardo Mella Serrano , 8 6 O señor das moscas (novela) , 9 6 Cristianismo , 10 5 Mitos platónicos , 11 5 The Fear of Freedom , 12 5 La peste , 13 5 Der Steppenwolf , 14 5 Antíxeno , 15 5 Alicia do outro lado do espello , 16 5 La philosophie expliquée à ma fille , 17 5 Podoloxía , 18 5 Podólogo , 19 5 Colorimetría , 20 5 A Pobra do Brollón , 21 5 Partido Nacionalista Galego-Partido Galeguista , 22 5 Alemaña , 23 5 A Coruña , 24 5 Vigo , 25 4 Leite Río

abr 2012: 1 6 Dominio de Internet , 2 6 The Lost Thing , 3 6 Facultade das Ciencias Económicas e Empresariais de Santiago de Compostela , 4 6 Galería de imaxes de casas dos concellos de Galicia , 5 6 Gerardo Conde Roa , 6 6 Ponte, Silleda , 7 5 Clero , 8 5 Festival de teatro grecolatino de Lugo , 9 5 The Red Tree , 10 5 Xesús Veiga , 11 5 Abella raíña , 12 5 Valentín Paz-Andrade , 13 5 Fernando VII , 14 5 Fragas do Eume , 15 4 Corinna zu Sayn-Wittgenstein , 16 4 Los Fresones Rebeldes , 17 4 Jeff Koons , 18 4 Sémele , 19 4 Ángel Currás Fernández , 20 4 .am , 21 4 .at , 22 4 .au , 23 4 Cows, Pigs, Wars and Witches , 24 4 Banda Artística de Merza , 25 4 Hiperpaxinación

mai 2012: 1 9 Valentín Paz-Andrade , 2 7 A arañeira de Charlotte , 3 6 Outono Fotográfico , 4 6 Victorious , 5 6 Vaca , 6 6 Ácido desoxirribonucleico , 7 6 Francia , 8 5 Chain of Responsibility (padrón de deseño) , 9 5 Álex Lombardero , 10 5 José Juan Figueras , 11 5 Borja Golán , 12 5 CB Estudiantes , 13 5 Barreiros (automoción) , 14 5 Vigo , 15 4 Manuel Allendesalazar Muñoz , 16 4 Memento (padrón de deseño) , 17 4 Facade (padrón de deseño) , 18 4 Macronutriente , 19 4 Strategy (padrón de deseño) , 20 4 Tella (construción) , 21 4 José Vega , 22 4 Composite (padrón de deseño) , 23 4 Laura del Río García , 24 4 Factory Method (padrón de deseño) , 25 4 François Hollande

jun 2012: 1 9 José Muíño Domínguez , 2 9 Real Club Celta de Vigo , 3 7 Vaca , 4 6 Ángel Carballeira Rego , 5 6 Compromiso por Galicia , 6 6 Eurocopa de Fútbol Polonia/Ucraína 2012 , 7 6 Roberto Vidal Bolaño , 8 5 Txetxu Rojo , 9 5 O Ciprianillo , 10 5 Manuel Preciado , 11 5 Joaquín Sabina , 12 5 O Grove , 13 5 A Coruña , 14 5 Galicia , 15 5 Deportivo da Coruña , 16 4 Carlos Vila Varela , 17 4 Marineda City , 18 4 Ismail Qemali , 19 4 Festa do Esquecemento , 20 4 Concurso de Cultura Clásica Odisea , 21 4 Andrés Balsa , 22 4 Carlos Aimar , 23 4 Nisargadatta Maharaj , 24 4 Vime , 25 4 Javier Maté

jul 2012: 1 9 A Coruña , 2 7 Códice Calixtino , 3 6 Arduino , 4 6 Museo Nacional de Ciencia e Tecnoloxía , 5 6 Marineda City , 6 5 Plásticos Ferro , 7 5 Eurocopa de Fútbol Polonia/Ucraína 2012 , 8 5 Estrella Galicia , 9 5 Zlatan Ibrahimović , 10 5 Roberto Vidal Bolaño , 11 5 Historia da lingua galega , 12 5 Real Academia Galega , 13 4 Polpa de remolacha , 14 4 Zona económica exclusiva , 15 4 O Gran Burato , 16 4 Refinería da Coruña , 17 4 Galegos nos Xogos Olímpicos de 2012 , 18 4 Alén de Ancos , 19 4 Castromil (autocares) , 20 4 Quempallou (álbum) , 21 4 A Chousa Nova , 22 4 Concentración parcelaria , 23 4 Francisco Doblas , 24 4 Postojna , 25 4 Kumrovec

ago 2012: 1 7 Chavela Vargas , 2 6 Galegos nos Xogos Olímpicos de 2012 , 3 6 Rocío Jurado , 4 6 Gato , 5 5 Manuela Santalla , 6 5 Mireia Belmonte , 7 5 Décatlon , 8 5 Caso do metílico , 9 5 Lobos de Arga , 10 5 Támara Echegoyen , 11 5 Aborixes australianos , 12 5 Sancho Gracia , 13 5 Xogos Olímpicos de 2012 , 14 5 Lista de medallistas olímpicos galegos , 15 5 David Cal , 16 5 Galicia , 17 4 Conservatorio profesional de música de Santiago de Compostela , 18 4 A Vilerma, Maside, Sarria , 19 4 O Souto, Xinzo, Ponteareas , 20 4 Rata negra , 21 4 El Telegrama , 22 4 Lee See-young , 23 4 Hóspede , 24 4 Penso (alimento) , 25 4 Encoro das Tres Gargantas

set 2012: 1 11 Eleccións ao Parlamento de Galicia 2012 , 2 7 Anova - Irmandade Nacionalista , 3 5 José Calavera Ruiz , 4 5 Caso do metílico , 5 5 Ribadeo , 6 4 Elena Filatova , 7 4 Canón de pau , 8 4 Cadea , 9 4 Adolfo Domínguez Otero , 10 4 Sitio paleontolóxico de Ediacara , 11 4 Compromiso por Galicia , 12 4 Galería de imaxes de casas dos concellos de Galicia , 13 4 Francisco Jorquera , 14 4 Narciso Heredia Begines de los Ríos , 15 4 Esperanza Aguirre , 16 4 Toponimia , 17 4 Adolf Hitler , 18 4 Pontevedra , 19 3 Scórpio , 20 3 Pilar de Lara , 21 3 Parra virxe , 22 3 FSC , 23 3 Coca (mitoloxía) , 24 3 Rosario (cristianismo) , 25 3 Francisco Rodríguez

out 2012: 1 8 Prestige , 2 7 Alternativa Galega de Esquerda , 3 6 Shinya Yamanaka , 4 6 Eleccións ao Parlamento de Galicia 2012 , 5 6 Samaín , 6 6 Praga , 7 5 Ivano Balić , 8 5 Xoel Yáñez , 9 5 Aulas de hospitalidade , 10 5 Joseph Lancaster , 11 5 Mariana Expósito , 12 5 Historia de Lugo , 13 5 Cataluña , 14 4 Microsoft Word , 15 4 Walter Model , 16 4 Sociedad Española de Ornitología , 17 4 Xosé Silva Martínez , 18 4 Amber Heard , 19 4 Santillana , 20 4 Ancylomenes pedersoni , 21 4 Madame Tussauds , 22 4 Jean Denys Cochin , 23 4 Tero Pitkämäki , 24 4 Joshua Redman , 25 4 Angus Young

nov 2012: 1 6 Praga , 2 6 Real Club Celta de Vigo , 3 5 Miña terra galega , 4 5 Pussy Riot , 5 5 Grosso modo , 6 5 Etcétera , 7 5 Gato , 8 5 Prestige , 9 4 Xardinaxe , 10 4 Françoise Hardy , 11 4 Das Kapital (grupo) , 12 4 Joaquín Queizán Taboada , 13 4 Don't Forget , 14 4 Lagoa de Caque , 15 4 Lucrecia , 16 4 Galicia Confidencial , 17 4 Manuel Rodríguez Pazó , 18 4 Pablo González Couñago , 19 4 Ex cathedra , 20 4 Ex aequo , 21 4 Exempli gratia , 22 4 Et cetera , 23 4 Carly Rae Jepsen , 24 4 Salvador García-Bodaño , 25 4 Tony Leblanc

dez 2012: 1 5 Andrea Iannone , 2 5 Sébastien Loeb , 3 5 2012 , 4 4 Carlos Piñeiro (piloto) , 5 4 The Hobbit: An Unexpected Journey , 6 4 Mar de Arousa , 7 4 Oriol Junqueras , 8 4 Yolanda López López , 9 4 Miguel Aleksandrovich Romanov , 10 4 Manuel Rodríguez López , 11 4 Xesta , 12 4 Campo , 13 4 Universidade de Santiago de Compostela , 14 4 Selección de fútbol de Galicia , 15 4 18 de decembro , 16 4 23 de decembro , 17 4 7 de decembro , 18 3 IES Santa Irene , 19 3 El Luís , 20 3 Samba Martine , 21 3 Arriba , 22 3 Briga , 23 3 Igrexa de Santiago de Breixa , 24 3 A Copa do Castro , 25 3 Arma de fogo

