Estatísticas da Wikipédia galego

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Articles per size range / Records per namespace / Most edited articles / Zeitgeist
 
  Dec 2017: WMF Analytics Team is happy to announce the first release of Wikistats 2
  

  Wikistats has been redesigned for architectural simplicity, faster data processing, and a more dynamic and interactive user experience. The data used in the reports will also be made available for external processing.  

  First goal is to match the numbers of the current system, and to provide the most important reports, as decided by the Wikistats community (see survey).  
  Over time, we will continue to migrate reports and add new ones that you find useful. We can also analyze the data in new and interesting ways, and look forward to hearing your feedback and suggestions.  

  You can go directly to Wikipedia galego

  

Most metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.

Some metrics have been collected from the full archive dump which runs on lower frequency than the usual monthly cycle.
These metrics are columns F,I,J,K,M,N,O,P,Q,R from the first table.


See also metrics definitions


 
Monthly counts & Quarterly rankings: novembro 2018
 
DataWikipedistasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
nov 20180% +3%-6%0% -39%    +10%      +1%
out 20180% +8%+21%+1% +38%    -27%      +2%
set 20180% -2%-10%0% +20%    -18%      +1%
ago 20180% +5%+19%0% -23%    -8%      +1%
jul 20180% -17%+4%+1% -16%    +130%      +1%
jun 2018+1% -22%-22%+1% +7%    -1%      +1%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P____Q____R____S__
nov 2018238878932153 k 2026,1   27 k      66 k
out 2018238198634152 k 3326   24 k      65 k
set 2018237288028151 k 2426   33 k      64 k
ago 20182364108231151 k 2025,9   41 k      64 k
jul 20182354107826150 k 2625,7   44 k      63 k
jun 20182344139425149 k 3125,6   19 k      63 k
mai 201823312912132148 k 2925,6   19 k      62 k
abr 201823022210033147 k 2825,6   24 k      62 k
mar 20182280209729147 k 3025,6   30 k      61 k
fev 20182260148426146 k 2825,6   17 k      60 k
jan 20182246108727145 k 2625,6   27 k      60 k
dez 20172236118327144 k 3925,6   24 k      59 k
nov 20172225148224143 k 2525,6   23 k      58 k
out 20172211128125142 k 3025,6   19 k      57 k
set 2017219968226141 k 2225,6   46 k      56 k
ago 20172193138823141 k 1925,4   21 k      55 k
jul 20172180117826140 k 1425,3   26 k      55 k
jun 20172169119225140 k 1925,2   31 k      54 k
mai 201721581810723139 k 1925,1   39 k      54 k
abr 20172140199828138 k 2425   22 k      53 k
mar 20172121127825138 k 4424,9   48 k      53 k
fev 20172109107627136 k 3124,8   23 k      52 k
jan 20172099127729135 k 2724,8   28 k      52 k
dez 20162087158328135 k 2524,8   23 k      51 k
nov 2016207267528134 k 2624,7   24 k      50 k
out 20162066148127133 k 1924,7   31 k      49 k
set 20162052107726132 k 1624,6   23 k      49 k
ago 20162042126923132 k 2124,5   17 k      48 k
jul 2016203097626131 k 2324,5   27 k      48 k
jun 2016202188125131 k 1724,4   19 k      47 k
mai 20162013109628130 k 1624,3   21 k      47 k
abr 201620032011331130 k 2624,3   53 k      46 k
mar 20161983199731129 k 2724   28 k      46 k
fev 20161964197624128 k 2624   16 k      45 k
jan 20161945149029127 k 2024   35 k      45 k
dez 2015193187523127 k 2423,8   17 k      44 k
nov 20151923138521126 k 1723,8   26 k      43 k
out 20151910148826125 k 1423,7   17 k      43 k
set 20151896117626125 k 2023,7   24 k      43 k
ago 20151885118022124 k 2123,6   24 k      42 k
jul 20151874106824124 k 2323,5   19 k      42 k
jun 20151864198724123 k 2323,5   20 k      41 k
mai 20151845159223122 k 1923,5   20 k      40 k
abr 201518303112923122 k 3123,4   19 k      40 k
mar 20151799158125121 k 2423,4   28 k      40 k
fev 20151784188722120 k 2123,3   14 k      39 k
jan 20151766107224119 k 2023,3   19 k      39 k
dez 20141756107422119 k 2623,3   18 k      38 k
nov 20141746199720118 k 2623,3   16 k      38 k
out 2014172797424117 k 2423,3   20 k      37 k
set 20141718107022116 k 2623,3   12 k      37 k
ago 20141708107422116 k 2523,4   13 k      36 k
jul 20141698116926115 k 2823,4   16 k      36 k
jun 20141687198520114 k 2923,4   13 k      35 k
mai 20141668209529113 k 3123,5   27 k      35 k
abr 20141648128428112 k 2723,5   21 k      35 k
mar 201416362710827111 k 2923,4   18 k      34 k
fev 20141609139130110 k109 k3223,5234377%33%16 k369 Mb46,2 M2,8 M15 k6,0 k182 k34 k
jan 201415961610028110 k108 k3623,5233677%33%21 k365 Mb45,6 M2,8 M16 k6,0 k178 k33 k
dez 20131580117422108 k107 k2723,6233577%33%13 k359 Mb45,0 M2,8 M16 k6,1 k175 k33 k
nov 20131569147624108 k106 k3523,6233577%33%13 k356 Mb44,6 M2,8 M16 k6,2 k173 k32 k
out 20131555107826107 k105 k2023,7233677%33%13 k352 Mb44,1 M2,7 M16 k6,2 k171 k32 k
set 20131545137327106 k104 k2523,8233077%33%14 k348 Mb43,6 M2,7 M16 k6,0 k168 k32 k
ago 20131532117824105 k104 k3823,8232577%33%27 k344 Mb43,1 M2,7 M17 k6,0 k166 k31 k
jul 20131521126931104 k102 k3223,8232477%33%17 k339 Mb42,5 M2,6 M23 k5,7 k163 k31 k
jun 20131509116731103 k101 k2623,9231477%32%22 k334 Mb41,8 M2,6 M24 k5,5 k159 k30 k
mai 20131498118928102 k101 k2623,9232076%32%19 k329 Mb41,2 M2,6 M25 k5,3 k156 k29 k
abr 20131487189324101 k100 k2523,9230876%32%20 k324 Mb40,6 M2,5 M27 k4,9 k153 k29 k
mar 201314692012331101 k99 k4423,8230476%32%96 k320 Mb40,2 M2,5 M39 k4,6 k151 k29 k
fev 20131449451413299 k98 k7423,2231076%32%41 k360 Mb39,6 M2,5 M1,9 M3,9 k148 k28 k
jan 2013140418913097 k96 k7123,3231876%32%36 k354 Mb38,9 M2,4 M1,9 M2,8 k143 k28 k
dez 2012138615802695 k93 k6823,4233376%32%30 k347 Mb38,2 M2,4 M1,8 M2,3 k138 k27 k
nov 20121371281002893 k91 k5323,6234475%32%25 k340 Mb37,5 M2,3 M1,8 M2,0 k134 k26 k
out 2012134311832391 k90 k2723,8234775%32%29 k334 Mb36,9 M2,3 M1,8 M1,7 k130 k26 k
set 201213327692990 k89 k3223,7234175%32%35 k330 Mb36,4 M2,3 M1,8 M1,4 k127 k26 k
ago 2012132513722790 k88 k3323,5233575%32%34 k324 Mb35,8 M2,2 M1,8 M765124 k25 k
jul 201213126612789 k87 k3323,4233075%32%52 k319 Mb35,3 M2,2 M1,7 M587121 k25 k
jun 2012130614712987 k86 k5623,1232675%32%74 k314 Mb34,8 M2,2 M1,7 M444118 k24 k
mai 2012129215872486 k84 k3322,7233575%32%37 k308 Mb34,2 M2,1 M1,7 M396115 k24 k
abr 2012127732942485 k83 k3522,5233175%32%35 k303 Mb33,7 M2,1 M1,7 M223113 k23 k
mar 2012124526952984 k82 k3822,4232174%32%44 k297 Mb33,1 M2,1 M1,6 M119110 k23 k
fev 2012121914722583 k81 k3522,2231374%31%32 k291 Mb32,4 M2,1 M1,6 M829107 k23 k
jan 2012120515722982 k80 k5222,1230674%31%32 k286 Mb31,9 M2,0 M1,6 M712105 k22 k
dez 2011119014683180 k78 k7522,1230374%31%34 k279 Mb31,1 M2,0 M1,6 M492102 k22 k
nov 2011117612652378 k76 k3522,3231975%31%29 k272 Mb30,4 M1,9 M1,5 M39498 k21 k
out 2011116410682477 k75 k3022,3231575%31%38 k268 Mb29,9 M1,9 M1,5 M25696 k20 k
set 2011115411662076 k74 k3522230874%31%27 k263 Mb29,4 M1,9 M1,5 M17694 k20 k
ago 2011114315701975 k73 k3022230574%31%29 k258 Mb28,9 M1,8 M1,5 M2,7 k92 k20 k
jul 201111288532274 k72 k3221,9230374%31%27 k254 Mb28,4 M1,8 M1,5 M2,6 k90 k19 k
jun 2011112013722273 k71 k3721,8228274%30%27 k248 Mb27,7 M1,8 M1,4 M2,6 k87 k19 k
mai 2011110722791972 k70 k2321,8226474%30%23 k242 Mb27,1 M1,7 M1,4 M2,5 k84 k19 k
abr 2011108511601871 k69 k2821,6225074%30%22 k238 Mb26,6 M1,7 M1,4 M2,5 k82 k19 k
mar 2011107422852570 k68 k5121,6224774%30%31 k234 Mb26,2 M1,7 M1,4 M2,5 k80 k18 k
fev 2011105211692068 k67 k3821,6225174%30%22 k229 Mb25,6 M1,6 M1,4 M2,3 k78 k18 k
jan 2011104121742667 k66 k4221,6226074%30%31 k225 Mb25,3 M1,6 M1,3 M2,3 k76 k18 k
dez 201010209532066 k64 k4121,6226574%30%25 k221 Mb24,8 M1,6 M1,3 M2,2 k73 k17 k
nov 2010101117641965 k63 k3121,6228674%30%28 k217 Mb24,4 M1,6 M1,3 M2,2 k71 k17 k
out 201099414711864 k62 k2721,5229373%30%24 k214 Mb24,1 M1,5 M1,3 M2,3 k69 k17 k
set 20109808592063 k61 k3121,4230173%30%27 k211 Mb23,8 M1,5 M1,3 M2,5 k67 k16 k
ago 201097215761562 k60 k2921,3230773%30%26 k208 Mb23,5 M1,5 M1,2 M2,5 k66 k16 k
jul 201095721731661 k59 k2621,2231773%30%20 k205 Mb23,2 M1,5 M1,2 M2,6 k64 k16 k
jun 201093624872760 k58 k3521,1231773%30%30 k202 Mb22,8 M1,5 M1,2 M2,6 k63 k15 k
mai 201091211742459 k57 k3721231672%30%28 k197 Mb22,3 M1,4 M1,2 M2,5 k61 k15 k
abr 201090113832558 k56 k4621232072%30%31 k193 Mb21,9 M1,4 M1,2 M2,4 k59 k14 k
mar 201088826852157 k55 k3220,9232272%29%30 k187 Mb21,3 M1,3 M1,1 M2,2 k56 k14 k
fev 201086213662456 k54 k2920,8231172%29%26 k183 Mb20,8 M1,3 M1,1 M2,2 k53 k14 k
jan 201084918772255 k53 k3020,6231272%29%23 k179 Mb20,4 M1,3 M1,1 M2,2 k51 k13 k
dez 200983116752354 k52 k4320,5230472%29%23 k175 Mb19,9 M1,3 M1,1 M2,3 k50 k13 k
nov 200981515711953 k51 k3220,6230671%29%21 k170 Mb19,4 M1,2 M1,1 M2,2 k47 k13 k
out 200980014781652 k50 k1920,6230271%28%21 k166 Mb19,0 M1,2 M1,1 M2,4 k46 k12 k
set 200978622732051 k49 k2420,4230871%28%23 k164 Mb18,7 M1,2 M1,0 M2,4 k45 k12 k
ago 200976410651850 k48 k1520,2230870%28%21 k161 Mb18,4 M1,1 M1,0 M2,8 k43 k12 k
jul 200975411671950 k48 k2620230870%28%29 k159 Mb18,2 M1,1 M1,0 M2,9 k43 k12 k
jun 200974319861649 k47 k3619,7232168%28%24 k156 Mb17,8 M1,1 M983 k2,8 k42 k12 k
mai 2009724241001848 k46 k4519,7232768%28%23 k152 Mb17,4 M1,1 M961 k2,5 k41 k11 k
abr 200970020932147 k44 k4419,8235068%28%24 k148 Mb17,0 M1,0 M939 k2,5 k39 k11 k
mar 200968025731945 k43 k3219,8236268%28%33 k143 Mb16,5 M1,0 M914 k2,4 k38 k11 k
fev 200965515711444 k42 k3119,6237868%28%20 k140 Mb16,2 M990 k895 k2,3 k37 k10 k
jan 200964014761744 k41 k2419,5238668%28%23 k138 Mb15,9 M968 k882 k2,2 k36 k10 k
dez 200862613762243 k40 k4419,3237867%28%29 k135 Mb15,6 M948 k864 k1,9 k35 k10 k
nov 200861314671641 k39 k3819,2239367%29%21 k131 Mb15,2 M920 k849 k3,6 k33 k9,9 k
out 20085999661540 k38 k2719,3240367%29%21 k128 Mb14,8 M896 k832 k3,4 k32 k9,6 k
set 20085909671739 k37 k2019,1241367%29%17 k125 Mb14,6 M879 k814 k3,1 k32 k9,4 k
ago 200858112581639 k36 k2819241667%29%23 k123 Mb14,4 M866 k801 k3,0 k31 k9,3 k
jul 200856914671838 k35 k3318,8243068%29%33 k121 Mb14,1 M850 k783 k3,0 k30 k9,1 k
jun 200855512622337 k34 k5018,5243268%29%27 k118 Mb13,7 M825 k764 k2,7 k29 k8,9 k
mai 20085439591935 k33 k3218,5243868%29%26 k113 Mb13,2 M793 k744 k2,4 k28 k8,6 k
abr 200853412702034 k32 k2718,2244568%29%22 k110 Mb12,9 M770 k722 k2,2 k26 k8,4 k
mar 200852211742034 k31 k2618241968%29%23 k106 Mb12,4 M743 k702 k1,8 k25 k8,2 k
fev 200851112851933 k30 k3517,8240067%28%23 k103 Mb12,0 M719 k677 k1,3 k24 k8,0 k
jan 200849914852332 k29 k3917,6238667%28%22 k99 Mb11,6 M692 k650 k1,0 k23 k7,8 k
dez 200748521862831 k28 k3217,6237067%28%37 k94 Mb11,1 M661 k624 k50322 k7,5 k
nov 200746425892730 k27 k3816,9234167%27%77 k90 Mb10,6 M631 k587 k1,9 k20 k7,2 k
out 200743924831929 k26 k4014,9232266%27%31 k86 Mb10,1 M601 k544 k25 k19 k6,5 k
set 200741511702327 k25 k2914,5226966%26%27 k81 Mb9,5 M570 k514 k24 k17 k5,9 k
ago 200740419682526 k24 k3413,9216165%25%19 k75 Mb8,8 M526 k494 k22 k16 k5,6 k
jul 200738515771825 k23 k2513,7208864%24%18 k70 Mb8,2 M490 k474 k19 k15 k5,3 k
jun 200737017761625 k22 k3113,4200163%23%23 k66 Mb7,6 M455 k453 k18 k14 k5,0 k
mai 200735317801624 k21 k2812,9196562%23%24 k62 Mb7,2 M434 k435 k17 k13 k4,8 k
abr 200733619791723 k21 k2412,4191961%22%16 k59 Mb6,8 M411 k418 k16 k12 k4,4 k
mar 200731717641622 k20 k2212,1186460%22%21 k56 Mb6,4 M387 k402 k15 k12 k4,2 k
fev 200730015531121 k19 k1911,5180059%21%13 k52 Mb6,0 M366 k380 k14 k11 k4,0 k
jan 20072858541221 k19 k2311,2177458%20%18 k50 Mb5,7 M352 k365 k13 k10 k3,8 k
dez 200627713611720 k18 k3410,7174457%20%18 k48 Mb5,5 M336 k345 k13 k9,7 k3,6 k
nov 20062647571219 k17 k2510,3171856%20%15 k44 Mb5,1 M314 k319 k12 k8,9 k3,4 k
out 200625711631218 k16 k219,9169756%19%19 k42 Mb4,8 M299 k303 k11 k8,4 k3,2 k
set 200624612521118 k16 k209,2169355%19%21 k40 Mb4,6 M284 k282 k10 k8,0 k3,0 k
ago 200623418631017 k15 k238,3167555%18%13 k38 Mb4,4 M270 k262 k9,0 k7,5 k2,9 k
jul 20062166531016 k14 k247,9162054%18%12 k35 Mb4,1 M252 k246 k7,9 k6,9 k2,7 k
jun 20062105441216 k14 k177,5160554%18%9,3 k33 Mb3,8 M236 k218 k7,1 k6,6 k2,4 k
mai 200620521621015 k13 k167,1159153%17%9,2 k32 Mb3,7 M226 k204 k6,6 k6,3 k2,3 k
abr 200618422531015 k13 k286,7159052%17%8,1 k30 Mb3,5 M216 k182 k6,3 k6,0 k2,1 k
mar 20061628501014 k12 k426,5162953%17%6,9 k29 Mb3,4 M209 k172 k6,1 k5,7 k2,0 k
fev 20061541341812 k11 k326,7168457%18%7,5 k28 Mb3,2 M200 k164 k5,8 k5,5 k1,8 k
jan 20061416301012 k10 k426,5169258%18%6,6 k26 Mb3,0 M187 k154 k5,5 k4,9 k1,7 k
dez 200513510351010 k9,0 k166,7168561%18%5,8 k23 Mb2,7 M167 k138 k4,7 k4,3 k1,5 k
nov 2005125533109,8 k8,5 k256,5162960%17%5,7 k21 Mb2,5 M156 k132 k4,4 k3,9 k1,4 k
out 20051201032119,0 k7,7 k306,4154659%16%6,1 k19 Mb2,1 M137 k119 k4,0 k3,4 k1,3 k
set 200511073088,1 k6,9 k196,4142557%15%6,7 k16 Mb1,8 M115 k100 k3,4 k2,8 k1,2 k
ago 200510372357,6 k6,4 k265,9133055%14%6,1 k14 Mb1,5 M101 k88 k3,0 k2,5 k1,1 k
jul 20059692666,7 k5,7 k275,7122654%13%5,2 k12 Mb1,3 M85 k74 k2,5 k2,1 k981
jun 200587103145,9 k4,9 k195,7114452%12%2,9 k9,5 Mb1,0 M70 k61 k2,0 k1,6 k833
mai 200577102985,3 k4,4 k245,8112152%11%4,5 k8,5 Mb907 k61 k57 k1,5 k1,5 k724
abr 20056772394,6 k3,8 k265,7112653%11%5,4 k7,2 Mb780 k51 k44 k1,2 k1,2 k626
mar 20056021673,8 k3,1 k135,5114456%11%2,3 k6,1 Mb655 k43 k36 k9341,1 k391
fev 20055821463,4 k2,8 k145,4111155%10%3,1 k5,4 Mb568 k36 k34 k702889348
jan 20055632163,0 k2,3 k135,1106550%10%2,9 k4,6 Mb479 k31 k30 k635693322
dez 20045351972,6 k2,0 k234,894139%9%3,5 k3,6 Mb377 k25 k23 k485595307
nov 20044861551,9 k1,2 k164,893737%10%2,4 k2,5 Mb277 k18 k15 k268461196
out 2004423911,4 k92944,793238%10%8501,8 Mb207 k14 k7,9 k109326142
set 2004394721,3 k82724,585737%9%6351,5 Mb174 k13 k6,4 k94252134
ago 2004351411,3 k77734,278835%8%4621,3 Mb154 k11 k6,2 k80193123
jul 20043415 1,1 k69214,175033%8%2851,2 Mb134 k10 k5,5 k42182112
jun 200433716 1,1 k6583475033%8%4081,1 Mb128 k9,7 k3,5 k37176104
mai 2004263911,0 k59323,973132%8%3151,0 Mb115 k8,7 k3,3 k3016288
abr 200423916195453133,972430%8%369930 kb106 k7,7 k3,0 k2413284
mar 200414614186346783,972730%8%1,2 k836 kb95 k7,0 k2,5 k2311576
fev 2004813162529743,568724%7%463559 kb66 k4,4 k1,3 k177858
jan 2004736150624383,472125%8%1,2 k481 kb56 k3,5 k984126753
dez 20034 2 266121 259221%6%53199 kb22 k1,3 k176 5531
nov 20034113 25311931,957921%6%203186 kb21 k1,2 k107 5229
out 20033   1749311,760925%5%47140 kb15 k72697 921
set 20033 1 14889 1,669630%6%14136 kb15 k65497 918
ago 2003312 14185 1,671630%6%32133 kb14 k63697 818
jul 20032   12674 1,664229%5% 107 kb10 k47178 516
jun 20032   12674 1,664229%5% 107 kb10 k47178 516
mai 20032   12674 1,664229%5% 107 kb10 k47178 516
abr 20032 1 1267421,664229%5%87107 kb10 k47178 516
mar 2003221 724421,554729%4%10943 kb5,4 k32374 54
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
The following table ranks this project in relation to projects in other languages with 1000+ articles
out 20184754433348 3674   37      278
jul 20184754473548 4275   30      278
abr 20184742423047 3678   36      278
jan 20184655493647 4578   36      278
out 20174546473647 3879   46      278
jul 20174548463647 6180   38      278
abr 20174445423647 4884   39      278
jan 20174356503446 4286   39      278
out 20164350473346 5587   34      278
jul 20164350473446 5188   38      278
abr 20164143373246 4089   28      278
jan 20164153463645 5496   35      278
out 20154148423545 6098   44      278
jul 20154150473545 44103   39      278
abr 20154136373645 41106   42      278
jan 20154155493646 54106   41      278
out 20144154433747 48107   41      278
jul 20144150433347 42106   43      278
abr 20144153453447 52106   40      278
jan 20144051453645413710948764238473936399746278
out 20134052443444425010946754146463936409648278
jul 20134050443244414411348744042453936379647278
abr 201340464235444250114477440534539363810148277
jan 201340474332413927112427342474336344212545277
out 201240504035413949110397139504235344314645277
jul 201240604532413943110387136344235344119043277
abr 201240374035413934115376834404235354122343277
jan 201240484533423936112366534424236344117444277
out 201140564736424045108365633394336334121645277
jul 201139574937413845108365732454136344011244277
abr 201139504540413849110385532474237334011246277
jan 201139434436403739102355329443935344011344277
out 20103944414241384098355128413835333911044277
jul 20103938424341384191325127483835333910044277
abr 20103945393540383587325227443735343810244277
jan 20103940393940394382325130423736353810744277
out 20093943394040384878325232403736353810144277
jul 2009394841383938457131553238373535389143277
abr 2009394039384138356627573241373435389643277
jan 2009394539414139476225543040373434389543276
out 2008394741404139425822562941383434377943274
jul 2008394140384036345620492535383433358042273
abr 2008394340373939445319482241373534358644273
jan 20083943393438373450185024413735343610644269
out 2007393839373838335718502538373534373344267
jul 2007393939383836505122502738373534363344262
abr 2007393939383635504925502640373534373243257
jan 2007394640413533485226512938373534373143254
out 2006394539403433495026482837373433373242251
jul 2006405139413333395926523040373434363440238
abr 2006393637373333346224493040373233353539233
jan 2006394642383534295317312540353130353037215
out 2005353637323332285020243037343130383035213
jul 2005353736383232234733253436363331393034202
abr 2005333438283333233631233927373333403337195
jan 2005304330293535313627193328353235363541191
out 2004284041484242423325312645444139475049189
jul 2004255244513938522929282551444036454852160
abr 2004252023373739373737373742413832424650143
jan 2004332026303538262828282822393433393578127
out 2003393541223333322020202035373734373953101
jul 200341363721282929151515155232323129324388
abr 200328272514242419131313132425262620212771
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
 WikipedistasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikipedistas (usuários registrados)
A = Wikipedistas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikipedistas que editaram pelo menos dez vezes desde que chegaram
C = Wikipedistas que contribuíram cinco vezes ou mais este mês
D = Wikipedistas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Artigos que contêm pelo menos uma ligação interna e 200 caracteres de texto legível, não contando códigos wiki e html,
      ligações ocultas, etc.; títulos também não contam (outras colunas são baseadas no método oficial de contagem)
G = Novos artigos por dia no mês passado
H = Número médio de revisões por artigo
I = Tamanho médio dos artigos em bytes
J = Porcentagem de artigos com pelo menos 0,5 kb de texto legível (veja F)
K = Porcentagem de artigos com pelo menos 2 kb de texto legível (veja F)

Base de dados
L = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
M = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
N = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
O = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
P = Total de ligações para outras wikipédias
Q = Total de imagens apresentadas
R = Total de ligações para outros sítios
S = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  2500  10000  5  10  100  1000  10000  1  3  5  10  25  100  250  1000  2500  10000  5  10  100  1000  1  3  5  10  25  100  250  1000  2500  5  10  100  1000  10000 
nov 2018237121896547322151 4411 483526141021   111 644436281283  4421 
out 2018243112866853342261 442  5130251711211  211 804840352496  442  
set 20182431098062512818511441  513324171021111111 6840342718106  442  
ago 201824611382635331155213311 562619171021111322 724535261363  442  
jul 2018239111785947261341 4422143251913103    111 7339312013431 541  
jun 2018275125946442252051 444  4724181262    11  764129191252  5511 
mai 2018310162121774732196  33   5126211493    111 915037251562  331  
abr 2018304136100795933165  3311 5830241771    111 835345311852  441  
mar 2018298123976851292192 551  673429211151   111 126694426191051 431  
fev 201826511584604426135  22   593223161021   111 824430231773  331  
jan 2018245110875742271561 4321 61292415112    111110644352318731 442  
dez 201722610883574027167  4411 4926201692    33117037282216104  542  
nov 2017267118825539241841 3311 623329181242   22  784837251392  221  
out 2017230112815538251741 3311 6031281882    111 794836251482  331  
set 201722510282613926166  441114929221692    331 653730251562114321 
ago 201725611988674123155  3311 5932271791    222 734034251653  4411 
jul 201723011078584226117  3311 54272217711   111 824634221382  431  
jun 2017253110926244251561 431116130221761    111 854938271494  43   
mai 2017301151107775023165  331115732221391    11  9345352616103  54   
abr 201726312598664328196  3321 483025181011   221177423528221052 441  
mar 2017244113785741252112  33111533426211441   111 815139302313721542  
fev 20172329376554127205  5421 57292416123    111 81483731211383 551  
jan 201724910477574029185  4421 5128211591    111 77383628211161 443  
dez 2016218107836146282051 3311 4526201361    221 72443627199521432  
nov 201622610175584228204  4411 50332315103    111 7440383216931 55   
out 201623511281563627185  331114726201371    22  664435231783  331  
set 201621110177594126157  3321 45302514821   11  674232221251  431  
ago 20161949169534223152  4411 532719149     111 633727201541  22   
jul 201624310376574326155  33111553120136     11  603827181261  521  
jun 201622110781523625154  3311 3922181371    11  553525171473  32   
mai 201627012596684928173  4411 512719149     111 7642382615731 431  
abr 2016325149113855731233  66311713226141151   322 9752412821941 4411 
mar 2016276119977251311951 3311 7332211072    222 118846630181061 431  
fev 201622710076564324172  3311 50262013101    211 7143382720741 32   
jan 2016258127906141291832 331115132261693    111 7843352919951 22   
out 2018243112866853342261 442  5130251711211  211 804840352496  442  
jul 2018239111785947261341 4422143251913103    111 7339312013431 541  
abr 2018304136100795933165  3311 5830241771    111 835345311852  441  
jan 2018245110875742271561 4321 61292415112    111110644352318731 442  
out 2017230112815538251741 3311 6031281882    111 794836251482  331  
jul 201723011078584226117  3311 54272217711   111 824634221382  431  
abr 201726312598664328196  3321 483025181011   221177423528221052 441  
jan 201724910477574029185  4421 5128211591    111 77383628211161 443  
out 201623511281563627185  331114726201371    22  664435231783  331  
jul 201624310376574326155  33111553120136     11  603827181261  521  
abr 2016325149113855731233  66311713226141151   322 9752412821941 4411 
jan 2016258127906141291832 331115132261693    111 7843352919951 22   
out 201524811988684526154  22   54282315721   111 8043363020631 21   
jul 20152399768543924126  3311 4018131071    111 6639292215751 32   
abr 2015320162129854523163  4411 60312215611   222212269473318931 431  
jan 20152339872493424134  542  54302114102    11  754233221674  22   
out 2014231100745032241362 542  5027161261    11  763832241432  11   
jul 201421897695239261531 221  46251565     1   654534241892  11   
abr 2014245122845941281552 222  5025191593        764335261854  11   
jan 2014254126100734928174  4311 66372821113        1005141322385  11   
out 201322611178543626142  221  5021161051        8744402517411 31   
jul 20132169369554131154  973  4828221511         7240322922112  431  
abr 201326612393664324161  7652 6832211594    1   8245362720105  6531 
jan 201331112891614330192  3331155 493021147     1   804432271762  191682 
out 201230512383533623152  3328135 5025211581    1   933629241882  221741 
jul 201224282614330271821 39341461472319139     1   653326221162  232081 
abr 2012298122947042241731 4038184 60302216101        944639261552  28205  
jan 201225510372513929223  3835154 452620148     111 974739311751  19165  
out 201124610268503524174  3632236 5422141062        9243372319821 261911  
jul 20112168453432822921 3329164 441512821        844637251321  17135  
abr 20112339760493118111  2927153 6032231461        803631231622  15126  
jan 20112759974573826153  3231204 72292317113        93433126224   17148  
out 201024595714932181421 3128123 603123141021       794134231963  21166  
jul 2010242957344261612   2726173 5629211372        864033211274  14106  
abr 201024210583563825144  3029174 673024131041       1035037251773  13123  
jan 201026611277543722111  2524164 61343022112        7543332417611 1182  
out 20092411057851301672  3126174 6327171293        823829181342  12112  
jul 20092148367443219142  3633174 5027221294        7735312013821 12104  
abr 200927212493704121102  3228185 64292319111        974637281875  13104  
jan 200923210576523017101  3030154 7636261491        954032231782  13115  
out 20082219266422615101  3428144 5527221581        11544282113621 1183  
jul 2008205896747331891  3325164171322017101    11  983930221662  1393  
abr 20081488770493420101  2421174 61322615102        774330221581  872  
jan 20081611088566462382  2424193 79453423133        744632231382  127   
out 200716810983684419122  2322154 67363025185        1064841302094  13112  
jul 2007129947758421851  151393 6128231461        643527231041  642  
abr 200713394795739177   141384 5226201561        633929171251  762  
jan 2007109695443281261  141252 37221893         5326231592   542  
out 2006120786346311261  121163 4627191252        64292017943  331  
jul 20069760533822107   9942 35201710711       51272318114   53   
abr 200610263533823101   4421 30121072         4116127421       
jan 200663403025201031  4331 25171473         3819151051   21   
out 20055737322818114   3321 301413115         3822181132   11   
jul 2005463226201464   984  16111062         25139431   21   
abr 2005513123201495   332  191710971        35171210531  1    
jan 2005282221161263   221  1510975         16121210632       
out 200419119551    111  63331         9531          
jul 2004106543         4211          411           
abr 2004261816621         53311         115311         
jan 200417964111        54311         741111        
out 20031                                        
jul 2003                                         
abr 200311111                                     

 

Distribuição de edições de artigos por wikipedistas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikipedistasEdições total
112,503100.0%2,076,761100.0%
34,65737.2%2,064,93899.4%
102,38719.1%2,051,85598.8%
329497.6%2,027,35297.6%
1004393.5%1,999,33296.3%
3162181.7%1,960,49394.4%
10001331.1%1,913,39392.1%
3162770.6%1,813,06187.3%
10000440.4%1,619,02078.0%
31623180.1%1,181,46156.9%
10000030.0%398,95719.2%

 