jan 2013: 1 6 The Beatles , 2 6 Santa Cruz de Moeche, Moeche , 3 4 CEIP de Randufe , 4 4 Princesa Sherezade , 5 4 Corrosión , 6 4 ITER , 7 4 Benni McCarthy , 8 4 Sonthonnax-la-Montagne , 9 4 Saint-Martin-du-Mont, Ain , 10 4 Saint-Germain-les-Paroisses , 11 4 Saint-Denis-lès-Bourg , 12 4 Le Petit-Abergement , 13 4 Pérouges , 14 4 Neuville-les-Dames , 15 4 L'Abergement-Clémenciat , 16 4 York , 17 4 Arata Isozaki , 18 4 Las Grecas , 19 4 José Posada , 20 4 Enrique Peña Nieto , 21 4 Brais González Pérez , 22 4 Endovelico , 23 4 Elvira Ribeiro Tobío , 24 4 RMS Titanic , 25 4 Pedroso, Narón

fev 2013: 1 8 A Coruña , 2 8 España , 3 7 Noli me tangere , 4 7 Mecos FG Ogrobe , 5 6 Víctor Campio Pereira , 6 5 Memento mori , 7 5 In vitro , 8 5 V de Vendetta (filme) , 9 5 Zanfona , 10 5 Santa Cruz de Moeche, Moeche , 11 5 Bieito XVI, papa , 12 5 Neda , 13 4 Silencio (música) , 14 4 Galería de imaxes de Cabalar, A Capela , 15 4 In vino veritas , 16 4 Paul Virilio , 17 4 Ens Públic de Radiotelevisió de les Illes Balears , 18 4 Chula Vista , 19 4 Malnutrición , 20 4 Popular Televisión Galicia , 21 4 Tucson , 22 4 RMS Titanic , 23 4 Samieira, Poio , 24 4 Cabalar, A Capela , 25 4 Galipedia

mar 2013: 1 11 Francisco, papa , 2 10 Real Club Celta de Vigo , 3 6 Bono lixo , 4 6 Skyranger , 5 5 Arne Næss , 6 5 Manuel Barreiro Núñez , 7 5 Lenin , 8 5 Galipedia , 9 4 Explosivo , 10 4 Rinoceronte laúdo , 11 4 Ramón Santamarina , 12 4 EMedicine , 13 4 Django Unchained , 14 4 O divino sainete , 15 4 Catania , 16 4 Caldas de Luna , 17 4 Kelley Deal , 18 4 Morte digna , 19 4 Fontes de información , 20 4 Partitura , 21 4 Escribenta riscada , 22 4 Caraveleira , 23 4 Asociación de Técnicos de Informática , 24 4 Refuxio de Sigüeiro , 25 4 Santiago Cortegoso

abr 2013: 1 7 Historia de Serbia , 2 7 Alemaña , 3 6 Si vis pacem, para bellum , 4 6 Sequoia xigante , 5 6 Lista de xefes de estado de México , 6 6 Lenin , 7 5 Escola Superior de Conservación e Restauración de Bens Culturais de Galicia , 8 5 Conservación e restauración , 9 5 Andrea Motis , 10 5 Seixo Branco , 11 5 Mexicas , 12 5 Demi (álbum) , 13 5 Vox populi , 14 5 Ruínas de San Domingos , 15 5 Historia da ciencia , 16 5 Margaret Thatcher , 17 5 Real Club Celta de Vigo , 18 4 Contactor , 19 4 Maj Sjöwall , 20 4 Narcose de nitróxeno , 21 4 Avanti! (filme) , 22 4 Gladys Vázquez Montes , 23 4 Nocilla , 24 4 Mazarico galego , 25 4 José Miguel de Barandiarán

mai 2013: 1 7 Roberto Vidal Bolaño , 2 6 Coursera , 3 6 Seúl , 4 5 Ramón Garrido Vidal , 5 5 Niño y Pistola , 6 5 Casa dos Austria , 7 5 Francisco de Goya , 8 5 Londres , 9 5 Devesa , 10 5 Gato , 11 4 Festa da filloa de Muimenta , 12 4 Senén Bernárdez Ferrán , 13 4 Luciano García Alén , 14 4 Narcotráfico , 15 4 Canón Dora , 16 4 Praia dos Cristais , 17 4 Estela Estévez Barreiro , 18 4 Reiki , 19 4 Asanas , 20 4 Pedro de Betancur , 21 4 Giro de Italia 2013 , 22 4 Kaʻiulani , 23 4 Historia de Serbia , 24 4 Beixo , 25 4 Nikos Galis

jun 2013: 1 8 Xosé María Díaz Castro , 2 7 Real Club Celta de Vigo , 3 6 Oza-Cesuras , 4 6 Primeira división española 2012/13 , 5 6 Iago Aspas , 6 6 Celso Emilio Ferreiro , 7 5 Xosé Manuel Olveira \"Pico\" , 8 5 Vitoria , 9 5 Oza, Oza-Cesuras , 10 5 Kinshasa , 11 5 Concello de Cesuras , 12 5 Oviedo , 13 5 Moscova , 14 5 A Coruña , 15 5 Galicia , 16 5 Athletic Club , 17 5 Prestige , 18 4 Xeración de electricidade , 19 4 Singapur , 20 4 Gran Premio do Reino Unido de 2013 , 21 4 Orquestra Olympus , 22 4 Árbores senlleiras de Galicia , 23 4 José Solchaga Zala , 24 4 Parque de Castrelos , 25 4 Primeira división española 2013/14

jul 2013: 1 13 Catedral de Santiago de Compostela , 2 8 Accidente de Angrois , 3 7 Santiago de Compostela , 4 5 Suárbol , 5 5 Valouta , 6 5 Cataluña , 7 5 Galicia , 8 5 Real Club Celta de Vigo , 9 4 Sorbeira, Candín , 10 4 Vilarbón , 11 4 Jurbarkas , 12 4 Veni, Sancte Spiritus , 13 4 Amerindia , 14 4 William Elford Leach , 15 4 Gran Premio de Hungría de 2013 , 16 4 Anser , 17 4 Tristan und Isolde , 18 4 2013 , 19 4 Leite desnatado , 20 4 Catedral de Tui , 21 4 Museo Catedralicio de Santiago de Compostela , 22 4 Leite , 23 4 Florencia , 24 4 Edimburgo , 25 4 Brasilia

ago 2013: 1 8 Tristan und Isolde , 2 7 Catedral de Santiago de Compostela , 3 6 Rosalía Mera , 4 5 Mosteiros e conventos de Galicia , 5 5 Figueroa, Abegondo , 6 5 Pontedeume , 7 5 Vigo , 8 4 Liga Galega de Fútbol Gaélico 7 contra 7 , 9 4 Accidente de Angrois , 10 4 As Córneas, San Salvador de Asma, Chantada , 11 4 Sarandós, Abegondo , 12 4 Kama Sutra , 13 4 Oia , 14 4 Redondela , 15 4 O Grove , 16 4 Leonardo da Vinci , 17 4 Deportivo da Coruña , 18 3 Castro da Roda , 19 3 Castro de Boado , 20 3 Cono de violación , 21 3 Eva Almazán , 22 3 Orde sacerdotal , 23 3 Río Gobia , 24 3 Río Barcés , 25 3 Ricardo de Barreiro

set 2013: 1 6 Federación Española de Actividades Subacuáticas , 2 6 Tristan und Isolde , 3 5 Castro das Muradellas , 4 5 Cortello dos Lobos , 5 5 Cultura castrexa , 6 5 Galicia , 7 4 Francisco María Rivas Taboada , 8 4 Baleeiro , 9 4 Iria Morgade , 10 4 Igrexa de Nuestra Señora del Azogue , 11 4 Vuelta a España 2013 , 12 4 Carl Theodor Dreyer , 13 4 Automóbil de turismo , 14 4 Cephalorhynchus , 15 4 Estatua de Che Guevara en Oleiros , 16 4 Triodos Bank , 17 4 Homo floresiensis , 18 4 El Greco , 19 4 Seabra , 20 4 Candorca , 21 4 Río Mississippi , 22 4 Sarria , 23 4 Pontedeume , 24 4 Redondela , 25 4 Virus

out 2013: 1 6 Iniciativa pol Asturianu , 2 5 Electrónica dixital , 3 5 Jessica Lange , 4 5 Francisco Porto Rey , 5 5 Galicia , 6 4 Igrexa de Santa María de Goó , 7 4 Queima de libros , 8 4 Unidad Castellana , 9 4 Winnipeg (barco) , 10 4 Michael Bublé , 11 4 Mirabel , 12 4 Overclocking , 13 4 Diego San José , 14 4 Caza de baleas en Galicia , 15 4 Nacionalismo castelán , 16 4 Allo porro , 17 4 Hábeas corpus , 18 4 Fiat lux , 19 4 Caso do metílico , 20 4 Corpus delicti , 21 4 Ad libitum , 22 4 Alea iacta est , 23 4 A irmandade da uva , 24 4 Samaín , 25 4 Lou Reed

nov 2013: 1 7 SIDA , 2 5 A matanza caníbal dos garrulos lisérxicos , 3 5 Fábula , 4 5 Pelicano , 5 5 Roberto Vidal Bolaño , 6 4 Salmonete de lama , 7 4 Panda vermello , 8 4 Winx Club , 9 4 Cadros de Leonardo da Vinci , 10 4 Revolución Belga , 11 4 Halle , 12 4 Errare humanum est , 13 4 Angrois, Sar, Santiago de Compostela , 14 4 Vincent van Gogh , 15 4 Cracovia , 16 4 Bandeira de Galicia , 17 4 Estados Confederados de América , 18 4 Violín , 19 4 Pedrafita do Cebreiro , 20 4 Xosé Manuel Beiras , 21 4 Santiago de Compostela , 22 4 Galicia , 23 3 Prochlorococcus , 24 3 Susana de Italia , 25 3 Marco Español de Cualificación para a Educación Superior

dez 2013: 1 10 Nelson Mandela , 2 7 Manuel Quiroga Losada , 3 7 Redondela , 4 5 Tampa , 5 5 Ramón Cabanillas , 6 5 SIDA , 7 4 AD Fogar da Xuventude , 8 4 Símbolos monetarios , 9 4 Xosé Manuel Pacho Blanco , 10 4 Mundial de Fútbol Suráfrica 2010 , 11 4 Vilariño Frío, Montederramo , 12 4 Gaita galega , 13 4 Pataca , 14 4 Martín Sarmiento , 15 3 Partido Demócrata Cristiano (Chile) , 16 3 Conserveras La Coca , 17 3 Conservatorio profesional de música Manuel Quiroga , 18 3 Raydibaum , 19 3 Pavo bravo , 20 3 Charouvía , 21 3 Parque Natural das Serras de Cazorla, Segura e Las Villas , 22 3 Festa da pataca de Coristanco , 23 3 Slackware , 24 3 Blas de Lezo , 25 3 Tux

jan 2014: 1 7 Guerras médicas , 2 7 Redondela , 3 5 Requián, Frades, A Estrada , 4 5 Will Champion , 5 5 Blas de Lezo , 6 5 Historia de Lugo , 7 5 Islay , 8 5 Illa de Ons , 9 5 Judo , 10 5 Portugal , 11 4 Xesta de Ons , 12 4 Constancia , 13 4 Thonon-les-Bains , 14 4 Florence Griffith Joyner , 15 4 Rocamadour , 16 4 Póvoa de Lanhoso , 17 4 Pedro Costa , 18 4 Brčko , 19 4 Go no sen , 20 4 Eparquía ortodoxa rusa da Arxentina e Suramérica , 21 4 Universidade Nacional de La Plata , 22 4 Ada Colau , 23 4 Fundación Barrié , 24 4 Håkan Hellström , 25 4 Pacto Federal Castelán

fev 2014: 1 9 Plauto , 2 6 Galicia , 3 5 Facsímile , 4 5 Finados en 2014 , 5 5 Shirley Temple , 6 5 Vaca , 7 5 Portugal , 8 4 Monitor de estudio , 9 4 Mir , 10 4 Lista de arcade cabinets xaponeses , 11 4 República Soviética de Baviera , 12 4 Número transcendente , 13 4 In pectore , 14 4 Emily Dickinson , 15 4 Micetozoos , 16 4 Philip Seymour Hoffman , 17 4 Karis , 18 4 Xoán Paulo I, papa , 19 4 Redondela , 20 4 Lugo , 21 4 Gato , 22 3 Os Bolechas , 23 3 Xosé Couceiro Bugallo , 24 3 Louis-Augustin Bosc d’Antic , 25 3 Henry James

mar 2014: 1 10 Adolfo Suárez , 2 9 Nova Zelandia , 3 6 Gubernia de Tavria , 4 6 República Popular de Crimea , 5 6 Salto de esquí , 6 6 Sebastopol , 7 6 Crimea , 8 6 Euclides , 9 5 Cabalo de mar , 10 5 Sebastian Bieniek , 11 5 Premios Mestre Mateo 2013 , 12 5 Finados en 2014 , 13 5 Aeroporto de Madrid-Barajas , 14 5 Teixeiro, Curtis, Curtis , 15 5 Iosif Stalin , 16 4 Demografía de Nova Zelandia , 17 4 Vladimir Sorokin , 18 4 Contos Estraños , 19 4 Xosé Duncan , 20 4 Swissquote , 21 4 Rus de Kiev , 22 4 Brest, Belarús , 23 4 Historia de Ucraína , 24 4 British Racing Partnership , 25 4 Marabedí

abr 2014: 1 6 Atlanta , 2 6 Xosé María Díaz Castro , 3 6 Xoán Paulo II, papa , 4 5 Coro Universitario Galego de Barcelona , 5 5 Dourado , 6 5 Krzysztof Penderecki , 7 5 Miguel-Anxo Murado , 8 5 Kenya , 9 5 Lingua inglesa , 10 4 Mateo (nome) , 11 4 Antonio López Díaz , 12 4 Ignacio , 13 4 Jorge Larraz , 14 4 Latvijas Televizija , 15 4 Mitílidos , 16 4 Tito Vilanova , 17 4 Isabel Risco , 18 4 Zoë Kravitz , 19 4 Anna Paquin , 20 4 Dalai Lama , 21 4 Naufraxios de pesqueiros galegos , 22 4 Kosovo , 23 4 Xoán XXIII, papa , 24 4 Donostia , 25 4 Xesús de Nazaret

mai 2014: 1 7 Conchita Wurst , 2 6 Sanna Nielsen , 3 6 Quero ser tua , 4 6 Pablo Iglesias Turrión , 5 5 Boliña de peluxe do embigo , 6 5 András Kállay-Saunders , 7 5 Festival de Eurovisión 2014 , 8 5 Arte de Galicia , 9 5 Festa dos maios , 10 5 Motor eléctrico , 11 5 Mondragón, Guipúscoa , 12 5 Unión Progreso y Democracia , 13 5 Máquina de corrente continua , 14 5 Australia , 15 5 A Pobra do Caramiñal , 16 4 Luís Castedo , 17 4 Válvula magnética (refrixeración) , 18 4 Lee Miller , 19 4 Compresor centrífugo , 20 4 Freaky Fortune , 21 4 Catedral de Palencia , 22 4 Trampa chinesa , 23 4 Sebalter , 24 4 Mariia Yaremchuk , 25 4 O Gran Compadre

jun 2014: 1 12 Centola , 2 8 Filipe VI de España , 3 6 Refrixerante , 4 6 Xoán Carlos I de España , 5 6 Deportivo da Coruña , 6 5 Recipiente de líquido refrixerante , 7 5 Giovanni Anselmo , 8 5 Mundial de Fútbol de 2014 , 9 5 Manuel Fraga , 10 4 Consulado (Francia) , 11 4 Miguel Veloso , 12 4 Chicago Fire Soccer Club , 13 4 Cadea humana polo dereito a decidir do País Vasco do 2014 , 14 4 Condensador multitubular , 15 4 Mamede de Capadocia , 16 4 Tubo capilar , 17 4 Compresor alternativo frigorífico , 18 4 Claude Cahun , 19 4 Pablo Iglesias Turrión , 20 4 Revista Gallega , 21 4 Baldo Ramos , 22 4 Ovidio Murguía , 23 4 Svenska hockeyligan , 24 4 Carol Henning , 25 4 Claudio Abbado

jul 2014: 1 12 Xosé Filgueira Valverde , 2 9 Real Club Celta de Vigo , 3 7 Pontedeume , 4 6 Mansour bin Zayed Al-Nahyan , 5 6 Dorothé Schubarth , 6 5 Sulaiman Al-Fahim , 7 5 Cúpula de Ferro , 8 5 Finados en 2014 , 9 5 Institucións españolas do Antigo Réxime , 10 5 Alfoz , 11 5 A Coruña , 12 4 Valdegeña , 13 4 Margarida de Inglaterra , 14 4 Mònica Oltra , 15 4 Prefixo aeronáutico , 16 4 Rafael González Villar , 17 4 Santuario Virxe da Pena de Congosto , 18 4 Amfíkleia , 19 4 Amfikleia-Elateia , 20 4 Helicicultura , 21 4 Caracol xigante africano , 22 4 Holanda (tecido) , 23 4 Lingua waray-waray , 24 4 Supreme Petroleum Council , 25 4 Manal bint Mohammed bin Rashid Al Maktoum

ago 2014: 1 6 Ébola , 2 6 Robin Williams , 3 6 Arqueas , 4 5 Época arcaica , 5 5 Sirius , 6 5 Peret , 7 4 Batumi , 8 4 Evanxeo da Verdade , 9 4 Shantala , 10 4 Liga Galega de Fútbol Gaélico , 11 4 Estefanía de Borgoña , 12 4 August Burns Red , 13 4 Cota de malla , 14 4 Architects , 15 4 Reganosa , 16 4 Selección de fútbol de Galicia , 17 4 Alfoz , 18 4 Real Club Celta de Vigo , 19 3 Ezio Flavio Bazzo , 20 3 Paio (ermitán) , 21 3 Pereion , 22 3 Liocarcinus navigator , 23 3 Chaceon , 24 3 Schangnau , 25 3 Bonet