50 wikipedistas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdições 
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
 agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
MiguelferigUC1 0153,5932,0027,00178abr 25, 201127754,05129--
Breogan2008UC2 0133,5282,04213,284186jan 26, 2011286410,871100--
HombreDHojalataUC3 0111,8361,29942,552244out 11, 2008370197210--
EstevoaeiUC4 090,49963115,857181mai 30, 200645663,27129--
Alfonso MárquezUC5 087,2192364,14416abr 21, 200742404,3061--
XasUC6 074,58238713,4093mar 20, 200742728,72040--
Chairego apcUC7 061,41012228,52965fev 26, 201128333,262---
BanjoUC8 055,11044745,0831,068nov 25, 200643875842--
ElisardojmUC9 049,81570925,542387out 31, 200644123784--
BeninhoUC10 045,65044411,28620mar 11, 200646465,08380--
Xabier CidUC11 045,1678913,84020mai 22, 200645741,6665--
Servando2UC12+142,0953494,75638dez 10, 200547374,44314--
ImxavitoohUC13-141,937304,271-mai 06, 200934943,7931--
AdorianUC14 039,772417,29615set 06, 200837362,151---
Norrin strangeUC15 039,31195519,683314mai 13, 200645831,29428--
InternetArchiveBotUC16+138,1262,21529,629982ago 21, 2018100----
LameiroUC18 034,838117,0341fev 24, 200742961,417---
AtobarUC19 031,42712810,39352fev 07, 200935823,0941--
AMPERIOUC20+229,20381411,056538nov 01, 200933151,00531--
KriskoUC21-128,940752,3661mar 25, 200646325,4362--
JglamelaUC23 023,6872561,67021set 04, 201319121,36229--
XoioUC25 020,0571341,7554out 11, 201029713,40714--
PiquitoUC28+115,56411310,199233mai 18, 201031171,65237--
HacheDous=0UC29-115,536182,072-dez 05, 20141455781---
Albert galizaUC30 015,39217,6351jan 13, 20064703437---
FendetestasUC32 014,7634522635mai 27, 201320121,69118--
FleaRHCPUC35+112,273182,8359dez 23, 200836281,161---
SobreiraUC41 011,4872365,407106jan 04, 200550773762--
MoedagalegaUC42 011,18260911612jan 28, 2016103646416--
Xosé AntonioUC46 09,279303,54611jul 26, 201126832,0671--
Ramiro TorresUC47 09,234456-jan 21, 20112869325---
JonnyJonnyUC49 08,400252,4253nov 15, 201029368383--
CastelaoUC50+18,2303291,26719jan 24, 20122501998--
AgremonUC52 08,0001953,07955ago 02, 200355981,2039--
MAGHOIUC57 06,6181408609dez 09, 200932771584--
AosbotUC58+526,3604,833--out 13, 201847----
RubenWGAUC59-16,256252,70413nov 24, 20167353971--
XosemaUC60-15,9127254-mar 22, 200935391,322---
JudcostaUC67-14,308103,6632mar 02, 20122463486---
VitoriaogandoUC73+83,6911,032397abr 21, 201758716---
LlesUC75 03,49239667933jan 19, 201831423126--
Mgl.brancoUC77-33,169292158jul 27, 200837775084--
Maria zaosUC78+13,08633677124nov 08, 2014148236---
DodroUC82 02,695492604abr 17, 20141687731--
NicoleUC88-12,3561145-abr 13, 20122421108---
Ogalego.galUC90 02,2615669-jun 01, 201512773026--
Jorges65UC98-11,7922184-fev 14, 2014174964---
CristianCbUC105+61,66115919123abr 12, 2017596153--
One2UC118+91,43531911219fev 06, 20064679594--
AndalcantUC127-11,154274-dez 13, 201414472---

 

20 wikipedistas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
  Primeira ediçãoúltima edição
 posiçãototaldatadias
atrás
datadias
atrás
PrevertUC1736,973out 01, 20045172mai 18, 2017560
XoacasUC2228,815out 06, 20083706mai 30, 2018183
Anton45UC2420,089ago 11, 20112667set 27, 201863
NachonionUC2618,994mar 01, 20122464set 04, 201886
AngeldomcerUC2718,955fev 20, 20093569ago 27, 201894
ToliñoUC3115,163mai 09, 20074222dez 22, 2016707
Hugo22UC3313,433ago 15, 20064489fev 17, 20132111
RocasteloUC3412,599dez 11, 20045101set 17, 20074091
VivaelceltaUC3612,265nov 01, 20083680out 13, 201847
LmbugaUC3712,205ago 09, 20054860jun 02, 2018180
Xoán Carlos FragaUC3811,887jun 13, 20054917ago 15, 2018106
XoséUC3911,613jan 06, 20055075mar 19, 20083907
PepedoCoutoUC4011,511jan 13, 20083973ago 10, 20141572
Isili0nUC4310,417set 06, 20151180jan 07, 2018326
CalqUC4410,102abr 28, 20112772jul 02, 2018150
GallaecioUC459,441ago 06, 20074133abr 01, 2018242
JaviP96UC488,624out 03, 20122248fev 28, 20141735
LansbricaeUC518,036nov 17, 20064395out 22, 20083690
Martinho12UC537,629jun 15, 20083819jul 10, 2018142
UnhanovaUC546,880abr 07, 2016966jan 18, 2018315

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 172.995 edições foram feitas por usuários anônimos, de um total de 3986.223 edições ( 4e %)
  


50 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições 
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
 datadias
atrás
datadias
atrás
BanjoBot 2.0UC1314,109fev 11, 20151387nov 30, 2018---
TXiKiBoTUC2116,365jun 03, 20064562jan 09, 20132150--
BotDHojalataUC398,530ago 14, 20112664jun 13, 2018169--
EmausBotUC495,558jun 10, 20103094nov 29, 2018---
Luckas-botUC590,830jul 24, 20083780jun 23, 20122350--
SieBotUC674,237mai 21, 20074210jan 25, 20112865--
XqbotUC768,432jul 29, 20093410set 12, 201878--
AddbotUC861,788mar 06, 20132094ago 27, 20131920--
BanjoBotUC958,399set 22, 20074086mar 23, 20093538--
XoseBotUC1050,770abr 24, 20054967mar 21, 20083905--
VolkovBotUC1148,818jan 12, 20074339mar 04, 20132096--
MerlIwBotUC1242,368abr 05, 20112795ago 09, 20131938--
PrebotUC1341,209abr 30, 20054961fev 28, 2017639--
Thijs!botUC1438,949jul 28, 20064507out 15, 20122236--
EscarbotUC1536,422jun 17, 20064548mar 21, 2018253--
ZéroBotUC1629,304dez 30, 20102891mar 07, 20132093--
CorribotUC1727,953out 08, 20102974out 19, 201841--
JAnDbotUC1827,533ago 17, 20064487jul 03, 20131975--
WikitanvirBotUC1926,496out 01, 20102981mai 15, 20122389--
ArthurBotUC2026,162dez 28, 20083623nov 05, 20122215--
YurikBotUC2120,907jul 31, 20054869set 04, 20064469--
MelancholieBotUC2220,891mar 30, 20083896nov 28, 20093288--
LovelessUC2315,555jun 05, 20074195out 04, 20122247--
ChuispastonBotUC2415,222out 03, 20102979abr 28, 20122406--
CommonsDelinkerUC2513,053set 27, 20064446nov 30, 2018---
ToloBotUC2612,009set 17, 20112630ago 03, 20131944--
AlleborgoBotUC2710,995jun 15, 20074185ago 08, 20103035--
TobeBotUC2810,342set 13, 20093364set 14, 20102998--
PtbotgourouUC299,954set 04, 20083738mar 06, 20132094--
Rembiapo pohyiete (bot)~glwikiUC309,824jul 20, 20054880dez 29, 20064353--
Rei-botUC318,980nov 12, 20064400nov 07, 20093309--
Idioma-botUC328,966ago 03, 20074136mar 07, 20132093--
KLBot2UC338,783jun 06, 20122367jul 03, 20131975--
KamikazeBotUC348,033jul 03, 20103071jan 27, 20132132--
DragonBotUC357,919out 05, 20074073fev 04, 20132124--
RedBotUC367,601jan 22, 20122503ago 24, 20122288--
MalafayaBotUC377,262set 24, 20074084fev 16, 20132112--
LucienBOTUC386,965jan 30, 20093590ago 23, 20112655--
ShydeUC396,538out 25, 20141496jun 01, 2018181--
TjBotUC406,453nov 21, 20093295mar 06, 20132094--
FlaBotUC416,243mai 23, 20064573set 17, 20102995--
RubinbotUC426,239mai 18, 20093482mar 05, 20132095--
Makecat-botUC436,021jun 16, 20122357mar 06, 20132094--
SynthebotUC445,629mar 29, 20074263jan 31, 20132128--
JackieBotUC455,104jul 29, 20103045fev 04, 2017663--
AmirobotUC464,943jul 24, 20083780nov 25, 20112561--
BotMultichillUC474,462jun 09, 20074191abr 17, 20112783--
CarsracBotUC484,278mai 22, 20083843mar 01, 20132099--
ChlewbotUC494,209dez 09, 20054738dez 31, 20064351--
MastiBotUC504,159dez 06, 20093280mar 04, 20132096--

 

Artigos que contêm pelo menos uma ligação interna e .. caracteres de texto legível, não contando códigos wiki e html,
ligações ocultas, etc.; títulos também não contam  (excluindo páginas de redirecionamento)

DataArtigos
 < 32 ch< 64 ch< 128 ch< 256 ch< 512 ch< 1 k ch< 2 k ch< 4 k ch< 8 k ch< 16 k ch< 32 k ch< 64 k ch
mai 20102.9%6.2%6.8%12.1%32.2%51.8%72.1%86.9%94.8%98.3%99.5%99.9%
abr 20102.8%5.9%6.5%12.1%32.2%51.8%72.1%86.9%94.8%98.3%99.6%100.0%
mar 20102.6%5.6%6.2%12.0%31.8%51.7%72.2%86.9%94.9%98.3%99.6%100.0%
fev 20102.4%5.2%5.9%11.8%31.6%51.6%72.2%86.9%94.8%98.2%99.4%99.8%
jan 20102.3%5.0%5.7%11.8%31.7%51.7%72.3%87.0%94.9%98.3%99.6%100.0%
dez 20092.1%4.5%5.2%11.4%31.5%51.6%72.3%86.9%94.7%98.2%99.4%99.8%
nov 20092.0%4.3%5.0%11.4%31.5%51.7%72.5%87.0%94.8%98.3%99.5%99.9%
out 20091.9%4.0%4.7%11.1%31.5%51.7%72.5%86.8%94.6%98.1%99.3%99.7%
set 20091.6%3.6%4.3%10.9%31.7%51.7%72.5%86.8%94.7%98.3%99.6%100.0%
ago 20091.4%3.2%3.9%10.7%31.9%51.8%72.4%86.6%94.5%98.1%99.4%99.8%
jul 20091.3%3.0%3.7%10.7%32.3%52.1%72.6%86.8%94.6%98.2%99.5%99.9%
jun 20090.9%2.5%3.3%10.6%33.1%52.1%72.5%86.8%94.7%98.3%99.6%100.0%
mai 20090.7%1.9%2.7%10.3%33.2%52.1%72.4%86.7%94.6%98.2%99.5%99.9%
abr 20090.5%1.3%2.1%10.0%32.6%51.8%72.1%86.6%94.6%98.3%99.6%100.0%
mar 20090.3%0.8%1.6%9.7%32.3%51.6%71.8%86.4%94.5%98.2%99.5%99.9%
fev 20090.1%0.4%1.2%9.6%32.1%51.3%71.5%86.2%94.4%98.2%99.5%99.9%
jan 20090.1%0.4%1.3%9.8%32.3%51.3%71.5%86.2%94.5%98.3%99.6%100.0%
dez 20080.1%0.4%1.3%9.9%32.3%51.3%71.4%86.1%94.3%98.1%99.4%99.8%
nov 20080.1%0.4%1.3%10.1%32.3%51.4%71.3%86.0%94.3%98.2%99.5%100.0%
out 20080.1%0.4%1.4%10.4%32.4%51.3%71.3%86.0%94.4%98.3%99.6%100.0%
set 20080.1%0.5%1.6%10.7%32.4%51.1%71.1%85.8%94.2%98.1%99.4%99.9%
ago 20080.1%0.5%1.6%10.9%32.3%51.1%71.1%85.8%94.2%98.1%99.4%99.9%
jul 20080.1%0.5%1.6%11.3%32.0%50.9%71.0%85.7%94.2%98.2%99.6%100.0%
jun 20080.1%0.5%1.7%11.5%31.9%50.9%71.0%85.7%94.1%98.1%99.4%99.9%
mai 20080.1%0.5%1.7%10.6%31.1%50.5%70.8%85.5%93.9%97.9%99.3%99.8%
abr 20080.1%0.6%1.9%10.7%31.2%50.6%71.0%85.6%94.0%98.1%99.5%100.0%
mar 20080.1%0.6%1.8%10.8%31.6%51.0%71.3%85.9%94.2%98.2%99.6%100.0%
fev 20080.1%0.7%2.0%11.1%32.2%51.5%71.6%85.9%94.2%98.2%99.6%100.0%
jan 20080.1%0.7%2.0%10.9%32.2%51.7%71.8%85.9%94.2%98.2%99.5%99.9%
dez 20070.1%0.7%2.1%10.9%32.4%52.1%72.1%85.9%94.1%98.1%99.4%99.8%
nov 20070.0%0.8%2.2%11.1%32.8%52.5%72.5%86.2%94.3%98.2%99.5%99.9%
out 20070.0%1.1%2.9%11.8%33.4%52.9%72.8%86.3%94.3%98.1%99.4%99.8%
set 20070.0%1.1%3.3%12.3%34.1%53.6%73.5%86.6%94.4%98.1%99.4%99.8%
ago 20070.0%1.2%3.7%12.8%35.2%55.0%74.8%87.5%94.9%98.3%99.5%99.9%
jul 20070.0%1.2%4.0%13.2%36.3%56.2%75.8%88.0%95.2%98.5%99.6%99.9%
jun 20070.0%1.3%4.2%13.6%37.3%57.3%76.8%88.7%95.7%98.6%99.6%99.9%
mai 20070.1%1.6%4.6%14.2%38.8%58.9%77.2%88.9%95.8%98.6%99.6%99.9%
abr 20070.1%1.9%5.0%14.8%40.0%59.9%77.9%89.2%95.9%98.6%99.6%99.9%
mar 20070.1%2.1%5.3%15.3%41.1%61.0%78.7%89.6%96.2%98.8%99.8%100.0%
fev 20070.1%2.2%5.6%15.8%42.1%61.9%79.3%89.9%96.2%98.7%99.6%99.9%
jan 20070.1%2.3%6.1%16.3%42.9%62.7%79.8%90.1%96.2%98.7%99.6%99.9%
dez 20060.2%2.7%6.8%16.9%43.7%63.3%80.3%90.5%96.5%98.9%99.8%100.0%
nov 20060.2%2.9%7.2%17.3%44.4%63.9%80.7%90.7%96.4%98.8%99.7%100.0%
out 20060.2%3.0%7.5%17.5%44.8%64.2%81.0%90.9%96.6%98.9%99.8%100.0%
set 20060.2%1.5%6.3%16.6%44.7%64.2%81.1%90.9%96.5%98.8%99.7%100.0%
ago 20060.8%1.4%6.5%16.7%45.1%64.5%81.5%91.1%96.6%98.9%99.8%100.0%
jul 20060.8%1.5%6.8%16.9%45.8%65.2%82.0%91.4%96.8%99.0%99.9%100.0%
jun 20060.8%1.5%6.7%16.7%45.9%65.4%82.2%91.5%96.7%98.9%99.8%100.0%
mai 20060.8%1.6%7.0%17.0%46.5%65.9%82.6%91.7%96.7%98.9%99.8%100.0%
abr 20060.2%1.0%6.5%16.7%47.0%66.4%83.0%91.9%96.9%99.1%100.0%100.0%
mar 20060.2%1.0%4.3%14.6%45.8%65.5%82.4%91.4%96.5%98.8%99.8%100.0%
fev 20060.2%1.1%4.2%14.7%43.7%64.2%81.8%91.1%96.5%98.8%99.8%100.0%
jan 20060.2%1.2%4.6%15.8%41.9%63.5%81.7%91.0%96.4%98.8%99.8%100.0%
dez 20050.3%1.8%5.9%18.4%39.5%62.5%81.7%91.1%96.5%98.7%99.7%99.9%
nov 20050.3%1.9%6.4%19.2%40.0%63.2%82.5%91.6%96.7%98.7%99.7%99.9%
out 20050.4%2.1%6.8%20.3%41.9%64.7%83.7%92.1%96.9%98.8%99.8%99.9%
set 20050.5%2.5%6.8%20.5%43.0%66.1%84.8%92.8%97.5%99.3%100.0%100.0%
ago 20050.5%2.7%7.5%22.2%45.2%67.9%85.8%93.2%97.6%99.2%99.8%99.9%
jul 20050.5%3.0%7.8%22.6%46.6%69.6%87.3%94.1%98.1%99.4%99.9%100.0%
jun 20050.6%2.0%7.3%23.6%48.2%70.8%88.5%94.9%98.5%99.6%100.0%100.0%
mai 20050.8%2.4%8.0%24.9%48.3%71.1%89.1%95.2%98.7%99.7%100.0%100.0%
abr 20050.5%2.2%8.3%25.3%47.3%69.7%89.3%95.3%98.4%99.5%99.9%99.9%
mar 20050.7%2.9%9.5%24.0%44.7%67.9%89.6%95.3%98.5%99.6%100.0%100.0%
fev 20050.8%3.4%10.5%25.8%45.9%68.4%90.0%95.4%98.3%99.4%99.9%99.9%
jan 20051.2%4.3%12.8%28.8%50.2%72.0%90.3%95.6%98.4%99.5%100.0%100.0%
dez 20041.4%4.9%14.6%41.4%61.5%78.5%90.8%95.9%98.5%99.4%99.9%99.9%
nov 20042.1%7.6%20.2%44.8%63.7%79.0%90.2%95.7%98.5%99.7%100.0%100.0%
out 20042.2%8.5%23.7%43.5%63.1%79.6%90.3%96.1%98.7%99.7%100.0%100.0%
set 20042.1%9.0%25.2%45.6%64.4%80.9%91.3%96.7%98.7%99.5%99.9%100.0%
ago 20042.1%9.2%26.2%47.3%65.9%81.5%91.9%97.2%99.1%99.7%100.0%100.0%
jul 20042.2%9.9%27.1%49.1%67.9%82.8%92.2%97.2%99.2%99.7%100.0%100.0%
jun 20042.3%9.9%27.6%49.4%68.2%83.1%92.2%97.1%99.1%99.6%99.9%99.9%
mai 20042.3%10.3%28.9%50.7%69.4%83.6%92.5%97.4%99.2%99.7%100.0%100.0%
abr 20042.1%10.5%29.7%52.1%71.0%84.9%92.5%97.3%99.2%99.7%100.0%100.0%
mar 20042.1%11.7%31.5%52.6%70.8%84.6%92.4%97.4%99.1%99.7%100.0%100.0%
fev 20042.4%13.7%36.2%59.6%77.3%88.3%93.2%97.5%98.9%99.7%100.0%100.0%
jan 20045.8%17.4%35.0%58.3%75.9%87.9%92.4%96.9%98.6%99.4%100.0%100.0%
dez 20032.7%10.9%32.0%56.2%76.9%90.2%94.1%97.6%99.2%100.0%100.0%100.0%
nov 20032.5%9.1%30.5%55.2%77.0%90.6%94.3%98.0%99.2%100.0%100.0%100.0%
out 20031.8%7.1%25.3%47.7%73.0%90.6%94.7%98.2%98.8%100.0%100.0%100.0%
set 20031.4%7.0%16.0%40.3%68.1%88.9%93.8%98.0%98.7%100.0%100.0%100.0%
ago 20031.5%6.6%14.7%39.0%67.7%89.0%93.4%97.8%98.5%100.0%100.0%100.0%
jul 20030.9%4.4%12.4%36.3%66.4%89.4%94.7%98.2%99.1%100.0%100.0%100.0%
jun 20030.9%4.4%12.4%36.3%66.4%89.4%94.7%98.2%99.1%100.0%100.0%100.0%
mai 20030.9%4.4%12.4%36.3%66.4%89.4%94.7%98.2%99.1%100.0%100.0%100.0%
abr 20030.9%4.4%12.4%36.3%66.4%89.4%94.7%98.2%99.1%100.0%100.0%100.0%
mar 20030.0%0.0%9.0%38.9%67.3%92.7%95.7%100.0%100.0%100.0%100.0%100.0%

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.

See also Category Overview Complete (1.9 Mb!), Concise (108 kb)
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110DjvuGifJpgMidOggOgvPdfPngSvgTifWebm
nov 2018219 k4,4 k4,8 k36 k71319 k12060 k2,6 k1     29533 k270281231,6 k620620
out 2018218 k4,4 k4,8 k36 k71119 k12060 k2,5 k1     29533 k270281231,6 k593620
set 2018216 k4,3 k4,7 k35 k71019 k11959 k2,5 k1     29533 k270281211,5 k572620
ago 2018214 k4,3 k4,7 k35 k71018 k11958 k2,5 k1     29533 k269281211,5 k572620
jul 2018213 k4,3 k4,7 k35 k70618 k11958 k2,5 k1     29533 k269281201,5 k572620
jun 2018212 k4,3 k4,7 k35 k70218 k11957 k2,5 k1     29433 k269281201,5 k572620
mai 2018210 k4,3 k4,6 k35 k70218 k11957 k2,5 k1     29433 k269281201,5 k572620
abr 2018209 k4,3 k4,6 k35 k70218 k11957 k2,4 k1     29433 k269281201,5 k571620
mar 2018208 k4,2 k4,5 k35 k70218 k11956 k2,4 k1     29433 k269281201,5 k571620
fev 2018206 k4,2 k4,5 k35 k70218 k11956 k2,3 k1     29433 k269281201,5 k571620
jan 2018204 k4,1 k4,5 k35 k70018 k11955 k2,3 k1     29433 k269281201,5 k571620
dez 2017203 k4,1 k4,4 k35 k70018 k11954 k2,3 k1     29432 k269281191,5 k571619
nov 2017200 k4,1 k4,4 k35 k69018 k11954 k2,3 k1     29432 k269271191,5 k571618
out 2017199 k4,1 k4,3 k35 k69018 k11954 k2,3 k1     29432 k269271191,5 k571618
set 2017197 k4,0 k4,3 k35 k68718 k7453 k2,2 k1     29432 k269271191,5 k571618
ago 2017196 k4,0 k4,3 k35 k68718 k7453 k2,2 k1     29432 k269271141,5 k571518
jul 2017195 k4,0 k4,3 k35 k68718 k7453 k2,2 k1     29432 k269271141,5 k571518
jun 2017194 k4,0 k4,3 k35 k68318 k7452 k2,1 k1     29432 k269271141,4 k571518
mai 2017193 k4,0 k4,2 k35 k68317 k7352 k1,9 k1     29432 k268271141,4 k571518
abr 2017192 k4,0 k4,2 k34 k68317 k7352 k1,9 k1     29132 k268271101,4 k570418
mar 2017190 k3,9 k4,2 k32 k68217 k7351 k1,9 k1     29130 k268271031,4 k56945
fev 2017188 k3,9 k4,1 k31 k68017 k7249 k1,8 k1     29029 k26822941,4 k56534
jan 2017187 k3,9 k4,1 k30 k68016 k7248 k1,8 k1     29028 k26816771,4 k56531
dez 2016185 k3,9 k4,1 k29 k68016 k7248 k1,8 k1     29027 k26816761,4 k56431
nov 2016184 k3,8 k4,0 k27 k67815 k7047 k1,7 k1     29025 k26716761,4 k51031
out 2016182 k3,8 k4,0 k27 k67315 k7047 k1,5 k1     29025 k26616761,4 k51031
set 2016181 k3,8 k4,0 k27 k67315 k7046 k1,5 k1     29025 k26616761,4 k51031
ago 2016180 k3,8 k3,9 k27 k67115 k7046 k1,4 k1     29025 k26616761,4 k51031
jul 2016179 k3,8 k3,9 k27 k66915 k7046 k1,4 k1     29025 k26616761,4 k51031
jun 2016178 k3,8 k3,9 k27 k66815 k6945 k1,4 k1     28925 k26616761,4 k51031
mai 2016177 k3,8 k3,8 k27 k66515 k6945 k1,4 k1     28925 k26616761,4 k51031
abr 2016176 k3,8 k3,8 k27 k66215 k6945 k1,3 k1     28925 k26616761,4 k51031
mar 2016174 k3,7 k3,8 k27 k65014 k6944 k1,2 k1     28925 k26616761,4 k51031
fev 2016173 k3,7 k3,7 k27 k64014 k6744 k9471     28924 k26616761,4 k51021
jan 2016172 k3,6 k3,6 k27 k63714 k6743 k7741     28924 k26616761,4 k51021
dez 2015171 k3,6 k3,6 k27 k63114 k6743 k7671     28924 k26616761,4 k51021
nov 2015169 k3,6 k3,6 k27 k63014 k6742 k7601     28824 k26616651,4 k50721
out 2015168 k3,6 k3,5 k26 k62714 k6642 k7601     28824 k26616651,4 k50721
set 2015167 k3,5 k3,5 k26 k62514 k6642 k7601     28824 k26616651,4 k50721
ago 2015166 k3,5 k3,4 k26 k62514 k6541 k7601     28824 k26616651,4 k50721
jul 2015165 k3,5 k3,4 k26 k62413 k6541 k7601     28824 k26616651,4 k50611
jun 2015164 k3,5 k3,4 k26 k62213 k6539 k7601     28824 k26615651,4 k50611
mai 2015163 k3,5 k3,3 k26 k61913 k6339 k7601     28824 k26615651,4 k50611
abr 2015162 k3,5 k3,3 k26 k61613 k6238 k7601     28824 k26615651,3 k5061 
mar 2015160 k3,4 k3,3 k26 k60013 k6138 k7601     28824 k26615631,3 k5051 
fev 2015159 k3,4 k3,3 k26 k58913 k5837 k7601     28823 k26615631,3 k5051 
jan 2015158 k3,4 k3,2 k25 k58913 k5736 k7581     28823 k26615631,3 k5051 
dez 2014157 k3,4 k3,2 k25 k58912 k5536 k7581     28823 k26615631,3 k5041 
nov 2014156 k3,3 k3,2 k25 k58912 k5536 k7581     28823 k26615621,3 k5041 
out 2014154 k3,3 k3,1 k25 k58912 k5535 k7461     28823 k26615431,3 k5041 
set 2014153 k3,3 k3,1 k25 k58812 k5535 k7461     28823 k26615381,3 k5041 
ago 2014152 k3,3 k3,1 k25 k58812 k5534 k7461     28823 k26615371,3 k4991 
jul 2014151 k3,2 k3,1 k25 k58812 k5534 k7461     28822 k26615371,3 k4951 
jun 2014149 k3,2 k3,1 k24 k58712 k5533 k7461     28722 k26615351,3 k4951 
mai 2014148 k3,2 k3,1 k24 k58712 k5533 k7461     28622 k26615351,3 k4951 
abr 2014147 k3,2 k3,0 k24 k58612 k5531 k7461     28622 k26615351,3 k4911 
mar 2014146 k3,2 k3,0 k24 k58612 k5531 k7461     28622 k26615351,3 k4901 
fev 2014144 k3,1 k3,0 k24 k58612 k5530 k7181    1463628622 k26615351,3 k4891 
jan 2014143 k3,1 k2,9 k23 k58611 k5530 k6961    1698728421 k26615351,3 k4871 
dez 2013141 k3,1 k2,9 k23 k58611 k5529 k6891    1220228421 k26615351,3 k4841 
nov 2013140 k3,1 k2,9 k23 k58611 k5529 k6601    1173428221 k26615241,3 k4831 
out 2013139 k3,1 k2,9 k23 k58611 k5528 k5891    1237828221 k26615191,3 k4831 
set 2013138 k3,0 k2,8 k23 k58610 k5528 k5371    1266028221 k26615161,3 k4831 
ago 2013137 k3,0 k2,8 k23 k58610 k5527 k4891    1410528221 k26615161,3 k483  
jul 2013135 k3,0 k2,8 k23 k58610 k5527 k4521    1477318221 k26615161,3 k480  
jun 2013133 k3,0 k2,8 k22 k58610 k5526 k3611    1854218220 k26615111,3 k476  
mai 2013132 k3,0 k2,7 k22 k58510 k5425 k2981    1502018220 k26615111,3 k474  
abr 2013130 k2,9 k2,7 k22 k5829,9 k5324 k2561    1313618220 k26615111,3 k474  
mar 2013129 k2,9 k2,7 k22 k5819,8 k5324 k1351    1725818220 k26615111,3 k474  
fev 2013127 k2,9 k2,6 k22 k5739,5 k5323 k82     1852818220 k26615111,3 k468  
jan 2013125 k2,8 k2,6 k22 k5719,5 k5322 k82     1640718220 k26615111,3 k468  
dez 2012122 k2,8 k2,6 k22 k5719,4 k5322 k82     1492018120 k26615111,3 k468  
nov 2012119 k2,8 k2,6 k22 k5719,4 k5321 k82     1228918120 k26615111,3 k468  
out 2012117 k2,7 k2,6 k21 k5719,3 k5321 k82     1132618119 k26615111,3 k468  
set 2012116 k2,7 k2,5 k21 k5679,3 k5321 k57     1704118119 k26615111,3 k467  
ago 2012115 k2,7 k2,5 k21 k5659,2 k5319 k57     1760218119 k26615111,3 k467  
jul 2012113 k2,7 k2,5 k21 k5659,2 k5319 k57     1382718019 k26615111,3 k466  
jun 2012112 k2,6 k2,5 k20 k5659,2 k5319 k57     1890518019 k2659111,3 k463  
mai 2012110 k2,6 k2,5 k20 k5619,1 k5318 k57     1786118018 k2659111,3 k463  
abr 2012108 k2,6 k2,4 k20 k5619,1 k5318 k57     1553718018 k2659111,3 k450  
mar 2012107 k2,6 k2,4 k20 k5619,0 k5318 k57     1834618018 k2599111,2 k447  
fev 2012105 k2,5 k2,4 k20 k5618,9 k5317 k57     15700 8018 k2599111,2 k445  
jan 2012104 k2,5 k2,4 k20 k5618,9 k5316 k57     17952 8018 k2599111,2 k445  
dez 2011101 k2,4 k2,3 k19 k5608,8 k5316 k57     18627 7917 k2599111,2 k435  
nov 201199 k2,4 k2,3 k19 k5608,8 k5315 k57     14162 7917 k2599111,2 k430  
out 201197 k2,4 k2,3 k19 k5588,7 k5315 k57     15247 7917 k2599101,2 k429  
set 201196 k2,4 k2,3 k19 k5568,7 k5215 k57     9270 7917 k259991,2 k428  
ago 201194 k2,3 k2,3 k19 k5548,6 k5214 k57     11300 7817 k259771,2 k428  
jul 201193 k2,3 k2,2 k19 k5448,6 k5214 k57     11383 7817 k259471,2 k428  
jun 201192 k2,3 k2,2 k18 k5448,5 k5214 k57     10644 7817 k259171,2 k428  
mai 201190 k2,3 k2,2 k18 k5418,5 k5214 k57     8226 7816 k259 71,2 k427  
abr 201189 k2,2 k2,2 k18 k5398,4 k5214 k57     8884 7816 k259 61,2 k427  
mar 201188 k2,2 k2,1 k18 k5398,3 k5213 k57     14397 7816 k259 61,2 k427  
fev 201186 k2,2 k2,1 k18 k5388,3 k5013 k57     9352 7816 k259 51,2 k427  
jan 201185 k2,2 k2,1 k18 k5388,3 k5013 k57     13328 7516 k259 51,2 k427  
dez 201083 k2,1 k2,1 k17 k5308,2 k4912 k57     10732 7516 k259 51,2 k421  
nov 201081 k2,1 k2,0 k17 k5308,2 k4912 k57     14644 7216 k259 51,2 k275  
out 201080 k2,1 k2,0 k17 k5298,2 k4712 k57     11048 7215 k259 51,2 k265  
set 201079 k2,1 k2,0 k17 k5298,1 k4711 k57     10206 7215 k259 51,2 k265  
ago 201078 k2,0 k2,0 k17 k5268,1 k4611 k57     7597 7215 k259 51,2 k265  
jul 201077 k2,0 k1,9 k16 k5268,0 k4610 k57     7993 7215 k258 51,2 k265  
jun 201076 k2,0 k1,8 k16 k5257,7 k4610 k57     12738 7214 k258 51,2 k246  
mai 201074 k1,9 k1,8 k16 k5257,7 k4510 k57     13651 7214 k258 51,2 k243  
abr 201073 k1,9 k1,8 k15 k5257,6 k4510 k57     13813 7214 k258 51,2 k243  
mar 201071 k1,9 k1,7 k15 k5257,6 k459,8 k57     13404 7214 k258 51,2 k230  
fev 201070 k1,9 k1,7 k14 k5257,5 k249,4 k57     9230 7113 k256 51,1 k152  
jan 201068 k1,8 k1,7 k13 k5197,5 k248,6 k57     9499 7111 k238 51,1 k147  
dez 200967 k1,8 k1,6 k12 k5197,4 k248,2 k57     10354 7111 k238 51,1 k144  
nov 200966 k1,8 k1,6 k12 k5187,2 k247,9 k57     8591 6910 k238 51,1 k144  
out 200964 k1,7 k1,6 k11 k5117,0 k247,8 k57     7447 6910 k238 51,1 k144  
set 200963 k1,7 k1,6 k11 k5106,7 k247,7 k57     9434 689,9 k237 51,1 k138  
ago 200963 k1,7 k1,5 k11 k5106,4 k247,5 k57     5680 669,7 k 4 51,1 k137  
jul 200962 k1,7 k1,5 k10 k5106,2 k247,2 k57     9929 659,1 k 4 51,1 k129  
jun 200961 k1,7 k1,5 k9,2 k5105,9 k246,9 k57     10420 657,9 k 4 51,0 k106  
mai 200959 k1,6 k1,5 k9,1 k5075,5 k246,6 k57     8756 647,8 k 4 51,0 k106  
abr 200958 k1,6 k1,5 k9,0 k5075,4 k246,4 k57     9827 647,8 k 4 51,0 k106  
mar 200956 k1,5 k1,4 k8,9 k5075,2 k246,1 k57     9916 647,7 k 4 51,0 k105  
fev 200955 k1,5 k1,4 k8,0 k5064,9 k245,4 k57     8179 647,0 k 4 5899102  
jan 200954 k1,5 k1,4 k7,9 k5054,7 k245,2 k57     7224 646,9 k 4 5898101  
dez 200853 k1,5 k1,4 k7,8 k5054,6 k245,0 k57     9134 636,8 k 4 5898101  
nov 200851 k1,4 k1,3 k7,4 k5054,3 k244,7 k57     8604 486,5 k 4 582553  
out 200850 k1,4 k1,3 k7,1 k5054,1 k244,5 k57     6929 486,2 k 4 582248  
set 200849 k1,3 k1,3 k6,3 k5023,8 k244,3 k57     5987 255,5 k 3  76838  
ago 200848 k1,3 k1,2 k5,6 k4963,7 k244,1 k57     7253 144,8 k 3  72333  
jul 200847 k1,2 k1,2 k5,4 k4963,6 k243,9 k57     7746 144,7 k 3  71033  
jun 200846 k1,2 k1,2 k5,3 k4963,6 k233,8 k57     9293 144,5 k 3  70833  
mai 200844 k1,1 k1,2 k5,2 k4953,5 k233,6 k57     7659 134,4 k 3  70429  
abr 200843 k1,1 k1,1 k5,0 k4943,4 k233,5 k57     8233 134,2 k 3  68529  
mar 200842 k1,1 k1,1 k4,8 k4933,2 k233,4 k57     7599 134,1 k 3  68429  
fev 200841 k1,0 k1,1 k4,7 k4933,0 k233,3 k57     7716 134,0 k 3  66724  
jan 200840 k1,0 k1,1 k4,5 k4932,9 k233,2 k57     9566 123,8 k 3  66323  
dez 200738 k9961,0 k4,3 k4932,9 k212,9 k57     10148 123,6 k 3  66123  
nov 200737 k9599714,1 k4922,8 k212,7 k57     10238 123,5 k 3  59522  
out 200735 k9029093,8 k4922,7 k212,6 k46     10235 123,2 k 3  54621  
set 200733 k8368483,6 k4922,5 k212,4 k46     8412 123,1 k 3  54220  
ago 200732 k7977783,4 k4612,4 k202,3 k46     8222 122,8 k 3  53920  
jul 200731 k7607473,2 k4601,9 k202,2 k33     7694 112,6 k 3  53416  
jun 200730 k7396993,0 k4571,9 k202,0 k33     5826 112,4 k 3  53116  
mai 200728 k7146692,9 k4561,8 k202,0 k33     6835 112,4 k 3  52914  
abr 200727 k6796292,8 k4501,6 k181,9 k      6514 112,2 k 3  52811  
mar 200726 k6335992,6 k4371,6 k181,7 k      6058 102,1 k 3  5279  
fev 200725 k6055712,6 k4231,5 k181,6 k      4818 102,1 k 3  5245  
jan 200725 k5835592,6 k4231,5 k171,6 k      6702 102,0 k 3  5212  
dez 200624 k5675502,5 k4141,4 k171,5 k      6793 102,0 k 3  5162  
nov 200622 k5375432,5 k3861,4 k171,4 k      4788 101,9 k 3  5072  
out 200622 k5145272,4 k3841,3 k161,3 k      5521 101,9 k 3  5062  
set 200621 k4774962,3 k3841,2 k141,2 k      4881 81,8 k 3  4972  
ago 200620 k4554731,9 k3841,2 k131,1 k      5050 41,4 k 3  4962  
jul 200619 k4224541,9 k3791,1 k121,1 k      4562 41,4 k    4932  
jun 200618 k3914411,8 k365932121,1 k      4060 31,3 k    4872  
mai 200617 k3734111,6 k363900111,0 k      3625 31,2 k    4732  
abr 200617 k3213811,6 k35585111960      3046 31,2 k    4692  
mar 200616 k3053551,1 k33984411949      3480  686    462   
fev 200614 k2743201,1 k33683811916      3430  675    462   
jan 200613 k2612881,1 k33182711891      4239  665    459   
dez 200512 k2382541,1 k32776811886      3611  658    449   
nov 200511 k22122387131974011855      3367  424    447   
out 200510 k20319684531372911834      3665  400    445   
set 20059,3 k18913982931070211790      2712  390    439   
ago 20058,6 k17313874129663611768      3332  327    414   
jul 20057,7 k16113058129251411691      3182  167    414   
jun 20056,7 k14612654325149111658      2486  130    413   
mai 20056,1 k13112551024939311599      3141  110    400   
abr 20055,2 k11112247324931311555      4139  73    400   
mar 20054,2 k891194432492329485      2095  54    389   
fev 20053,7 k821134192491847365      2760  33    386   
jan 20053,3 k74100400249777140      2413  16    384   
dez 20042,9 k679419249566126      3003  7    12   
nov 20042,1 k56721617423347      1941  6    10   
out 20041,6 k4748111741123      467  2    9   
set 20041,4 k45468174112          2    6   
ago 20041,4 k39438173112          2    6   
jul 20041,3 k36433173112          2    1   
jun 20041,2 k34433173112          2    1   
mai 20041,1 k30423166102          2    1   
abr 20041,0 k273338282          2    1   
mar 2004938202538281          2    1   
fev 20046821622382 1          2    1   
jan 20045581122282 1          1    1   
dez 200329634 82 1                   
nov 2003281 4   1                   
out 2003194 3   1                   
set 2003165 3   1                   
ago 2003158 3   1                   
jul 2003142 3                       
jun 2003142 3                       
mai 2003142 3                       
abr 2003142 3                       
mar 200376 3                       