set 2014: 1 6 Jean Sibelius , 2 5 Manuel Tomé Piñeiro , 3 4 Alcaldes de Santiago de Compostela , 4 4 Fervenza de Férveda , 5 4 Ioan Niculae , 6 4 Maurizio Malvestiti , 7 4 Salto de esquí , 8 4 Luciano García Alén , 9 4 Lista de circuítos da Fórmula 1 , 10 4 Mariano Rajoy , 11 4 Wolfgang Amadeus Mozart , 12 4 Dolmen de Dombate , 13 3 Iglú , 14 3 Gatón do Bierzo , 15 3 Alicia Estévez , 16 3 Museo Marítimo Seno de Corcubión , 17 3 Mettius Pompusianus , 18 3 Mega Top 50 , 19 3 Copa do Mundo de Rugby 2015 , 20 3 Batalla de Galicia , 21 3 Empanada berciana , 22 3 Castelo de Sarracín , 23 3 Manuel García Diéguez , 24 3 Machado , 25 3 Arco de medio punto

out 2014: 1 8 Ébola , 2 5 Igrexa da Asunción de Benafarces , 3 5 Konstantinos Argyros , 4 5 República Federal da Illa de Arousa , 5 5 Árabes , 6 5 Historia dos xudeus de Tesalónica , 7 5 Magosto , 8 4 O Monte Lourido, A Ramallosa, Nigrán , 9 4 Baía de Baiona , 10 4 Francisco Granados , 11 4 Eladio y los seres queridos , 12 4 Lorena (homónimos) , 13 4 Cruz Martínez , 14 4 Salve Regina , 15 4 Mignons , 16 4 Mosteiro de Santa María de Palazuelos , 17 4 Igrexa de Santa María do Castelo de Castronuño , 18 4 Igrexa da Asunción de Castrillo de Duero , 19 4 Ponte e calzada romana de Becilla de Valderaduey , 20 4 Igrexa de San Martiño de Aldeamayor de San Martín , 21 4 Igrexa de Santiago Apóstolo de Alcazarén , 22 4 Igrexa de Santa María de Alaejos , 23 4 Vila romana de Almenara-Puras , 24 4 Canle de Castela , 25 4 Gatón do Bierzo

nov 2014: 1 7 Le Sacre du printemps , 2 6 Cayetana Fitz-James Stuart , 3 6 Historia dos xudeus de Tesalónica , 4 6 Dodro , 5 5 Vágar (concello) , 6 5 Tomás Batuecas Marugán , 7 5 Trinity College , 8 5 Asociación Cultural Cultura do País , 9 5 Laureano Araujo , 10 4 ACUDE , 11 4 Gloria Lago , 12 4 Harry Houdini , 13 4 Cruceiro da Santísima Trindade , 14 4 Día da Ciencia en Galego , 15 4 Novosibirsk , 16 4 La sombra del pasado , 17 4 Félix Calviño , 18 4 A esmorga (filme de 2014) , 19 4 Ans de Tellado, Paleo, Carral , 20 4 Michael Douglas , 21 4 Diocese católica latina de Tui-Vigo , 22 4 Xoana de Arco , 23 4 Michael Jackson , 24 4 Vincent van Gogh , 25 4 Economía dos Estados Unidos de América

dez 2014: 1 5 Norma de repertorio , 2 5 Norma sistémica , 3 4 Flag Fen , 4 4 Mestre de Sobrado , 5 4 Vetóns , 6 4 Intersistema cultural , 7 4 Proxecto Ronsel , 8 4 José Manuel García-Margallo , 9 4 José María Solé , 10 4 Inquietude , 11 4 Vontade , 12 4 Amizade , 13 4 Emotivismo , 14 4 Xenreira , 15 4 Satisfacción , 16 4 Lusofonía , 17 4 Javier Gómez Noya , 18 4 Michelangelo , 19 4 Dodro , 20 4 Baiona , 21 3 Capitanía Xeneral de Galicia , 22 3 Curtis Axel , 23 3 A coroa de fogo , 24 3 Microscopio óptico , 25 3 Handsup

jan 2015: 1 7 Galicia , 2 5 Banda de Música Municipal de Valga , 3 5 Gia Carangi , 4 5 Mundial de Fútbol de 2010 - Fase final , 5 5 Revolución de Outubro , 6 5 Rubia galega , 7 5 Condados de Romanía , 8 5 Generalitat de Cataluña , 9 5 Galipedia , 10 4 Cyperus eragrostis , 11 4 Frances Bean Cobain , 12 4 Manuel Jiménez de Parga , 13 4 Karl Gegenbaur , 14 4 Víctor Muñoz , 15 4 Víctor Muñoz Baijón , 16 4 Serramoura , 17 4 Charlie Hebdo , 18 4 Matt Damon , 19 4 Mundial de Fútbol de 2014 , 20 4 Mundial de Fútbol Suráfrica 2010 , 21 4 Unión Progreso y Democracia , 22 4 Vilarraso, Aranga , 23 4 Sudoku , 24 4 Algoritmo , 25 3 Eslovenia no Festival de Eurovisión

fev 2015: 1 8 Gato , 2 7 West Side Story (musical) , 3 7 Revolución de Outubro , 4 7 Taboada , 5 6 Afundación , 6 5 Faun , 7 5 Apóutega , 8 5 The Monochrome Set , 9 5 Sinfonía nº 8 (Sibelius) , 10 5 Silingos , 11 5 Lista de xefes de estado de México , 12 5 Ourense , 13 4 Capo , 14 4 The Pillars of the Earth , 15 4 Iana Kudriavtseva , 16 4 Abraham Olano , 17 4 Giro de Lombardía , 18 4 París-Tours , 19 4 José Antonio Hermida , 20 4 Amstel Gold Race , 21 4 Manifestación polo galego en febreiro de 2015 , 22 4 Xoaquín de Arévalo Rodríguez , 23 4 Rebeliom do Inframundo , 24 4 Castelo de Montealegre de Campos , 25 4 Teresa Rodríguez

mar 2015: 1 7 Festas Minervais , 2 6 Ramon Barnils i Folguera , 3 6 Festival de Eurovisión 2015 , 4 5 Herberto Helder , 5 5 Eclipse de Sol do 20 de marzo de 2015 , 6 5 Ibai Gómez , 7 5 Club de piragüismo Altruán de Ribadeo , 8 5 Festa dos Fachós , 9 4 Asociación Irimia , 10 4 Arsenie Boca , 11 4 Cecilia Payne-Gaposchkin , 12 4 Mar dos Argazos , 13 4 Fame Neghra , 14 4 Redes (TVE) , 15 4 Carmen Acuña , 16 4 Gwenda Thomas , 17 4 Casa Galicia de Nova York , 18 4 Jesús María Zamora , 19 4 Sam Simon , 20 4 Stana Katić , 21 4 Eleccións municipais de 2015 en Galicia , 22 4 Campionato do Mundo de Fútbol Gaélico , 23 4 CMS , 24 4 Finados en 2015 , 25 4 Eloi Caldeiro

abr 2015: 1 9 Contorna Persoal de Aprendizaxe , 2 8 Arquitectura en repositorio , 3 8 Rúa da Acibechería (Santiago de Compostela) , 4 7 Competencia dixital , 5 7 Arquitectura en pipeline , 6 7 Curación de contidos , 7 6 Eleccións municipais de 2015 en Galicia , 8 6 Rede social , 9 6 Slipknot , 10 6 Web 2.0 , 11 6 Xosé Filgueira Valverde , 12 5 Congreso da Emigración Galega , 13 5 Tallaght Stadium , 14 5 Tecnoloxía adecuada , 15 5 Arquitectura mestre-escravo , 16 5 María Francisca de Isla y Losada , 17 5 Agrupación Cultural Lóstrego , 18 4 Rescate financeiro , 19 4 Precursores , 20 4 Inscricións de Bir El Qutt , 21 4 Sistema experto , 22 4 Estrutura de datos , 23 4 Vieiros (revista) , 24 4 Instituto Galego de Información , 25 4 Lluís-Anton Baulenas

mai 2015: 1 7 Eleccións municipais de 2015 en Galicia , 2 6 Transpiración vexetal , 3 6 Fundación Rosalía de Castro , 4 6 Xosé Filgueira Valverde , 5 6 Galicia , 6 5 Compostela Aberta , 7 5 Aleida March , 8 5 Alóctono , 9 5 Carlos López García-Picos , 10 5 María do Carme Kruckenberg , 11 5 Revolución de Febreiro , 12 5 Carballo (homónimos) , 13 5 Charles Darwin , 14 5 Lingua galega , 15 4 Enrique Vázquez Lescaille , 16 4 Club Karepas , 17 4 Euphorbia ipecacuanhae , 18 4 Ipecacuaña , 19 4 Garbage plate , 20 4 Arnoglossus , 21 4 Enciclopedia Libre Universal en Español , 22 4 Módulo de Thiele , 23 4 Globo de Betanzos , 24 4 Hippoglossus hippoglossus , 25 4 Sidhe