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

mar 2003: 1 1 Coitelo

abr 2003: 1 1 Trastornos da linguaxe

ago 2003: 1 1 XIX

set 2003: 1 1 Unidade

out 2003: 1 1 Enerxía

nov 2003: 1 4 T , 2 4 P , 3 4 C , 4 3 I , 5 2 Z , 6 2 Teoría de cordas , 7 2 Titanic (homónimos) , 8 2 R , 9 2 Ribadeo , 10 2 Pintura , 11 2 Linux , 12 2 G , 13 1 Costa

dez 2003: 1 2 Isaac Asimov , 2 1 Ciencias Naturais

jan 2004: 1 3 A , 2 2 Astrofísica , 3 2 Electricidade , 4 2 Sistema Internacional de Unidades , 5 2 Efecto Lenard , 6 2 Electricidade atmosférica , 7 2 Electrólise , 8 2 Magnetismo , 9 2 Cinemática , 10 2 Galileo , 11 2 Ecuacións de Maxwell , 12 2 Electrodinámica clásica , 13 2 Electrodinámica cuántica , 14 2 Péndulo , 15 2 Dinámica , 16 2 Metro , 17 2 Historia do Brasil , 18 2 América Latina , 19 2 Brasil , 20 2 Colombia , 21 2 Velocidade , 22 2 Hernán Naval Parapar , 23 2 Andrés Gaos Berea , 24 2 Cavitación , 25 2 Cronómetro

fev 2004: 1 2 Eiffel , 2 2 Cantares gallegos , 3 2 Follas novas , 4 2 Flandres , 5 2 Franco belga , 6 2 Peseta , 7 2 Escudo (homónimos) , 8 2 Interlingua (lingua artificial) , 9 2 México , 10 2 Electróns , 11 2 Cometa , 12 2 Aritmética , 13 2 Internet , 14 2 Mundo (homónimos) , 15 2 Partícula , 16 1 Altura (magnitude)

mar 2004: 1 4 Engativá , 2 4 Brasil , 3 4 Ar , 4 4 T , 5 4 C , 6 4 A , 7 3 Comuna de García Rovira , 8 3 Custodio Garcia Rovira , 9 3 Lista de países , 10 3 24 de abril , 11 3 Santander, Colombia , 12 3 San Gil, Colombia , 13 3 Soto, Colombia , 14 3 Guanentá , 15 3 España , 16 3 Economía , 17 3 R , 18 3 L , 19 3 Informática , 20 3 H , 21 3 Deporte , 22 3 Cine , 23 3 Astronomía , 24 2 Francés , 25 2 Astrofísica

abr 2004: 1 5 Deporte , 2 4 Mitoloxía , 3 2 Antigo Réxime , 4 2 Santiago de Compostela , 5 2 1122 , 6 2 1152 , 7 2 4 de marzo , 8 2 Pontecesures , 9 2 Software , 10 2 Servidor , 11 2 Wáter-polo , 12 2 Honduras , 13 2 Venezuela , 14 2 Hobbit , 15 2 1419 , 16 2 Aeroporto de Palonegro , 17 2 Comuna de García Rovira , 18 2 Lebrija, Colombia , 19 2 Peseta , 20 1 2004

mai 2004: 1 3 Lingua inglesa , 2 3 1268 , 3 2 2004 , 4 2 SIDA , 5 2 Violadores del Verso , 6 2 Densidade , 7 2 Estreito de Xibraltar , 8 2 Mar Mediterráneo , 9 2 Comunismo (homónimos) , 10 2 Radio , 11 2 1968 , 12 2 Filipe I de Savoia , 13 2 Jacques-Yves Cousteau , 14 2 Charles Robert Darwin , 15 2 Patente , 16 2 Vigo , 17 2 Marie Curie , 18 2 Mercurio (elemento) , 19 1 Contido libre

jun 2004: 1 4 Xeoloxía , 2 3 J. R. R. Tolkien , 3 3 Orlando Bloom , 4 3 Anatexia , 5 3 Neutrón , 6 3 Protón , 7 3 Música , 8 3 Bioloxía , 9 2 Suevos , 10 2 Besta do Gévaudan , 11 2 Hiénidos , 12 2 Grunge , 13 2 Elijah Wood , 14 2 Valquiria , 15 2 Termómetro , 16 2 Lei de Stefan-Boltzmann , 17 2 Meninxite , 18 2 Vibráfono , 19 2 Droga , 20 2 Marimba , 21 2 Sill , 22 2 Pegmatita , 23 2 Basalto , 24 2 Glockenspiel , 25 2 Membranófono

jul 2004: 1 2 Núcleo , 2 2 Ética , 3 2 Dario Fo , 4 2 MNL , 5 2 CIG , 6 2 Unidade imaxinaria , 7 2 Identidade de Euler , 8 2 Fósforo (elemento) , 9 2 Carlos Fuentes , 10 2 Pablo Neruda , 11 2 Lei potencial , 12 2 Circunferencia , 13 2 Vesta (deusa) , 14 2 Saturno (deus) , 15 2 Constante de Planck , 16 2 Principio de indeterminación de Heisenberg , 17 2 Saturno , 18 2 Radio , 19 2 Número e , 20 2 Bélxica , 21 1 Metafísica

ago 2004: 1 2 Troll , 2 2 Troll (Terra Media) , 3 2 Alfredo Di Stéfano , 4 2 Francisco Javier González Pérez , 5 2 Garrincha , 6 2 Franz Beckenbauer , 7 2 Lev Iashin , 8 2 Burato negro , 9 2 Océano , 10 2 Mitoloxía , 11 2 Medicina , 12 1 Cromosoma

set 2004: 1 2 Arnaut Daniel , 2 2 27 de febreiro , 3 2 Ferrol , 4 2 Thomas Alva Edison , 5 2 Mexillón , 6 2 Ada (informática) , 7 2 MIT , 8 2 Proxecto Apollo , 9 2 Sistema operativo , 10 2 UNIX , 11 2 GNIX , 12 2 AGNIX , 13 2 Proxecto Trasno , 14 2 Camelle, Camariñas , 15 2 Camariñas , 16 2 Xosé Manuel Beiras , 17 2 Oviedo , 18 2 Abeleira , 19 2 Software , 20 2 Hardware , 21 2 26 de febreiro , 22 2 Paleontoloxía , 23 2 Vigo , 24 2 X , 25 1 Xunta de Galicia

out 2004: 1 3 Humphrey Bogart , 2 3 Sempre Xonxa , 3 3 Televisión de Galicia , 4 3 Hollywood , 5 3 Mamasunción , 6 3 Super 8 , 7 3 Chano Piñeiro , 8 3 Cinema de Galicia , 9 3 Bill Gates , 10 3 Galicia , 11 2 Antoni Gaudí , 12 2 Electrónica , 13 2 Sobrado , 14 2 Rem Koolhaas , 15 2 Le Corbusier , 16 2 GIMP , 17 2 Volkswagen , 18 2 Dire Straits , 19 2 GNOME , 20 2 Matthias Ettrich , 21 2 Copérnico , 22 2 Nicolao Copérnico , 23 2 Perihelio , 24 2 Capitalismo , 25 2 Christopher Reeve

nov 2004: 1 5 Colombia , 2 4 Grecia , 3 4 Paraguai , 4 4 Estados Unidos de América , 5 4 Sistema operativo , 6 4 Vigo , 7 3 Álvaro Cunqueiro , 8 3 ESA , 9 3 George S. Patton , 10 3 Países Baixos , 11 3 Europa , 12 3 Angola , 13 3 Albania , 14 3 Estonia , 15 3 Haití , 16 3 Afganistán , 17 3 Manuel Curros Enríquez , 18 3 Perú , 19 3 Río Amazonas , 20 3 Estado do Amazonas, Brasil , 21 3 Acerbaixán , 22 3 Brasilia , 23 3 Taiwán , 24 3 Cuba , 25 3 Octeto

dez 2004: 1 6 Alemaña , 2 6 Bélxica , 3 6 Dinamarca , 4 5 Irlanda , 5 5 España , 6 4 Suecia , 7 4 Abashiri , 8 4 Hungría , 9 4 1887 , 10 4 Noruega , 11 4 Países Baixos , 12 4 Volkswagen , 13 4 1 de xaneiro , 14 4 2000 , 15 4 Francia , 16 4 Suíza , 17 4 Colombia , 18 4 Albert Einstein , 19 3 Camboxa , 20 3 Eslovaquia , 21 3 Francisco de Moure , 22 3 Chipre , 23 3 17 de xaneiro , 24 3 Xeografía de Alemaña , 25 3 Austria

jan 2005: 1 4 Abadín , 2 4 2 de xaneiro , 3 4 Vigo , 4 3 Castelo de Lobeira , 5 3 Couto Mixto , 6 3 Abomei , 7 3 India , 8 3 Limón , 9 3 A Arnoia , 10 3 Vilanova de Arousa , 11 3 Baleira , 12 3 Baltar , 13 3 Calvos de Randín , 14 3 Sandiás , 15 3 Comarca da Limia , 16 3 1990 , 17 2 Ramón Verea , 18 2 Gregorio Aglipay , 19 2 Axenor , 20 2 19 de abril , 21 2 Vorbis , 22 2 Martín, Baleira , 23 2 13 de febreiro , 24 2 Nanotecnoloxía , 25 2 Nanobiosensor

fev 2005: 1 5 Clítoris , 2 4 São Paulo , 3 4 Filloa , 4 3 Abadexo , 5 3 Basilio o Grande , 6 3 Akita , 7 3 Akashi , 8 3 A Marronda , 9 3 Ernest Shackleton , 10 3 Adamstown , 11 3 Ramirás , 12 3 Abadín , 13 3 Dominio de primeiro nivel , 14 3 2 de xaneiro , 15 3 Lista de países , 16 3 Lugo , 17 3 Santander, Colombia , 18 3 Rosalía de Castro , 19 3 Galicia , 20 3 Mercurio (elemento) , 21 3 Historia do Brasil , 22 3 Alfabeto , 23 2 Ahmedabad , 24 2 Matamá, Vigo , 25 2 Troll

mar 2005: 1 4 Hórreo , 2 4 Ferrol , 3 4 28 de marzo , 4 4 Historia de España , 5 4 España , 6 3 Pandeireta , 7 3 Lista ordenada de elementos químicos , 8 3 Eros , 9 3 Caos , 10 3 Andoriña , 11 3 Xenebra, Suíza , 12 3 Jisaburo Ozawa , 13 3 Abruñeiro , 14 3 Abrótano macho , 15 3 Lawrence Alma-Tadema , 16 3 Rato (informática) , 17 3 Basilio o Grande , 18 3 ADSL , 19 3 5 de xaneiro , 20 3 Guerra fría , 21 3 4 de xaneiro , 22 3 Países Baixos , 23 3 Camilo José Cela , 24 3 Rato , 25 3 Nós

abr 2005: 1 6 Cataluña , 2 6 Galicia , 3 5 Canadá , 4 5 Partido dos Socialistas de Galicia , 5 5 España , 6 4 Identidade Galega , 7 4 Digamma , 8 4 Cruzadas , 9 4 C (linguaxe de programación) , 10 4 Alberte I de Mónaco , 11 4 Billarda , 12 4 28 de abril , 13 4 3 de xaneiro , 14 4 Dinamarca , 15 3 Pandeireta , 16 3 Tony Blair , 17 3 Dseta , 18 3 Abraham Lincoln , 19 3 Delta (letra) , 20 3 Praia de Riazor , 21 3 Navegador web , 22 3 Emilio Pérez Touriño , 23 3 Anxo Quintana , 24 3 Sofía de Prusia , 25 3 Constantino I de Grecia

mai 2005: 1 5 CORBA , 2 4 Dolmen , 3 4 Ribadeo, Ribadeo , 4 4 Illa de San Martiño, O Vicedo , 5 3 Frédéric Mistral , 6 3 Pataca , 7 3 Raíz cadrada , 8 3 Vilasobroso, Mondariz , 9 3 Turcomenistán , 10 3 Mar Caspio , 11 3 Romaría das Cruces , 12 3 A Ponte, Arante, Ribadeo , 13 3 Sudán , 14 3 Osvobodilna Fronta , 15 3 France Prešeren , 16 3 Compoñente de software , 17 3 Unidade Galega (coalición) , 18 3 Partido Galeguista (1978) , 19 3 Esquerda Galega , 20 3 Partido Obreiro Galego , 21 3 Peer-to-peer , 22 3 Object Management Group , 23 3 XML , 24 3 Partido Popular Galego , 25 3 Partido Galego Social Demócrata

jun 2005: 1 4 Vaca , 2 4 Francia , 3 3 Final Fantasy , 4 3 Apple Inc. , 5 3 Batman , 6 3 Ana Paula Arósio , 7 3 Thor (banda deseñada) , 8 3 Disco ríxido , 9 3 Casto Sampedro Folgar , 10 3 Zen , 11 3 Final Fantasy VII , 12 3 Monte Etna , 13 3 Cataluña , 14 3 Kitesurf , 15 3 Os doce traballos de Hércules , 16 3 Frauta doce , 17 3 Mariola (xogo) , 18 3 Convento de San Francisco do Val de Deus , 19 3 Gaita galega , 20 3 Portocubelo, Lira, Carnota , 21 3 Ramón Armada Teixeiro , 22 3 Reintegracionismo , 23 3 Escocia , 24 3 Partido Popular de Galicia , 25 3 A Pobra do Caramiñal

jul 2005: 1 4 Estatuto de autonomía de Galicia de 1981 , 2 4 Vilalba , 3 4 A Coruña , 4 4 Wiki , 5 3 Xunta de Galicia , 6 3 Massachusetts , 7 3 Guerra dos Seis Días , 8 3 Mendinho , 9 3 Tigre , 10 3 Trinidad e Tobago , 11 3 Xabier Barreiro Liz , 12 3 Niccolò Paganini , 13 3 Wolfgang Amadeus Mozart , 14 3 Giuseppe Verdi , 15 3 Alexandre o Grande , 16 3 Sun Tzu , 17 3 Trotskismo , 18 3 Montevideo , 19 3 Illas Ashmore e Cartier , 20 3 Mahatma Gandhi , 21 3 Bosnia - Hercegovina , 22 3 Ext3 , 23 3 Proxecto Apollo , 24 3 Elemento químico , 25 3 Santiago de Compostela

ago 2005: 1 4 A Coruña , 2 3 Quioto , 3 3 Lista de papas , 4 3 Monte Pindo , 5 3 Tomate , 6 3 Historia de México , 7 3 Laborie, Santa Lucía , 8 3 Cáncer , 9 3 Ponferrada , 10 3 Rondonia , 11 3 Bretaña , 12 3 Figura estilística , 13 3 Río Xallas , 14 3 Asterix , 15 3 Río Tambre , 16 3 Mahoma , 17 3 Luar na lubre , 18 3 As Burgas , 19 3 Culleredo , 20 3 Castropol , 21 3 Amazonas , 22 3 Ría de Arousa , 23 3 Lago , 24 3 Galicia , 25 3 Pesca

set 2005: 1 5 Silva, Pol , 2 4 Lingua galega , 3 3 Silano , 4 3 Milladoiro , 5 3 Encoro , 6 3 Illa da Altura , 7 3 Regato de Saímes , 8 3 Silva , 9 3 Silva, Silva, Pol , 10 3 Muralla de Lugo , 11 3 Arco (arquitectura) , 12 3 Nova Orleáns , 13 3 Fuji , 14 3 Papiro , 15 3 Imperio Romano , 16 3 Roma antiga , 17 3 Milladoiro (grupo musical) , 18 3 Río Ulla , 19 3 William Shakespeare , 20 3 1 , 21 3 Touro , 22 3 Lingua latina , 23 3 Luz , 24 2 Sete marabillas do mundo , 25 2 Microsoft Office

out 2005: 1 5 Palestina (rexión) , 2 4 Ramón Sampedro , 3 4 Ribadeo , 4 3 Ponte dos Santos , 5 3 Ourizo cacho , 6 3 Período helenístico , 7 3 Rapa das bestas , 8 3 Illa Jarvis , 9 3 Curitiba , 10 3 Trastorno bipolar , 11 3 Castelo de area , 12 3 Folión dos carros , 13 3 Shiatsu , 14 3 Mar de Mármara , 15 3 Texas , 16 3 Marguerite Duras , 17 3 Lei de Grimm , 18 3 Antífrase , 19 3 Luar na lubre , 20 3 Gripe aviaria , 21 3 4 de novembro , 22 3 Marín , 23 3 Microsoft Windows , 24 3 Ferrol , 25 3 América

nov 2005: 1 5 Chile , 2 5 Galicia , 3 4 Lista de volcáns , 4 4 Idade Media , 5 3 Muro de Berlín , 6 3 Canedo, Ourense , 7 3 A Galicia feudal , 8 3 Sacaúntos , 9 3 Catro , 10 3 Conflitos e sublevacións no Brasil , 11 3 Bésta , 12 3 Historia da pintura en Creta , 13 3 Smog gris , 14 3 Grecia antiga , 15 3 Afonso II de Asturias , 16 3 Castros de Punta Neixón , 17 3 Felicidade , 18 3 Carmina Burana , 19 3 Bamiro, Vimianzo , 20 3 Michelangelo , 21 3 Nova Jersey , 22 3 Estado de Washington , 23 3 Trigonometría , 24 3 Volcán , 25 3 Armenia

dez 2005: 1 5 Ribadeo , 2 4 Estados dos Estados Unidos de América , 3 4 Suráfrica , 4 4 Ribeira , 5 4 Baiona , 6 4 Literatura , 7 3 Lingua galó , 8 3 Bacallau , 9 3 Chihuahua (can) , 10 3 Declaración Universal dos Dereitos Humanos , 11 3 Os Picapedra , 12 3 John Ford , 13 3 Xénero literario , 14 3 Autodefensas Unidas de Colombia , 15 3 Seúl , 16 3 Quebec , 17 3 Hawai , 18 3 Tíbet , 19 3 Quilogramo , 20 3 20 de decembro , 21 3 31 de decembro , 22 3 A Estrada , 23 3 Armenia , 24 3 BitTorrent , 25 3 California

jan 2006: 1 4 Galiza Nova , 2 4 Lista de filmes con versión en galego , 3 4 Lobo , 4 4 Alfabeto Fonético Internacional , 5 4 Miguel de Cervantes , 6 4 Galicia , 7 4 Música , 8 3 Xosé Luís Méndez Ferrín , 9 3 O planeta dos simios , 10 3 Avant Browser , 11 3 Publio Cornelio Escipión o Africano , 12 3 Tarragona , 13 3 Comités Abertos de Faculdade , 14 3 ATI Technologies , 15 3 Desenvolvemento sustentábel , 16 3 Álvaro Cunqueiro , 17 3 Lista de emperadores romanos , 18 3 Gala Placidia , 19 3 Anicio Olibrio , 20 3 Anicio Boecio , 21 3 Linguas crioulas , 22 3 Escrita cuneiforme , 23 3 Dinastía Omeia , 24 3 Francis Drake , 25 3 Galia

fev 2006: 1 4 Bloque Nacionalista Galego , 2 4 Galicia , 3 3 Canedo , 4 3 San Clodio, Leiro , 5 3 Centros de Formación e Recursos , 6 3 Devasa (informática) , 7 3 Futbolín , 8 3 Catedral de Santiago de Compostela , 9 3 Safari (navegador) , 10 3 Ceilán , 11 3 Gaza , 12 3 PowerPC , 13 3 Lucía Aldao , 14 3 GameCube , 15 3 Aníbal Cavaco Silva , 16 3 Pastafarismo , 17 3 Caudal (fluído) , 18 3 Tenerife , 19 3 Grego capadocio , 20 3 Estremadura , 21 3 Genghis Khan , 22 3 System of a down , 23 3 Novela , 24 3 Al Qaida , 25 3 Faixa de Gaza

mar 2006: 1 4 Aeroportos de Galicia , 2 4 José Ricardo Díaz Pardeiro , 3 4 Atentados do 11 de marzo de 2004 en Madrid , 4 4 Bandeira de Galicia , 5 4 Galicia , 6 3 Run , 7 3 Uxío Novoneyra , 8 3 Altofalante , 9 3 A arte da guerra , 10 3 Sniffer , 11 3 Topoloxía de rede , 12 3 Cataluña , 13 3 Xeorxia , 14 3 Acerbaixán , 15 2 Porto do Son , 16 2 Orella , 17 2 C. J. Cherryh , 18 2 1399 , 19 2 1400 , 20 2 1401 , 21 2 1402 , 22 2 1403 , 23 2 1404 , 24 2 1405 , 25 2 1406

abr 2006: 1 6 País Vasco , 2 6 Filloa , 3 5 Galicia , 4 4 Mugardos , 5 3 Galería de imaxes de Mugardos , 6 3 Galería de imaxes de Lugo , 7 3 Six Feet Under , 8 3 Castela-A Mancha , 9 3 Celestino I, papa , 10 3 Cracker , 11 3 JPEG , 12 3 Extraterrestre , 13 3 Clima , 14 3 Cataluña , 15 3 Comunidade Valenciana , 16 3 Café , 17 3 Nós-Unidade Popular , 18 3 Camboxa , 19 3 Alemaña , 20 3 Real Academia Galega , 21 2 Francisco Franco , 22 2 Interface gráfica de usuario , 23 2 Buenaventura Durruti , 24 2 Radioactividade , 25 2 Porto do Son

mai 2006: 1 7 Galicia , 2 6 Vigo , 3 5 Enric Miralles , 4 5 Carlos V, Sacro Emperador Romano-Xermánico , 5 5 Ith , 6 5 Batalla de Pavía , 7 4 Petra , 8 4 Heart of Midlothian F.C. , 9 4 Rangers F.C. , 10 4 Cámara de Faraday , 11 4 Moebius , 12 4 Batalla de Salamina , 13 4 Sebastianismo , 14 4 Muiñeira , 15 4 Nerva , 16 4 Vitelio , 17 4 Porto do Son, Noal, Porto do Son , 18 4 Manuel Lugrís Freire , 19 4 Ghana , 20 4 Costa Rica , 21 4 Serbia e Montenegro , 22 4 Albany, Nova York , 23 4 17 de maio , 24 3 Porto do Son , 25 3 Tomé de Aquino

jun 2006: 1 8 Galicia , 2 6 Cataluña , 3 5 Lingua aragonesa , 4 5 Irlanda , 5 5 Cuba , 6 5 Portugal , 7 4 Partido Popular , 8 4 Nacionalismo vasco , 9 4 Partido Nacionalista Vasco , 10 4 Arpa , 11 4 Caracalla , 12 4 Parque Arqueolóxico da Arte Rupestre , 13 4 Iparralde , 14 4 Cataluña do Norte , 15 4 Estreleira , 16 4 New Deal , 17 4 Cristina Pato , 18 4 FC Bayern München , 19 4 Irán , 20 4 Segunda guerra mundial , 21 4 Europa , 22 4 A Coruña , 23 3 Polbo , 24 3 Estalactita , 25 3 UCI ProTour

jul 2006: 1 7 Óscar Pereiro , 2 5 Treboniano Galo , 3 5 Galicia , 4 4 Día Nacional de Galicia , 5 4 House (serie de televisión) , 6 4 Parque Nacional de Mu Co Chan , 7 4 Praia da Lavanqueira , 8 4 Gordiano I , 9 4 Agora é sempre , 10 4 Alexandre Severo , 11 4 Rosalía de Castro , 12 4 Vigo , 13 3 Daniel Kessler , 14 3 Emanuel Lasker , 15 3 Ana Guevara , 16 3 Galieno , 17 3 Henrique V (teatro) , 18 3 Moscovita , 19 3 Petroloxía , 20 3 Ágreda , 21 3 Valeriano , 22 3 Pardo de Cela , 23 3 Emiliano , 24 3 House , 25 3 Decio

ago 2006: 1 5 Guerra civil española , 2 5 Galicia , 3 4 Manuel Godoy , 4 4 Fascismo , 5 4 El Gran Wyoming , 6 4 Santiago Casares Quiroga , 7 4 Barbantesa , 8 4 Castelo do Castrodouro , 9 4 Mario , 10 4 Pardo de Cela , 11 4 House (serie de televisión) , 12 4 Miguel de Cervantes , 13 4 2006 , 14 4 Matemáticas , 15 4 Deportivo da Coruña , 16 4 Historia de España , 17 4 Astronomía , 18 3 Galiza Nova , 19 3 Buenaventura Durruti , 20 3 Cladoxénese , 21 3 Fernando VII , 22 3 Píllara riscada , 23 3 Isabel II de España , 24 3 Armée Révolutionnaire Bretonne , 25 3 Estanislao Figueras

set 2006: 1 5 Lingua galega , 2 4 Metallica , 3 4 Nomenclátor de Galicia , 4 4 Hórreo , 5 4 Outeiro de Rei , 6 4 Editorial Galaxia , 7 4 Galicia , 8 3 País Vasco , 9 3 Mirón , 10 3 Curtametraxe , 11 3 Álex de la Iglesia , 12 3 Coia, Vigo , 13 3 Adarga , 14 3 Thrash metal , 15 3 Dios ke te crew , 16 3 Río San Lázaro , 17 3 A Ponte Maceira, Portor, Negreira , 18 3 Xaime Quintanilla Martínez , 19 3 Miguel Barros , 20 3 Xosé Luís Barreiro Rivas , 21 3 Diego Xelmírez , 22 3 Historia da Coruña , 23 3 Comunidade autónoma , 24 3 Gaélico irlandés , 25 3 Tourón

out 2006: 1 4 Marco Antonio , 2 4 Castro das Grobas , 3 4 Lingua telugúa , 4 4 Aquiles , 5 4 Cova do Rei Cintolo , 6 4 Nós-Unidade Popular , 7 4 Deportivo da Coruña , 8 3 Comunicación síncrona , 9 3 Iguanodonte , 10 3 Parlamento escocés , 11 3 Lista de extensións de ficheiros , 12 3 CSS , 13 3 Amílcar Barca , 14 3 Paul Gauguin , 15 3 Paul Cézanne , 16 3 Zaphod Beeblebrox , 17 3 Björk , 18 3 Dresden , 19 3 Cegoña negra , 20 3 Fuenlabrada , 21 3 Leganés , 22 3 Copa Galiza de fútbol , 23 3 Harpo Marx , 24 3 Xénova , 25 3 Lista de concellos de Ourense

nov 2006: 1 4 Teorema de Thévenin , 2 4 Wii , 3 4 Atentados do 11 de setembro de 2001 , 4 4 Lingua galega , 5 3 Serra da Enciña da Lastra , 6 3 Wilhelm Röntgen , 7 3 Canguro , 8 3 Afluente , 9 3 Xoguetes para un tempo prohibido , 10 3 ReNova Galiza , 11 3 Casa dos Toubes , 12 3 Osmo, Cenlle , 13 3 Cenlle, Cenlle, Cenlle , 14 3 A Quintá, Cenlle, Cenlle , 15 3 Cenlle, Cenlle , 16 3 Vulgarismo , 17 3 Pano de aceiro , 18 3 2062 Atón , 19 3 Julian Barnes , 20 3 433 Eros , 21 3 Economía de Chile , 22 3 Roger Federer , 23 3 Lista de extensións de ficheiros , 24 3 Carlos Velo , 25 3 Jimbo Wales

dez 2006: 1 5 Edvard Munch , 2 5 Wassily Kandinsky , 3 5 O lapis do carpinteiro , 4 5 Cabanas , 5 4 Veiga, A Pobra do Brollón , 6 4 Automobilismo , 7 4 Postimpresionismo , 8 4 Premio Xerais , 9 4 Cádavos, A Mezquita , 10 4 Canguro , 11 4 Miranda, Castroverde , 12 4 Castros de Galicia , 13 4 Heredeiros da Crus , 14 4 Fidel Castro , 15 4 A Pobra de Trives , 16 4 Marín , 17 4 Bloque Nacionalista Galego , 18 4 Moscova , 19 4 As Pontes de García Rodríguez , 20 3 Cidade Ho Chi Minh , 21 3 Louis Pasteur , 22 3 Cloroplasto , 23 3 Ferreiros, A Pobra do Brollón , 24 3 A Ferreirúa, A Pobra do Brollón , 25 3 Piño, A Pobra do Brollón

jan 2007: 1 5 Aerosmith , 2 4 Francisco Fernández del Riego , 3 4 Cruceiro , 4 4 House (serie de televisión) , 5 4 Premio Nobel de Literatura , 6 4 Fernando Vázquez , 7 4 Vía Nova , 8 3 Johán Carballeira , 9 3 Pelota vasca , 10 3 Andrés de Prada e Gómez de Santalla , 11 3 Lista de prefixos telefónicos de España , 12 3 Adam Smith , 13 3 American Beauty , 14 3 Antroponimia , 15 3 The New York Dolls , 16 3 Cantiga de amor , 17 3 Borsod-Abaúj-Zemplén , 18 3 Tolueno , 19 3 Isidro Parga Pondal , 20 3 Biduedo, Pedrafita de Camporredondo, Baralla , 21 3 Condados de Hungría , 22 3 Ryszard Kapuściński , 23 3 Miliario , 24 3 Asterisk , 25 3 Ana Turpin

fev 2007: 1 4 Xulio Nepote , 2 4 Pascal (unidade) , 3 4 Avito , 4 4 Valentiniano II , 5 4 Pedro Madruga , 6 4 Diego Armando Maradona , 7 3 Philipp Lenard , 8 3 Lauburu vasco , 9 3 Ron , 10 3 Brandy , 11 3 Patricio de Irlanda , 12 3 Stéphane Mallarmé , 13 3 Chip , 14 3 Ciclo de desenvolvemento , 15 3 Lábaro , 16 3 Valentín de Terni , 17 3 Panteras Grises , 18 3 Panteras Negras , 19 3 Maioriano , 20 3 Albino Núñez Domínguez , 21 3 Petronio Máximo , 22 3 Castelo da Rocha Forte , 23 3 Stephen Jay Gould , 24 3 Bacanal , 25 3 Lupercais