jun 2015: 1 7 Le Sacre du printemps , 2 6 Eleccións municipais de 2015 en Galicia , 3 6 Johann Sebastian Bach , 4 5 Germán Garmendia , 5 5 Pablo Ruiz , 6 5 Rafael Nadal , 7 5 Eleccións municipais en Pontedeume , 8 5 Redondela , 9 5 Ourense , 10 5 Deportivo da Coruña , 11 4 Antonio Gómez Carneiro , 12 4 Anel de Nardó , 13 4 Code Lyoko: l'esercito dal nulla , 14 4 Code Lyoko: Il castello sotterraneo , 15 4 Tambores metálicos de Trinidad e Tobago , 16 4 Xogos Europeos de 2015 , 17 4 Bachfest Leipzig , 18 4 Liber chronicarum , 19 4 Intercambiador de calor , 20 4 Da terra asoballada , 21 4 MEO (operadora) , 22 4 CMTV , 23 4 Certeza , 24 4 Nomes da folla do piñeiro en Galicia , 25 4 Festival de Eurovisión 2015

jul 2015: 1 9 J. R. R. Tolkien , 2 8 Georg Friedrich Händel , 3 6 Asociación Galega de Fútbol Gaélico , 4 6 Xosé Neira Vilas , 5 6 Johann Sebastian Bach , 6 5 Liu Gang , 7 5 Galicia Bilingüe , 8 5 Prado, Lalín , 9 5 Michelangelo , 10 5 Velocidade da luz , 11 5 Manuel María , 12 4 Francisco Domínguez Romero , 13 4 Rocío Leira , 14 4 Falcón da raíña , 15 4 Curuxa gabián , 16 4 Amizade por correspondencia , 17 4 Fra Angelico , 18 4 Dorna FG , 19 4 Pigargo , 20 4 Michel Azama , 21 4 Smaug (xénero) , 22 4 DiSEqC , 23 4 Adonis (poeta) , 24 4 Jacob Frank , 25 4 Gastroenterite

ago 2015: 1 8 Angkor Wat , 2 7 Finados en 2015 , 3 6 Georg Friedrich Händel , 4 5 Henrique Mitchell de Paiva Couceiro , 5 5 Cristóval , 6 5 Louredo, Maside , 7 4 Maccabi Tel Aviv F.C. , 8 4 Nosa Señora de Lourdes , 9 4 Arciprestado de Montes-Mondariz , 10 4 Illa Roti , 11 4 Terra de Montes , 12 4 Explosión no porto de Tianjin , 13 4 Guarda Nacional Republicana , 14 4 Cevide , 15 4 Praia de Covas , 16 4 Praia de Areas , 17 4 Praia de Bascuas , 18 4 Alireza Panahian , 19 4 Estevo Vladislau II da Serbia , 20 4 Igrexa de San Nicolao de Portomarín , 21 4 David (Michelangelo) , 22 4 PubChem , 23 4 Xudit e Holofernes (Donatello) , 24 4 Oleiro valenciano , 25 4 As Ferrarías, A Veiga de Valcarce

set 2015: 1 10 Edward Elgar , 2 7 Carlos López García-Picos , 3 6 Angkor Wat , 4 5 The Martian , 5 5 432 Park Avenue , 6 5 Casa consistorial do Porriño , 7 5 Holguín , 8 5 Diamante mandarín , 9 5 Hospital Álvaro Cunqueiro , 10 5 Laika , 11 5 Buenos Aires , 12 4 Porta do Sol , 13 4 One World Trade Center , 14 4 Parlamento de Croacia , 15 4 Cronoloxía do descubrimento dos planetas do Sistema Solar e os seus satélites naturais , 16 4 Igrexa da Soidade de Vigo , 17 4 Colexiata de Cangas , 18 4 Ricard Terré , 19 4 ChEMBL , 20 4 Campionato europeo de baloncesto de 2015 , 21 4 New England Revolution , 22 4 Necrofaxia , 23 4 OwnCloud , 24 4 Gálea , 25 4 Vila do Bispo

out 2015: 1 10 Ribadeo , 2 8 Ácido desoxirribonucleico , 3 7 Ruta da Ría , 4 7 Svetlana Alexievich , 5 6 Cronoloxía do descubrimento dos planetas do Sistema Solar e os seus satélites naturais , 6 6 CIFP Porta da Auga , 7 6 Xirafa , 8 6 Avespa asiática , 9 6 A Coruña , 10 5 Caspar Friedrich Wolff , 11 5 Avia Veira , 12 5 Premio de poesía Avelina Valladares , 13 5 A praia dos afogados (filme) , 14 5 A praia dos afogados , 15 5 Oza, A Coruña , 16 5 Charles Darwin , 17 5 Covelas, Ribadeo , 18 4 José Barral Souto , 19 4 2014 MU69 , 20 4 Akita Inu , 21 4 Cinto de Kuiper , 22 4 Premio de Teatro Mome Varela Buxán , 23 4 Coral Polifónica de Ribadeo , 24 4 Sant'Angelo Lodigiano , 25 4 Premio xornalístico Manuel Reimóndez Portela

nov 2015: 1 9 Xosé Neira Vilas , 2 7 Eleccións xerais de España de 2015 , 3 6 Economía na Hispania romana , 4 6 Carlos Oroza , 5 5 En Marea , 6 5 Kyle XY , 7 5 Premio San Martiño de normalización lingüística , 8 5 Rocío de Frutos , 9 5 Montreal Canadiens , 10 5 Xosé Chao Rego , 11 5 Darío Villanueva , 12 5 Graba, Silleda , 13 5 Catedral de Santiago de Compostela , 14 4 Ricardo Llovo , 15 4 Urxa , 16 4 Casa do Consulado , 17 4 Xogo de mesa , 18 4 Cloruro de guar hidroxipropiltrimonio , 19 4 Antón Gómez-Reino , 20 4 Castelo de Aranga , 21 4 Teoría da Conspiración Jade Helm 15 , 22 4 Mareas cidadás , 23 4 Pingüín emperador , 24 4 Finados en 2015 , 25 4 Galiciencia

dez 2015: 1 10 Eleccións xerais de España de 2015 , 2 6 Erythrura gouldiae , 3 6 Preste Xoán , 4 6 Pensamento crítico , 5 6 En Marea , 6 6 Fauna de Ediacara , 7 5 Baixo (voz) , 8 5 Liña Ribadeo - Vilaoudriz , 9 5 Rhodospingus cruentus , 10 5 Juan Manuel , 11 5 La Philosophie dans le boudoir , 12 5 Podemos , 13 5 Historia dos xudeus de Tesalónica , 14 5 Galicia , 15 4 Lorenzo Piretto , 16 4 Platycercus eximius , 17 4 Frayre de Joy e Sor de Plaser , 18 4 A Roda, Tapia , 19 4 Sorpresa , 20 4 Chernóbil , 21 4 El Libro del cavallero Zifar , 22 4 Periquito , 23 4 Les Merveilles de Rigomer , 24 4 Aymeric Laporte , 25 4 Razoamento

jan 2016: 1 9 Galegofobia , 2 8 Escultura románica , 3 8 España , 4 7 Carles Puigdemont , 5 6 Golgona Anghel , 6 6 Edificio Itatiaia , 7 6 Certificado de estudos de lingua galega , 8 6 David Bowie , 9 5 José Julio Fernández Rodríguez , 10 5 Rachel McAdams , 11 5 Der Zauberberg , 12 5 Naturopatía , 13 5 Sos del Rey Católico , 14 5 Guillermo Lago , 15 5 Televés , 16 5 Antón Losada Diéguez , 17 5 Fragas do Eume , 18 4 Glutón , 19 4 Múon , 20 4 Chaetophractus vellerosus , 21 4 Columnas galegas , 22 4 Giovanni Battista Ramusio , 23 4 Reserva da biosfera Río Eo, Oscos e Terras de Burón , 24 4 Steam , 25 4 Hematémese

fev 2016: 1 9 Arteixo , 2 8 Xesús de Nazaret , 3 7 Israel , 4 6 IES María Sarmiento , 5 6 Xornadas de Xullo , 6 5 David Mackenzie , 7 5 Xavier Estévez Ferreiro , 8 5 Vilacide de Abaixo, Oroso, Oroso , 9 5 Veronica Guerin , 10 5 Janko Kamauf , 11 5 Celeirós, Pedrafita, A Teixeira , 12 5 Manor Racing , 13 5 Finados en 2016 , 14 5 Bloque Nacionalista Galego , 15 5 Entroido , 16 4 José Pascual López Cortón , 17 4 Le Journal d'une femme de chambre , 18 4 Campións do Aberto de Australia (individual mulleres) , 19 4 Veleučilište VERN' , 20 4 Mattsee , 21 4 Illa de San Borondón , 22 4 Parada na porta da escola , 23 4 Fuji Television , 24 4 Luís VII de Francia , 25 4 Zengi