mar 2007: 1 6 IES Lamas de Castelo , 2 6 Literatura galega do século XX , 3 5 Lingua leonesa , 4 4 Tornado , 5 4 Bioestratinomía , 6 4 Lista de reis de Portugal , 7 4 Azor , 8 4 Castelo de Tebra , 9 4 Lingua mirandesa , 10 4 Biblos , 11 4 Merlín , 12 4 Prodemar , 13 4 Piscifactoría , 14 4 Castelo de Sobroso , 15 4 Pedro Madruga , 16 4 Batalla das Termópilas , 17 4 Lingua galesa , 18 4 Los Tamara , 19 4 Lingua portuguesa , 20 3 Literatura galega dos Séculos Escuros , 21 3 Ribosoma , 22 3 Fritz Strassmann , 23 3 Piñeiro (homónimos) , 24 3 Citoesqueleto , 25 3 Xenética molecular

abr 2007: 1 6 Nacionalismo galego , 2 5 La Figuera , 3 4 The Simpsons , 4 4 Loita , 5 4 Moucho común , 6 4 Conservatorio Nacional de Arte Galega , 7 4 Squash , 8 4 Skate , 9 4 Principado do Pindo e de Moglena , 10 4 Bufo pequeno , 11 4 Xesús Alonso Montero , 12 4 Cesare Pavese , 13 4 René Magritte , 14 4 Pedro Froilaz de Traba , 15 4 Théophile Gautier , 16 4 Ourego , 17 4 Literatura galega dos Séculos Escuros , 18 4 Lista de encoros de Galicia , 19 4 Manuel Comellas , 20 4 Casa Grande de Lentille , 21 4 Soutomaior , 22 4 Vila de Cruces , 23 4 Lista de concellos da Coruña , 24 4 Galicia , 25 3 País Vasco

mai 2007: 1 8 María Mariño , 2 6 Literatura galega dos Séculos Escuros , 3 5 Eleccións municipais de 2007 en Galicia , 4 5 Lingua scots , 5 5 Nacionalismo galego , 6 5 Bloque Nacionalista Galego , 7 5 Cabalo , 8 4 Francisco Franco , 9 4 Mesa , 10 4 Ramón Campos Durán , 11 4 Pato chupón , 12 4 Literatura galega do período intersecular , 13 4 Alternativa Canguesa de Esquerdas , 14 4 Garfield e mailos seus amigos , 15 4 Velocidade de escape , 16 4 Garrucho , 17 4 Pena de morte , 18 4 Literatura galega do Rexurdimento , 19 4 Xabier P. DoCampo , 20 4 Francisco Frutos , 21 4 Hogzilla , 22 4 Gyula von Milványi-Csesznegi , 23 4 Literatura galega do século XX , 24 4 Freixo común , 25 4 O detective Conan

jun 2007: 1 6 Literatura galego-portuguesa , 2 5 Led Zeppelin IV , 3 5 Xoán Gato , 4 5 Síndrome de Down , 5 5 Xoán Caboto , 6 5 Bande , 7 5 Cadeira , 8 5 Burro , 9 4 Ielena Ielesina , 10 4 Rosa Mota , 11 4 Notario , 12 4 Vellarrón , 13 4 Tiro con arco , 14 4 Martiño Rivas , 15 4 Eleccións municipais de 2007 en Galicia , 16 4 Batasuna , 17 4 Serra do Xistral , 18 4 Pernileiro , 19 4 Estados Unidos de América , 20 4 Reino Unido , 21 3 Banco Europeo de Investimento , 22 3 Henrique II , 23 3 Biodiésel , 24 3 Roi Xordo , 25 3 Río Vaa

jul 2007: 1 6 Partido Independentista Portorriqueño , 2 5 Alimentación , 3 5 Rodrigo de Castro Osorio , 4 5 Club Baloncesto Breogán , 5 5 Robert Bruce , 6 5 Illas Galápagos , 7 5 Alonso I de Fonseca , 8 5 Pardo de Cela , 9 5 Prada, A Veiga , 10 5 Alfonso Daniel Rodríguez Castelao , 11 4 Mariscal , 12 4 Ganso paporrubio , 13 4 Henrique VIII de Inglaterra , 14 4 Roberto II de Escocia , 15 4 Matrimonio entre persoas do mesmo sexo , 16 4 Vexetarianismo , 17 4 Gerald Gardner , 18 4 Fiúncho , 19 4 Celtiberos , 20 4 Illa de Jersey , 21 4 Especia , 22 4 Sacro Imperio Romano Xermánico , 23 4 Hans Magnus Enzensberger , 24 4 Teoloxía , 25 4 Mosteiros e conventos de Galicia

ago 2007: 1 6 Estremadura , 2 6 Ourense , 3 6 Vigo , 4 5 2007 , 5 5 Castros de Galicia , 6 5 Roberto Somoza , 7 5 Historia de Galicia , 8 4 Quebraosos , 9 4 Museo do Louvre , 10 4 Ratatouille (filme) , 11 4 The Queen , 12 4 Galicia na Segunda República , 13 4 Cuarta Internacional , 14 4 Castro de San Cibrao de Las , 15 4 Museo de Arte Contemporánea de Vigo , 16 4 Euskadi Ta Askatasuna , 17 4 Río Sar , 18 4 Gallaecia , 19 4 Sanxenxo , 20 4 Estados Unidos de América , 21 4 1 de xaneiro , 22 4 Galicia , 23 3 Francisco Franco , 24 3 Antonio Meucci , 25 3 Frodo Bulseiro

set 2007: 1 9 Vigo , 2 6 Portada , 3 6 Leite callado , 4 6 Vuelta a España 2007 , 5 6 Fragas do Eume , 6 5 Petróglifo , 7 5 Dialecto altonavarro , 8 5 Dialecto suletino , 9 5 Emma Goldman , 10 5 Helen Keller , 11 5 Galicia na Segunda República , 12 5 Antisemitismo , 13 5 Xenocidio armenio , 14 5 Hipergaleguismo , 15 5 España , 16 5 Lingua portuguesa , 17 5 Prestige , 18 4 Francisco Franco , 19 4 Salamántiga rabilonga , 20 4 María Castaña , 21 4 Declaración dos dereitos da muller e da cidadá , 22 4 Rubén Darío , 23 4 Catarina II de Rusia , 24 4 Aras sextianas , 25 4 Teófilo Caamaño

out 2007: 1 7 Thomas Kuhn , 2 7 Fernando Alonso , 3 6 Robert Musil , 4 5 David Batista , 5 5 Val de Aosta , 6 5 Monte Medulio , 7 5 Portada , 8 5 Lewis Hamilton , 9 5 Franquismo , 10 5 José Luis Rodríguez Zapatero , 11 5 Alfonso Daniel Rodríguez Castelao , 12 5 Gato , 13 4 Moloko , 14 4 John Nash , 15 4 John Cena , 16 4 L'Hôpital-Saint-Blaise , 17 4 Os Vilares, Guitiriz , 18 4 Csesznek , 19 4 Paul Ricoeur , 20 4 Castro de Santa Trega , 21 4 Mosteiro de San Vicente do Pino , 22 4 Garfield e mailos seus amigos , 23 4 A-76 , 24 4 Literatura galega do século XX , 25 4 Pórtico da Gloria

nov 2007: 1 6 Rea (lúa) , 2 6 El Greco , 3 6 Piloto , 4 6 Fernando Fernán Gómez , 5 5 Abelardo Miguel , 6 5 Pedro Froilaz de Traba , 7 5 Historia do Reino Unido , 8 5 Castros de Galicia , 9 5 Santiago Ramón y Cajal , 10 5 Galicia , 11 4 Xeosfera , 12 4 Henry Fonda , 13 4 Tetis (lúa) , 14 4 Titán (lúa) , 15 4 Río Guadiana , 16 4 FEVE , 17 4 Pegada ecolóxica , 18 4 Era Compostelá , 19 4 Ennio Morricone , 20 4 Boris Vian , 21 4 Botellón , 22 4 Encelado (lúa) , 23 4 Federación , 24 4 Lewis Hamilton , 25 4 Castro de Santa Trega

dez 2007: 1 6 Bugallo , 2 6 Monte de San Trocado , 3 5 Resistência Galega , 4 5 Encoro de Portodemouros , 5 5 Projecto Mourente , 6 5 Ignorancia , 7 5 Teoría científica , 8 5 Fundación Carlos Casares , 9 5 Eleccións xerais de España de 2008 , 10 5 Xosé Cuíña , 11 4 País Vasco , 12 4 A Rianxeira , 13 4 Unión Progreso y Democracia , 14 4 Encoro de Caldas , 15 4 Club do Mar Ferrol , 16 4 Charly J , 17 4 Club Deportivo Choco , 18 4 Vinte mil leguas baixo dos mares , 19 4 Aegean Sea , 20 4 Sistema de posicionamento global , 21 4 Abelardo Miguel , 22 4 Mosteiro de Santa María de Aciveiro , 23 4 Lista de encoros de Galicia , 24 4 Castelo da Rocha Forte , 25 4 Castro dos Prados

jan 2008: 1 6 Tutankhamon , 2 6 Fragas do Eume , 3 6 Sada , 4 5 Estación depuradora de augas residuais , 5 5 Estación de Ourense - Empalme , 6 5 Rosa Díez , 7 5 Museos de Galicia , 8 5 Historia de Istambul , 9 5 CITES , 10 5 Rafael Mouzo , 11 5 Silleda , 12 4 Miro Casabella , 13 4 Marie Smith Jones , 14 4 Capitel , 15 4 Cabo Vilán , 16 4 Números E , 17 4 Orde , 18 4 Pobreza absoluta , 19 4 A de Carlomagno , 20 4 O holandés errante , 21 4 X-Men Evolution , 22 4 Portela da Laxe , 23 4 Antonio Carballeira Muñiz , 24 4 Amenofis III , 25 4 Cruz celta

fev 2008: 1 5 Manuel Murguía , 2 5 Vigo , 3 4 Mosteiro de Yuste , 4 4 Fedro (Platón) , 5 4 Emilio Araúxo , 6 4 Papagaio Ravachol , 7 4 Dacca , 8 4 Pazo de Meirás , 9 4 Romancero gitano , 10 4 Calendario chinés , 11 4 Emilio Mola , 12 4 Resío , 13 4 Chuvia de animais , 14 4 Clorofluorocarbonos , 15 4 Mascato , 16 4 The Legend of Zelda: A Link to the Past , 17 4 Garri Kasparov , 18 4 Lista de cidades en Portugal , 19 4 Vaca , 20 4 Xosé María Álvarez Blázquez , 21 4 Fidel Castro , 22 4 Eduardo Blanco Amor , 23 4 Alfonso Daniel Rodríguez Castelao , 24 4 Xaquín Lorenzo , 25 4 Entroido

mar 2008: 1 7 Galicia , 2 6 Galeusca , 3 6 A Coruña , 4 6 Lingua galega , 5 5 Jenseits von Gut und Böse , 6 5 Galería de bandeiras dos concellos de Galicia , 7 5 Illa de San Simón , 8 5 Historia da lingua galega , 9 5 Ferrol , 10 5 Lugo , 11 4 Curro , 12 4 David Fernández Ortiz , 13 4 Antón Arias Curto , 14 4 Ocupación de Estonia por Alemaña , 15 4 Galeusca (homónimos) , 16 4 Método D'Hondt , 17 4 Enseada de San Simón , 18 4 Río Grande de Xuvia , 19 4 Vladimir Nabokov , 20 4 José Lage Lage , 21 4 J. K. Rowling , 22 4 José Blanco , 23 4 Escola de Vela Tradicional da Illa de Arousa , 24 4 Muíño , 25 4 Manuel Lugrís Freire

abr 2008: 1 6 Unión de Mulleres Antifascistas , 2 6 Pazo de Meirás , 3 6 Redondela , 4 6 Ferrol , 5 5 Etanol , 6 5 Bebida alcohólica , 7 5 Rafael Mouzo , 8 5 Galicia , 9 4 Gando , 10 4 Santa María la Blanca , 11 4 LeBron James , 12 4 The Battle of Los Angeles , 13 4 Evil Empire , 14 4 Surf-casting , 15 4 Malice Mizer , 16 4 Aditivo , 17 4 ¡Asústate, Merche! , 18 4 María Antonia Iglesias , 19 4 Xosé Chorén , 20 4 Octógono , 21 4 Assembleia da Mocidade Independentista , 22 4 Gallia Narbonensis , 23 4 Queixo , 24 4 Ecosistema , 25 4 Belize

mai 2008: 1 7 Xosé María Álvarez Blázquez , 2 7 Galicia , 3 7 Francia , 4 6 A Voz de Vilalba , 5 5 Galería de imaxes de casas dos concellos de Galicia , 6 5 Mata do porco , 7 5 Dialogues Concerning Natural Religion , 8 5 Ría da Coruña , 9 5 O Grove , 10 5 Karl Marx , 11 4 Encontro Irmandiño , 12 4 Zur Kritik der politischen Ökonomie , 13 4 Zum ewigen Frieden , 14 4 Quiksilver , 15 4 Fernando González \"Gonzo\" , 16 4 Mouzo, Carnés, Vimianzo , 17 4 Retroceso dos glaciares desde 1850 , 18 4 Mario de Langullo , 19 4 Lista de monarcas de Galicia , 20 4 Queimada , 21 4 Queixo San Simón da Costa , 22 4 Casa do Home , 23 4 Lusismo , 24 4 Mugardos , 25 4 A Fonsagrada

jun 2008: 1 7 Galicia , 2 6 Bella ciao , 3 6 Pontevedra , 4 6 España , 5 5 A Avenida de Ordóñez, Goián, Tomiño , 6 5 COPE , 7 5 Monumento á Liberdade , 8 5 Demografía de Galicia , 9 5 Lino Gómez Canedo , 10 5 Eurocopa de Fútbol Austria/Suíza 2008 , 11 5 Noceda, Lalín , 12 5 Festival Internacional do Mundo Celta , 13 5 Goián, Tomiño , 14 5 Narón , 15 5 Santiago de Compostela , 16 5 Vigo , 17 5 Música moderna , 18 4 Anna-Maria Ravnopolska-Dean , 19 4 Lista de grupos que participaron no Festival de Ortigueira , 20 4 Atún vermello , 21 4 Vampiro , 22 4 Os tres Augustos e os cinco Emperadores , 23 4 Campionato do mundo de tríatlon 2008 , 24 4 Sara Montiel , 25 4 Cangues d'Onís

jul 2008: 1 7 Bloque Nacionalista Galego , 2 6 Lamatumbá , 3 6 Lista de universidades de España , 4 6 Vigo , 5 5 Rex, un policía diferente , 6 5 Marcelo Macías , 7 5 A muller biónica , 8 5 Discovery Channel , 9 5 Aldo Manuzio , 10 5 Bret Hart , 11 5 Philosophiæ Naturalis Principia Mathematica , 12 5 Galicia , 13 4 Golfiño (banda deseñada) , 14 4 Lee Friedlander , 15 4 Filgueira, Castro, Cerdedo-Cotobade , 16 4 Cozido à portuguesa , 17 4 César Millán , 18 4 The Matrix , 19 4 Apocalyptica , 20 4 Maria Anna Mozart , 21 4 Nelson Frazier, Jr. , 22 4 Abeto de Douglas , 23 4 Carlos I de Portugal , 24 4 Luís I de Portugal , 25 4 Sally Martin

ago 2008: 1 7 Voo 5022 de Spanair , 2 5 Pazo de Meirás , 3 5 Xogos Olímpicos de 2008 , 4 5 Goián, Tomiño , 5 4 George Steiner , 6 4 Alexandre Nerium , 7 4 Día da Independencia , 8 4 Manuel María Puga Parga , 9 4 Capadocia , 10 4 Helios Gómez , 11 4 Segunda República Española , 12 4 Betanzos , 13 4 Cambados , 14 4 Andorra , 15 4 Vigo , 16 4 Galicia , 17 4 España , 18 3 Stoner rock , 19 3 Bixkek , 20 3 Estación de Bioloxía Mariña da Graña , 21 3 Coralia e Maruxa, as irmás Fandiño , 22 3 Festa do Gaiteiro , 23 3 Bartolomeo Vanzetti , 24 3 Nicola Sacco , 25 3 Mercedes Castro Díaz

set 2008: 1 7 Pazo de Meirás , 2 6 Gran colisor de hadróns , 3 4 Seseo , 4 4 Ambiente de escritorio , 5 4 Eduardo Ferreirós Boullosa , 6 4 Xoán de Gante , 7 4 Organización Europea para a Investigación Nuclear , 8 4 Esterno , 9 4 A Veronza, Carballeda, Carballeda de Avia , 10 4 Reino de Galicia , 11 3 Praia de Carnota , 12 3 Flickr , 13 3 Rótula , 14 3 Kaspar Capparoni , 15 3 Bomba , 16 3 Billions and Billions , 17 3 Miguel Anxo Fernández Lores , 18 3 Roland Ratzenberger , 19 3 Dorado (homónimos) , 20 3 Coroa de Castela , 21 3 Ría de Abres (homónimos) , 22 3 Lapislázuli , 23 3 Taifa , 24 3 Guerra dos Cen Anos , 25 3 Xoán Fernández de Andeiro