mar 2016: 1 7 Antía Nara , 2 7 Atlanta Flames , 3 7 Ángela Ruiz Robles , 4 6 Georgii Chicherin , 5 6 As Pontes de García Rodríguez , 6 5 Lingua diula , 7 5 Luis Carlos de la Peña , 8 5 Las Lajas, Neuquén , 9 5 Ryder Hesjedal , 10 5 Cruz do Monte, Trasmonte, Oroso , 11 5 Golpe de estado de Kornilov , 12 5 Grandes Voltas , 13 5 Audioslave , 14 5 Anxo Quintana , 15 5 Manuel María , 16 5 Bloque Nacionalista Galego , 17 5 Ada Lovelace , 18 5 Rosalía de Castro , 19 5 Galicia , 20 4 Padroado da cultura galega de México , 21 4 Airbnb , 22 4 London Palladium , 23 4 Will Ferrell , 24 4 John Deacon , 25 4 Bear Grylls

abr 2016: 1 14 Curación de contidos , 2 11 Rede social , 3 10 Competencias básicas , 4 9 Web 2.0 , 5 8 Contorna Persoal de Aprendizaxe , 6 8 Coala , 7 8 Kilimanjaro , 8 7 Competencia dixital , 9 7 Arteixo , 10 6 Boletín de Estudios del Seminario Fontán-Sarmiento de Hagiografía, Toponimia y Onomástica de Galicia , 11 6 Terra Chá (poemario) , 12 6 Krzysztof Penderecki , 13 6 Grigorii Rasputin , 14 6 Amy Winehouse , 15 6 Universidade de Vigo , 16 5 Centro Gallego de La Habana , 17 5 Jean Giraudoux , 18 5 Atanasoff–Berry computer , 19 5 Festas de interese turístico de Galicia , 20 5 Conflito entre Uber e os taxis , 21 5 Padroado da cultura galega de México , 22 5 Finados en 2016 , 23 5 Einojuhani Rautavaara , 24 5 Chus Lampreave , 25 5 Onésimo Redondo

mai 2016: 1 7 Osíxeno , 2 5 Xornadas da Cultura Galega , 3 5 Pelegrín , 4 5 Implantes de polipropileno , 5 5 Festival de Eurovisión 2017 , 6 5 Xosé Duncan , 7 5 Camiño Francés , 8 5 Vicente Peña Saavedra , 9 5 Aborixes australianos , 10 5 Feísmo , 11 5 Coala , 12 5 Arteixo , 13 5 Día das Letras Galegas , 14 5 Xadrez , 15 4 Asistente persoal intelixente , 16 4 Rafael Cadenas , 17 4 Baxar Uarda , 18 4 Valerià Paül Carril , 19 4 Monte Alto, A Coruña , 20 4 Caldeira , 21 4 Enórmic Banda , 22 4 Compresor scroll , 23 4 Lucas Vázquez , 24 4 Arquieparquía católica caldea de Arbil , 25 4 Festival de Eurovisión Júnior 2016

jun 2016: 1 8 Eleccións xerais de España de 2016 , 2 7 Kathleen Ferrier , 3 7 Acción Integralista Brasileira , 4 5 Malandrómeda , 5 5 Partido Comunista da Federación Rusa , 6 5 Negociacións Vikzhel , 7 5 O'Brien Trophy , 8 5 Deméter , 9 5 Pedro Pablo Kuczynski , 10 5 Barcala, A Baña , 11 5 A Baña, A Baña , 12 4 Henrietta Swan Leavitt , 13 4 Curro da Valga , 14 4 Aligátor do Mississippi , 15 4 Palacio de Aquisgrán , 16 4 Estación de Liubliana , 17 4 Meme (Internet) , 18 4 Illas Senkaku , 19 4 Partido Social Nacionalista Sirio , 20 4 Microevolución , 21 4 Michał Kwiatkowski , 22 4 Cor pulmonale , 23 4 Diego Giráldez , 24 4 Prince of Wales Trophy , 25 4 Clarence S. Campbell Bowl

jul 2016: 1 8 India , 2 7 Schachnovelle (ópera) , 3 6 Atentado de Niza de 2016 , 4 6 Finados en 2016 , 5 6 Escultura da Roma antiga , 6 5 Caimán almiscreiro común , 7 5 Batalla de Carabobo (1814) , 8 5 Federación Mundial de Sociedades Galegas , 9 5 Área Metropolitana de Vigo , 10 4 Teatro romano de Mérida , 11 4 Gaetano Bresci , 12 4 La Nueva España , 13 4 Joan Ridao , 14 4 Teatro romano , 15 4 Micaela Navarro , 16 4 Manuel Valls , 17 4 Rebecca Clarke , 18 4 Desterro , 19 4 Tetrodotoxina , 20 4 Estado de Chuuk , 21 4 Depresión Meridiana , 22 4 Ragnar Sigurðsson , 23 4 Humanismo (filosofía) , 24 4 Auckland Grammar School , 25 4 Kathleen Ferrier

ago 2016: 1 11 Deportivo da Coruña , 2 6 Escultura da Roma antiga , 3 6 Richard Wagner , 4 5 Meliloto , 5 5 Ortiga morta , 6 5 Rosa de Lima , 7 5 Michele Angiolillo , 8 5 Luís Villares , 9 5 Lista de réptiles de Galicia , 10 5 Gonzalo Caballero , 11 5 Baiona , 12 4 Igrexa de Santa María do Azougue , 13 4 Bárbara Iglesias , 14 4 Anatoli Boukreev , 15 4 Sapo parteiro común , 16 4 Cadrifollo , 17 4 London Overground , 18 4 Herba da prata , 19 4 Víctor Mora , 20 4 Partido xudicial de Lalín , 21 4 Praia do Son , 22 4 Picanzo isabel , 23 4 Dique , 24 4 Irmán , 25 4 Pazo das Torres de Cereixo

set 2016: 1 16 Eleccións ao Parlamento de Galicia 2016 , 2 8 Richard Wagner , 3 7 Reparación do ADN , 4 6 Aletta Ocean , 5 6 Frankenstein ou o moderno Prometeo , 6 6 Alberto Núñez Feijóo , 7 6 Alzhéimer , 8 5 My Little Pony , 9 5 Miss Mundo , 10 5 Caimán negro , 11 5 Trindade, Goiás , 12 5 Baía de Baiona , 13 5 Porto do Son , 14 5 Castelo de Santo Antón , 15 5 India , 16 5 Florentino López Cuevillas , 17 5 Vigo , 18 5 Galicia , 19 4 Pato castaño , 20 4 Luis Álvarez Martínez , 21 4 Tancredo de Hauteville , 22 4 Vibo Valentia , 23 4 Síndrome da muller branca desaparecida , 24 4 Universidade Johns Hopkins , 25 4 Pilar Pérez Solano

out 2016: 1 9 Vigo , 2 8 Cerdedo-Cotobade , 3 8 Lei orgánica para a mellora da calidade educativa , 4 6 Miranda do Corvo , 5 6 Torre de Guimarei , 6 6 Iago Fernández , 7 6 España , 8 5 Āyurveda , 9 5 Manuel Diz Ramos , 10 5 Edificio Curbera , 11 5 Aleksandr Sokúrov , 12 5 Concerto delle donne , 13 5 Fran Cortegoso , 14 5 Onda electromagnética , 15 5 Camiño Portugués , 16 5 Orcadas , 17 5 Duna , 18 4 The Hunger Games (libros) , 19 4 IES San Rosendo , 20 4 Tea (planeta) , 21 4 Georg Leisner , 22 4 Asociación Coro Gospel Vida , 23 4 Gurumelo , 24 4 Geraldine Chaplin , 25 4 Lista de soberanos de Sicilia e Nápoles

nov 2016: 1 7 Dicionario da Real Academia Galega , 2 7 Xosé Docampo Vázquez , 3 6 Narf , 4 6 Donald Trump , 5 6 Ángel Castro Argiz , 6 6 Moaña , 7 5 Diccionario da Real Academia Galega , 8 5 Sicixia (filme) , 9 5 Sword Art Online , 10 5 Catedral de Palermo , 11 5 Clara Clemens , 12 5 Música para piano de Gabriel Fauré , 13 5 Uxío Abuín , 14 5 Batalla de Elviña , 15 5 Carta xeométrica de Galicia , 16 5 Vaca , 17 5 Fidel Castro , 18 4 Johan Hegg , 19 4 Caneiro de Don Eduardo , 20 4 Massimo Spadano , 21 4 Manuel Lesteiro Martínez , 22 4 PlayStation 4 , 23 4 Melania Trump , 24 4 Literatura do Romanticismo en Alemaña , 25 4 Templo de Xúpiter Óptimo Máximo

dez 2016: 1 9 Finados en 2016 , 2 7 Faro das Illas Sisargas , 3 6 Premio Estornela , 4 5 Mare Ingenii , 5 5 Mar lunar , 6 5 Cousas que trouxo a chuvia , 7 5 Atentado de Berlín de 2016 , 8 5 Persecucións aos cristiáns , 9 5 Antonio Palacios Ramilo , 10 5 Bibiano , 11 4 Singin' in the Rain , 12 4 Mofeta , 13 4 José Grande Juncal , 14 4 Cara visible da Lúa , 15 4 Mare Australe , 16 4 Lista de mares lunares , 17 4 Lista de cráteres lunares , 18 4 Antoine Goüan , 19 4 John Keats , 20 4 Carrie Fisher , 21 4 Nir Yaniv , 22 4 Tetronarce nobiliana , 23 4 Instituto do Templo , 24 4 Escola de Borgoña , 25 4 Biblioteca Pública Central de Vigo

jan 2017: 1 8 Finados en 2017 , 2 6 Troglodítidos , 3 6 Arrival (filme) , 4 6 Partícula beta , 5 6 Golpe de estado en Irán de 1953 , 6 6 Gran viaxe da familia Mozart , 7 5 Río Romeán , 8 5 Axencia Galega de Noticias , 9 5 Gran Mesquita de Djenné , 10 5 Guerra civil chinesa , 11 5 Mozart en Italia , 12 5 Alcrique , 13 5 Segunda guerra mundial , 14 5 Israel , 15 5 A Illa de Arousa , 16 5 Galicia , 17 4 Lion (filme de 2016) , 18 4 A Brea, Bascuas, Lugo , 19 4 Bascuas, Bascuas, Lugo , 20 4 Brumado , 21 4 Carassius , 22 4 Brema , 23 4 Manchester by the Sea (filme) , 24 4 Leboreiro, Seoane Vello, Montederramo , 25 4 La La Land (filme)

fev 2017: 1 9 Jane Joseph , 2 8 Lista de científicas , 3 8 Vera Zasulich , 4 7 Revolución de Maio , 5 7 República Soviética Húngara , 6 6 Carmen Santos , 7 6 Rosalía de Castro , 8 5 Castro de Ferreira , 9 5 Dygra Films , 10 5 Sabre , 11 5 Revista Galega de Filoloxía , 12 5 Carrapucho , 13 5 Finados en 2017 , 14 5 Miguel Tellado , 15 5 Pataca , 16 5 Galicia , 17 4 Sudario , 18 4 Cama elástica , 19 4 Chris Bristow , 20 4 Coada , 21 4 Vera Popova , 22 4 Tim Behrens , 23 4 Fosa común , 24 4 Arciprestado de Ferreira de Pantón , 25 4 Celia Brañas

mar 2017: 1 10 Rosalía de Castro , 2 8 Sinfonía coral , 3 8 Catedral de Santiago de Compostela , 4 6 Mariano Fragueiro , 5 6 Sandra Ortega , 6 6 Xoana de Arco , 7 5 Geranium , 8 5 Ética do dereito , 9 5 Couza guatemalteca , 10 5 A Balsa da Medusa , 11 5 Wismichu , 12 5 Mary Wollstonecraft , 13 5 Cobre , 14 5 O Grove , 15 5 Narón , 16 5 Estados Unidos de América , 17 4 Irmandade Galeguista do Uruguai , 18 4 Pobo masai , 19 4 Beauty and the Beast (filme de 2017) , 20 4 A Bela e a Besta , 21 4 Cleopatra (filme de 1917) , 22 4 Atlantismo , 23 4 Intercambio colombiano , 24 4 Hidróxido , 25 4 Kazuyoshi Hoshino

abr 2017: 1 8 Rosalía de Castro , 2 6 Obras variadas para piano só (Rachmaninov) , 3 6 Xornadas de Cine de Ourense , 4 6 Georges Bizet , 5 6 Carme Chacón , 6 6 Segunda guerra mundial , 7 5 Ramón Ferro , 8 5 Óscar Graña , 9 5 Exposición Rexional Galega , 10 5 Justo Pico de Coaña , 11 5 Nadezhda Krupskaia , 12 5 Sítidos , 13 5 Golpe de Estado do 18 de xullo de 1936 , 14 5 Fely Manzano , 15 5 Alfonso Daniel Rodríguez Castelao , 16 5 Esperanto , 17 4 Universitarios. Revista de la F.U.E. , 18 4 La Jetée , 19 4 Romanceiro popular galego de tradición oral , 20 4 Exequias da Raíña Margarida , 21 4 Once portas , 22 4 Igrexa de Santo Antoíño de Baíñas , 23 4 Antía Veres , 24 4 Leopoldina Fortunati , 25 4 José Eleicegui López

mai 2017: 1 12 Carlos Casares , 2 8 Basílica de Santo Isidoro de León , 3 7 Certame Literario Musical de O'Galiciano , 4 7 Matusa Barros , 5 7 Galicia , 6 6 Manel Navarro , 7 6 José María Rodríguez Díaz , 8 6 Alleeiros , 9 6 Editorial Citania , 10 5 Gerda Taro , 11 5 , 12 5 O Mono da Tinta , 13 5 Grupo 1500 , 14 5 Semana Santa de Lugo , 15 5 Festival de Eurovisión 2018 , 16 5 Aleksandr Kolchak , 17 5 Festival de Eurovisión 2017 , 18 5 Chris Cornell , 19 5 Istambul , 20 5 Real Club Celta de Vigo , 21 4 José Miguélez Pampín , 22 4 Esa-Pekka Salonen , 23 4 Nicky Hayden , 24 4 Galería de imaxes de placas altimétricas dos concellos da provincia de Lugo , 25 4 Cadernos do povo

jun 2017: 1 8 Maite Veiga , 2 8 María Victoria Moreno , 3 7 Finados en 2017 , 4 6 Andrés Toxeiro , 5 6 Andrea Dworkin , 6 5 Mar adiante , 7 5 Teorías da aprendizaxe , 8 5 Imperio de Malí , 9 5 Santiago Lopo , 10 5 Narf , 11 5 Anagnórise (novela) , 12 5 Noite de san Xoán , 13 4 Espionaxe , 14 4 Óscar García Junyent , 15 4 Shih-tzu , 16 4 My Little Pony: Friendship Is Magic , 17 4 Cámaras Time of Flight , 18 4 Arundhati Roy , 19 4 Clarice Lispector , 20 4 Morteiro (arma) , 21 4 Tomorrowland , 22 4 Peaxes , 23 4 Precuela , 24 4 Obxecto de aprendizaxe , 25 4 Pablo Fernández Barba

jul 2017: 1 9 Crocodilianos , 2 7 Estrea da Sinfonía n.º 7 de Shostakovich en Leningrado , 3 7 Finados en 2017 , 4 7 Corazón , 5 5 Diario da luz e a sombra , 6 5 Poruchik Kizhe (Prokofev) , 7 5 Miguel Blesa , 8 5 Rosario Mariño de Lobeira , 9 5 Ser humano , 10 4 Olavo de Carvalho , 11 4 Paulo Ricardo , 12 4 Leonardo e os fontaneiros , 13 4 Maryam Mirzakhani , 14 4 Nina Hagen , 15 4 Isaac Fernández , 16 4 Monte da Picaraña , 17 4 Clarice Lispector , 18 4 Six moments musicaux (Rachmaninov) , 19 4 George A. Romero , 20 4 Praia dos Cristais , 21 4 Rafael Berges , 22 4 Historia dos eslavos do sur , 23 4 Centro Galego de Artes da Imaxe , 24 4 Anagnórise (novela) , 25 4 Laureano Sanabria

ago 2017: 1 9 Atentados de Cataluña de 2017 , 2 8 Olaia Ledo Díaz , 3 7 Finados en 2017 , 4 6 Rico , 5 5 Fidel Diéguez , 6 5 Arnau Pons , 7 5 Petrotilapia chrysos , 8 5 Abelmoschus manihot , 9 5 Carlos Vasallo , 10 5 Píseň bohatýrská , 11 5 Poruchik Kizhe (Prokofev) , 12 5 Día das Letras Galegas , 13 4 Castelanización , 14 4 Santa Isabel (barco) , 15 4 Marroio , 16 4 Alas de papel , 17 4 María Alonso Seisdedos , 18 4 Ana María Bejarano Escanilla , 19 4 Svetlana Ražnatović , 20 4 Greenwashing , 21 4 Illa Nelson (Alasca) , 22 4 Pablo Rubén Eyré , 23 4 Kindness , 24 4 Vireo caribaeus , 25 4 Jaume Collboni

set 2017: 1 7 Cromatóforo , 2 6 David Ortiz , 3 6 Manuela Varela , 4 6 Golf , 5 5 Vítor Manuel II de Italia , 6 5 Masculino xenérico , 7 5 Finados en 2017 , 8 5 María Victoria Moreno , 9 5 Xohana Torres , 10 5 Severo Ochoa , 11 5 Israel , 12 4 Democracia Ourensana , 13 4 Eric Voegelin , 14 4 Cabalos e lobos , 15 4 Test de Bechdel , 16 4 Arde amor , 17 4 Pamela Palenciano , 18 4 Aterosclerose , 19 4 Uvas e granito , 20 4 Calouste Gulbekian , 21 4 Referendo sobre a independencia de Cataluña de 2017 , 22 4 Magdalena Aguinaga Alfonso , 23 4 Pobo xudeu , 24 4 Carlos Negreira , 25 4 Rafael Nadal

out 2017: 1 12 Cataluña , 2 9 República Catalá , 3 9 Carles Puigdemont , 4 8 Vaga de incendios forestais de 2017 en Galicia , 5 7 Claude Lorrain , 6 7 Referendo sobre a independencia de Cataluña de 2017 , 7 7 Traité d'instrumentation et d'orchestration , 8 6 Satenta , 9 6 Finados en 2017 , 10 6 Alberto Núñez Feijóo , 11 6 Dodo , 12 5 Rafael Bárez , 13 5 Marcos Abalde , 14 5 Baldo Ramos , 15 5 Roberto Vidal Bolaño , 16 5 Calgary Flames , 17 5 Galicia , 18 4 Proceso independentista catalán , 19 4 Roubo de identidade , 20 4 Biblioteca da Universidade da Coruña , 21 4 Beni Yáñez , 22 4 Louza de Delft , 23 4 Furacán Ophelia de 2017 , 24 4 Illa Bray , 25 4 As flores radioactivas

nov 2017: 1 8 Pixar , 2 7 Intempo , 3 7 Carl von Linné , 4 7 Mozilla Firefox , 5 6 Xesús Culebras , 6 6 Eastern Telegraph Company , 7 5 Mario Diz , 8 5 Termas romanas , 9 5 1I/ʻOumuamua , 10 5 Orquestra de Espazo de Cámara da Universidade de Santiago de Compostela , 11 5 Pórtico do Paraíso , 12 5 Penicilina , 13 5 Proxecto Manhattan , 14 5 Isidro Parga Pondal , 15 4 Premio de novela por entregas de La Voz de Galicia , 16 4 Clara Millán González , 17 4 Río Bouzós , 18 4 Schenkenschanz , 19 4 José Luis de Frutos , 20 4 Barbara Walters , 21 4 Hedda Hopper , 22 4 Rider técnico , 23 4 Derivación (lingüística) , 24 4 Fodiña , 25 4 Orquestra sinfónica

dez 2017: 1 8 Carl von Linné , 2 6 Charlotte Perkins Gilman , 3 6 Biblia Kennicott , 4 6 Anton van Dyck , 5 5 Tabarnia , 6 5 Eleccións ao Parlamento de Cataluña 2017 , 7 5 Salvador Peña Martín , 8 5 Dominio real francés , 9 5 Manuel Marín , 10 5 Discriminación , 11 5 Age of Empires II: The Age of Kings , 12 5 Children of Men , 13 5 María Victoria Moreno , 14 5 Max Born , 15 5 Literatura galega do século XX , 16 5 Cataluña , 17 5 Xosé Luís Franco Grande , 18 4 À Punt Mèdia , 19 4 Ezio Auditore , 20 4 Vitoria Ogando , 21 4 Gabriella Morreale , 22 4 Julián Sánchez Bort , 23 4 Add Violence , 24 4 Las Maestras de la República , 25 4 Pluralismo de valores

jan 2018: 1 7 Cultura da violación , 2 7 Albert Camus , 3 7 Galicia , 4 6 Alan Lee , 5 6 Biblia Kennicott , 6 6 Rosa Luxemburg , 7 6 India , 8 5 Roger Torrent i Ramió , 9 5 Casilda Rodrigáñez , 10 5 Cristina Pardo , 11 5 Ricardo Dorado Janeiro , 12 5 Ara de Eiras , 13 5 Finados en 2018 , 14 5 Sinfonía núm. 3 (Górecki) , 15 5 Persoas supercentenarias e centenarias galegas , 16 5 Penicilina , 17 5 Kazuo Ishiguro , 18 4 Nella Larsen , 19 4 Cormac mac Cuilennáin , 20 4 Daniel Ripa , 21 4 7 Wonders (xogo de mesa) , 22 4 Ponte da Amizade , 23 4 Lope de Ulloa y Lemos , 24 4 Juan Benet , 25 4 Dogville

fev 2018: 1 7 Eugenia Osterberger , 2 7 Finados en 2018 , 3 6 Licaón (mitoloxía) , 4 6 Maternidade , 5 6 Galicia , 6 5 Rebeca Atienza , 7 5 Elisa Díaz , 8 5 Ramona Vaamonde , 9 5 Dolores Lombardero , 10 5 Manuela Barreiro , 11 5 Billy Graham , 12 5 Alicia do Reino Unido , 13 5 Lingua mirandesa , 14 4 Arquivo de Galicia , 15 4 Ángel Durán Álvarez , 16 4 Balbina López Somoza , 17 4 Dolores Lorenzo Salgado , 18 4 Ascensión Vidal Piazuelo , 19 4 Helmuth Koinigg , 20 4 Irish Independent , 21 4 Novas do Eixo Atlántico , 22 4 Revolta das Pedradas , 23 4 Germán Sierra Paredes , 24 4 Costumari Català , 25 4 Día dos Medios en Galego

mar 2018: 1 8 Día Internacional da Muller , 2 7 Ramiro Vidal Carrera , 3 6 O coelliño branco , 4 6 Eugenia Pereira Rodríguez , 5 6 Dhogs , 6 6 Margaret Brown , 7 6 Stephen Hawking , 8 6 Reino de Galicia , 9 5 Obdulia Díaz , 10 5 Irmás Touza , 11 5 Fariña (serie de televisión) , 12 5 Irene Milleiro , 13 5 Eugenia Osterberger , 14 5 Anticorpo , 15 5 Wernher von Braun , 16 5 Ricardo Carballo Calero , 17 5 Belarús , 18 5 Illas Malvinas , 19 4 Pretérito Imperfeito (1927-1961) , 20 4 Españolada , 21 4 Joe Sugg , 22 4 Zoella , 23 4 José Imaz Baquedano , 24 4 Os Artistiñas , 25 4 Erupción do Eyjafjallajökull do 2010

abr 2018: 1 9 Cristina Cifuentes , 2 8 Nelson Mandela , 3 7 María Victoria Moreno , 4 6 Partido Froilanista , 5 5 Koke Resurrección , 6 5 Latrodectus , 7 5 Facultade de Xeografía e Historia de Santiago de Compostela , 8 5 Casahamlet , 9 5 Praza da Universidade , 10 5 Praza de Mazarelos , 11 5 Instituto Xelmírez , 12 5 Luz Darriba , 13 5 Sotelo Blanco Edicións , 14 5 Juan Manuel de Prada , 15 5 Finados en 2018 , 16 5 Ramiro Vidal Carrera , 17 5 Manuel María González López , 18 5 Illas Malvinas , 19 4 Squamata , 20 4 Mauro Pezzente , 21 4 Doctrina nazonalista , 22 4 Every Breath You Take , 23 4 Gonzalo Jar Couselo , 24 4 Praia de Caldebarcos , 25 4 Soto

mai 2018: 1 8 España , 2 7 Festa do melindre de Melide , 3 7 Execución da familia Romanov , 4 6 Adriano Domínguez , 5 6 Máis alá! , 6 5 Nós Televisión , 7 5 Sobreiral do Arnego , 8 5 Boops boops , 9 5 Mensajes de poesía , 10 5 Pilar Bermejo Barrera , 11 5 Finados en 2018 , 12 5 Pagellus , 13 5 Conan o bárbaro (filme) , 14 5 Castañeta encarnada , 15 5 Ollomol , 16 5 Grupo Brais Pinto , 17 5 María Victoria Moreno , 18 5 Maragota , 19 5 Berta Cáccamo , 20 5 Río de Xaneiro , 21 4 Antón de Borbón , 22 4 Loris Karius , 23 4 A Viñeta de Schrödinger , 24 4 Día das Galegas nas Letras , 25 4 Moeda bizantina

jun 2018: 1 12 Pedro Sánchez , 2 9 Nadia Calviño , 3 7 Mariano Rajoy , 4 6 Beatriz Guiance Rostro , 5 6 Castañeta encarnada , 6 6 Xabier P. DoCampo , 7 5 Ernst Jünger , 8 5 Charles Maurras , 9 5 Aspazija , 10 5 Pobo español , 11 5 Isaac Cordal , 12 5 Adriano Domínguez , 13 5 Plácido Betanzos , 14 5 Carles Puigdemont , 15 5 José Luis Meilán Gil , 16 5 Maragota , 17 5 Fermín Penzol , 18 5 Afonso VIII de León e Galicia , 19 5 Uxío Carré Aldao , 20 5 Copa do Mundo de Fútbol , 21 4 Libelloides coccajus , 22 4 Ferran Hurtado Sanchis , 23 4 Архипелаг ГУЛАГ , 24 4 Bugalliña , 25 4 Giovanni Papini

Wikipedias are initially ordered by number of speakers of the language

Speakers: Number of speakers of a language is the estimated total of primary and secondary speakers, is in many cases a very rough estimation (based on the page on the English Wikipedia about that language)
Regions are parts of the world where the language is spoken in substantial amounts (compared to total number of speakers). Regions where a language gained presence only by a recent diaspora are generally not included.
Region codes: AF:Africa, AS:Asia, EU:Europe, NA:North America, OC:Oceania, SA:South America, W:World Wide, CL:Constructed Language

Estatísticas geradas em Sábado, 7 de julho 2018 23:10

Dump file glwiki-20180701-stub-meta-history.xml.gz (edits only), size 327 Mb as gz -> 2.1 Gb
Dump processed till Jun 30, 2018, on server stat1005, ready at Sun-01/07/2018-21:51 after 15 min, 48 sec.

Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### =
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.