out 2008: 1 7 Illa de San Simón , 2 7 Google , 3 6 Amancio Ortega , 4 5 Ramiro Fonte , 5 5 Galicia , 6 5 Lingua galega , 7 4 A morte na cultura popular galega , 8 4 Lareira , 9 4 Aparello dixestivo , 10 4 Marce, Vilar de Ortelle, Pantón , 11 4 Biotecnoloxía , 12 4 Torre da Penela , 13 4 Colombo (serie de televisión) , 14 4 Euskadi Ta Askatasuna , 15 4 Vigo , 16 3 Dumbo , 17 3 Láchar , 18 3 Watergate , 19 3 Martin Weinek , 20 3 Glándula salivar , 21 3 Parlamento de Andalucía , 22 3 Cegoñal , 23 3 Ab 18 , 24 3 Torre de Marce , 25 3 Xusto Beramendi

nov 2008: 1 6 Pazo Baión , 2 6 Carnota , 3 5 Teresa Pedrosa , 4 5 Praia América , 5 4 Eugène Ionesco , 6 4 O lobo na cultura popular galega , 7 4 James Watt , 8 4 Revolución Cubana , 9 4 Cortadeira , 10 4 Glicóxeno , 11 4 Napoleón III de Francia , 12 4 Demi Lovato , 13 4 Enxeñaría xenética , 14 4 Aria Giovanni , 15 4 Lexionario , 16 4 Independientes por Ferrol , 17 4 O porco na cultura popular galega , 18 4 Juan Camilo Mouriño , 19 4 Barack Obama , 20 4 Francisco Sampedro , 21 4 Telecinco , 22 4 Rioaveso, Vilalba , 23 4 Couto Mixto , 24 4 Castro , 25 4 Historia de Inglaterra

dez 2008: 1 7 Alfonso Daniel Rodríguez Castelao , 2 7 Galicia , 3 6 Selección de fútbol de Galicia , 4 6 Reino de Galicia , 5 5 Caudal ecolóxico , 6 5 Glicoproteína , 7 5 Ubuntu (GNU/Linux) , 8 4 El coronel no tiene quien le escriba , 9 4 A Igrexa, Chapela, Redondela , 10 4 Biótopo , 11 4 Bandeira da Comunidade Valenciana , 12 4 Licor 43 , 13 4 Serafín Martínez Acevedo , 14 4 Especie eurióica , 15 4 IES Canido , 16 4 Nivel trófico , 17 4 Confessiones , 18 4 Mikel Laboa , 19 4 Xacobeo Galicia , 20 4 Subespecie , 21 4 Jesús Vázquez Martínez , 22 4 Cataluña , 23 4 Manuel Rivas , 24 4 Burela , 25 4 Monforte de Lemos

jan 2009: 1 8 Reino de Galicia , 2 6 Francia , 3 5 Estratopausa , 4 5 Lista de concellos de España por poboación , 5 5 Arte prerrománica , 6 5 Escola Naval Militar de Marín , 7 5 A morte na cultura popular galega , 8 5 Xoán Gato , 9 5 Movemento pola Base , 10 5 Alfonso Daniel Rodríguez Castelao , 11 4 Xesús Fraga , 12 4 Lemon of Troy , 13 4 Sedimento , 14 4 Salto, Uruguai , 15 4 Transliterar , 16 4 Orbital atómico , 17 4 Mucha e Nucha , 18 4 Eleccións ao Parlamento de Galicia 2009 , 19 4 Valenciano , 20 4 Urania Mella , 21 3 Ecualizador , 22 3 Phaeophyceae , 23 3 N-536 , 24 3 Apalpador , 25 3 Deputación de Pontevedra

fev 2009: 1 9 Eleccións ao Parlamento de Galicia 2009 , 2 6 Entroido , 3 5 Bolero , 4 5 Ad libitum , 5 5 Xil Ríos , 6 5 Reino de Galicia , 7 4 Francisco Javier Cobián Salgado , 8 4 Misa , 9 4 IES Monte Carrasco , 10 4 Doutrina social da Igrexa , 11 4 Beatus ille , 12 4 Esmagamento por elefante , 13 4 José Lezama Lima , 14 4 Eurípides , 15 4 Incendiario , 16 4 Touros de Guisando , 17 4 Santa Compaña , 18 4 Sarria , 19 4 Maceda , 20 4 Francia , 21 3 Montecristo , 22 3 Victoria Abril , 23 3 Fronte cálida , 24 3 Ave, Caesar, morituri te salutant , 25 3 Tropopausa

mar 2009: 1 9 Eleccións ao Parlamento de Galicia 2009 , 2 8 Retrete , 3 6 Alberto Núñez Feijóo , 4 5 Mojinos escozíos , 5 5 Emilio Pérez Touriño , 6 5 Reino de Galicia , 7 5 Galicia , 8 5 Hip hop , 9 4 Hay alguien ahí , 10 4 Rosa Porriño , 11 4 Summum ius summa iniuria , 12 4 Praia de Area das Vacas , 13 4 Radagast , 14 4 Cómplices , 15 4 Sly Cooper , 16 4 Fracción do Exército Vermello , 17 4 Árbitro (deporte) , 18 4 Vladimir Lenin , 19 4 Afonso I de Aragón , 20 4 SpongeBob SquarePants , 21 4 Eva Perales , 22 4 Provincia marítima , 23 4 Selección de rugby de Escocia , 24 4 Doutrina social da Igrexa , 25 4 Spaßguerilla

abr 2009: 1 9 Ramón Piñeiro , 2 7 Escudo de Exipto , 3 7 Contixe, Tourón, Ponte Caldelas , 4 7 Vilarchán, Tourón, Ponte Caldelas , 5 7 Dodro , 6 6 Arturo Díaz , 7 6 Raúl Alfonsín , 8 6 Alberto Núñez Feijóo , 9 6 Partido Popular de Galicia , 10 5 Destilación fraccionada , 11 5 Lady Gaga , 12 5 Basílica do Sacré Cœur , 13 5 Twilight (filme de 2008) , 14 5 José Fernando Vila Brión , 15 5 Guillerme Vázquez , 16 5 Matalobos (serie de televisión) , 17 5 O retrato de Dorian Gray , 18 5 Ángeles González-Sinde , 19 5 Lingua leonesa , 20 5 Partido dos Socialistas de Galicia , 21 4 Xunta de Galicia , 22 4 Pro Evolution Soccer 2009 , 23 4 Gripe A (H1N1) , 24 4 Kamel Ghilas , 25 4 Portugaliza (revista)

mai 2009: 1 22 A Pobra do Caramiñal , 2 9 Fútbol Club Barcelona , 3 8 Lingua galega , 4 7 Toxicidade do paracetamol , 5 7 Ramón Piñeiro , 6 6 Río Támega , 7 6 Vilarchán, Tourón, Ponte Caldelas , 8 6 Rabal, Oímbra , 9 5 Toxicidade da cocaína , 10 5 Toxicidade dos sales de litio , 11 5 Iván Costa Blanco , 12 5 Manifestación polo galego en maio de 2009 , 13 5 Alfonso Daniel Rodríguez Castelao , 14 5 Psicoloxía , 15 4 Yaracuy , 16 4 Teratóxeno , 17 4 Peito , 18 4 Torupill , 19 4 Ben falado! , 20 4 Katie Holmes , 21 4 Minaría , 22 4 Iniciativa Internacionalista , 23 4 Acceso , 24 4 Feísmo , 25 4 Arantza Quiroga

jun 2009: 1 15 A Pobra do Caramiñal , 2 7 Michael Jackson , 3 6 Aquilino Iglesia Alvariño , 4 5 Toxicidade da cocaína , 5 5 Antídoto , 6 5 Voo 447 de Air France , 7 5 Teratóxeno , 8 5 Bloque Nacionalista Galego , 9 5 Reino de Galicia , 10 5 Galicia , 11 4 Xosé Luís Méndez Ferrín , 12 4 Irmandades da Fala , 13 4 Arde Lucus , 14 4 Haluro , 15 4 Castro de Moreira , 16 4 Galicia estremeira , 17 4 Galinux-Ubuntu , 18 4 Presidente da Unión Soviética , 19 4 Intoxicación etílica , 20 4 Marcelino Pardal Pouso , 21 4 Club de Mar Ría de Aldán , 22 4 Unión Coruñesa , 23 4 Demanda Química de Osíxeno , 24 4 Lei marcial , 25 4 Toxicidade do cánnabis

jul 2009: 1 6 Robert Bosch GmbH , 2 5 Xosé Antonio Touriñán , 3 5 A sereíña , 4 5 Litografía , 5 5 Fala de Estremadura , 6 5 Gonzalo Torrente Ballester , 7 5 Moeche , 8 5 A Fonsagrada , 9 4 Iago Aspas , 10 4 Stieg Larsson , 11 4 Técnica de impresión , 12 4 Peltre , 13 4 Síndrome de Alicia no país das marabillas , 14 4 Poeta en Nueva York , 15 4 Dettifoss , 16 4 Reyðarfjörður , 17 4 Lugh , 18 4 Toxicidade da heroína , 19 4 A sereíña (estatua) , 20 4 Sardeña , 21 4 Lingua castelá , 22 4 Pitufo , 23 4 Lince ibérico , 24 4 Manuel Rivas , 25 4 Vila de Cruces

ago 2009: 1 7 Euskadi Ta Askatasuna , 2 6 Viana do Bolo , 3 5 As Meninas , 4 4 Fento , 5 4 John Hendley Barnhart , 6 4 Vanessa Paradis , 7 4 Willy DeVille , 8 4 Josefa de Bastavales , 9 4 Alfonso Vilar Lamelas , 10 4 Contra proferentem , 11 4 José Calvo Sotelo , 12 4 A Rianxeira , 13 4 Rizoma , 14 4 Guerra dos Trinta Anos , 15 4 Cangas , 16 4 Vigo , 17 3 Cindy Crawford , 18 3 Zac Efron , 19 3 Bartolomeu de Nosendo , 20 3 The Office (NBC) , 21 3 Dev Patel , 22 3 Limbo foliar , 23 3 Fronde , 24 3 Folíolo , 25 3 Equipo Crónica

set 2009: 1 8 Buño, Malpica de Bergantiños , 2 7 Ponte Lubiáns , 3 7 Lingua leonesa , 4 7 Deportivo da Coruña , 5 6 Kilt , 6 5 Oleiros de Buño , 7 5 Consello dos Estados , 8 5 Hidrografía de Galicia , 9 5 Bibimbap , 10 5 Cántigas da Terra , 11 5 As Meninas , 12 5 Historia postal , 13 5 Illas Sisargas , 14 5 Costa da Morte , 15 5 Yoshito Usui , 16 4 Castro de San Millao , 17 4 Suíza xermanófona , 18 4 Dionisio Gamallo , 19 4 Exaculación , 20 4 San Galo , 21 4 Forte da Ínsua , 22 4 Audrey Tautou , 23 4 Lírica , 24 4 Marie Fredriksson , 25 4 Río Vouga

out 2009: 1 8 Xavier Lama , 2 6 Furacán Hortensia de 1984 , 3 6 Celtismo , 4 6 Andrés Montes , 5 5 Central térmica de Meirama , 6 5 Manzaneda , 7 5 Páxina web , 8 4 Narón TV , 9 4 Monte Xalo , 10 4 Castro (automóbil) , 11 4 Citroën Visa , 12 4 Kilt , 13 4 Xiana Arias , 14 4 Valenciano , 15 4 Xavier Prado Rodríguez , 16 4 Bandeira de Galicia , 17 4 Celta , 18 4 Daniel Cortezón , 19 4 Silleda , 20 3 Os Bolechas , 21 3 La Cuadra , 22 3 Aldara de Celanova , 23 3 Soutelo, Sobreganade, Porqueira , 24 3 San Mamede de Sobreganade, Sobreganade, Porqueira , 25 3 Faramontaos, San Martiño de Porqueira, Porqueira

nov 2009: 1 8 Molly Malone , 2 8 Goto Muñiz , 3 7 Carlos Velo , 4 6 2009 , 5 5 Gaita asturiana , 6 5 Xan das Bólas , 7 5 Andrea Pirlo , 8 5 Ferentino , 9 5 Appenzell , 10 5 Reino de Nova Galicia , 11 5 Claude Lévi-Strauss , 12 5 Primeira guerra mundial , 13 5 Galicia , 14 4 Ramón Nonato , 15 4 O Rapote, Broño, Negreira , 16 4 Lista de Illas do Xapón , 17 4 Catherine Ashton , 18 4 Palacio de Buckingham , 19 4 Baserri , 20 4 Atmosfera , 21 4 Scott Cunningham , 22 4 Zlatan Ibrahimović , 23 4 Liga de Campións da UEFA 2008-09 , 24 4 Morgan Robertson , 25 4 Esparreguera

dez 2009: 1 6 Xoán Abeleira , 2 6 Ponteareas , 3 6 Galicia , 4 5 C-531 , 5 5 Asente , 6 5 Nino Bravo , 7 5 Dani Pedrosa , 8 5 Rede social , 9 5 Caldo galego , 10 4 Terry Eagleton , 11 4 Buxaina (banda) , 12 4 Literatura modernista , 13 4 RadioVoz , 14 4 Fernando I, Duque de Bragança , 15 4 Servizo de Protección da Natureza da Garda Civil , 16 4 Jorge Mira , 17 4 Pías, Ponteareas , 18 4 A Cañiza , 19 4 Lugo , 20 4 Ourense , 21 3 Dinastía de Borgoña , 22 3 Incertae sedis , 23 3 Emil Constantinescu , 24 3 ¿Cuándo se come aquí? , 25 3 Grace Paley

jan 2010: 1 8 Breogán , 2 7 Festival de Eurovisión 2010 , 3 5 Juan Francisco Ordóñez , 4 5 Panificadora de Vigo , 5 5 Radio 3 , 6 5 Serea , 7 5 Deportivo da Coruña , 8 4 IPad , 9 4 Estevesiños, Estevesiños, Monterrei , 10 4 Albarellos, Albarellos, Monterrei , 11 4 Foxo de lobo , 12 4 Salto de trampolín , 13 4 Gasterópodos , 14 4 Sarna , 15 4 MacGyver , 16 4 Dosmasunoarquitectos , 17 4 Grande Esfinxe de Gizeh , 18 4 Os Carunchos , 19 4 Isaac Alonso Estraviz , 20 4 Culto á personalidade , 21 4 Loita de guerrillas , 22 4 Donón, O Hío, Cangas , 23 4 Vidal , 24 4 Ramón Conde , 25 4 Necrópole de Gizeh

fev 2010: 1 10 Rosa Díez , 2 5 Wikipedia en éuscaro , 3 5 Luís Iglesia , 4 5 Carlos Jiménez Díaz , 5 5 Pemento de Padrón , 6 5 Praza da Ferrería , 7 5 Diego Velázquez , 8 5 Vigo , 9 4 Algoritmo de compresión con perda , 10 4 Abertal , 11 4 Carlos Aenlle , 12 4 Crónica de una muerte anunciada , 13 4 Josep Ferrater Mora , 14 4 O soño do falcón , 15 4 Furco, Arcos, Cuntis , 16 4 Xosé Manuel Sánchez Aguión , 17 4 Pía megalítica , 18 4 Grupo Brais Pinto , 19 4 Them Crooked Vultures , 20 4 Aclis ascaris , 21 4 Menhir , 22 4 Xerez Club Deportivo , 23 4 Haumea (planeta anano) , 24 4 Lady Gaga , 25 4 Reis Magos

mar 2010: 1 37 IES Francisco Aguiar , 2 12 O Mintireiro Verdadeiro , 3 11 Dumbo , 4 10 30 Seconds to Mars , 5 9 The Lion King , 6 9 Bambi , 7 8 MÁSmóvil , 8 8 Cinderella (filme de 1950) , 9 7 The Simpsons , 10 7 The Black Cauldron , 11 7 James and the Giant Peach , 12 7 The Nightmare Before Christmas , 13 7 Uxío Novoneyra , 14 7 Fútbol , 15 6 Carlos Meijide , 16 6 Reloxo de sol , 17 6 Os Teletubbies , 18 6 Family Guy , 19 6 Emilia Pardo Bazán , 20 5 Deuses celtas , 21 5 Brothers In Arms: Road to Hill 30 , 22 5 Alfonso Pérez Sánchez , 23 5 Arturo Regueiro , 24 5 Europa (mitoloxía) , 25 5 El alcalde de Zalamea

abr 2010: 1 7 Exilio galego de 1936 , 2 6 Geoffrey Hull , 3 6 Accidente do Tu-154 da Forza Aérea de Polonia , 4 6 Hórreo , 5 5 Talking Heads , 6 5 Hórreo galego , 7 5 Cabo de Cruz, Castro, Boiro , 8 5 Música tradicional galega , 9 5 Shin Chan , 10 5 Luftwaffe , 11 5 Susana Seivane , 12 5 Televisión autonómica , 13 5 Uxío Carré Aldao , 14 5 Guerra civil española , 15 5 Historia da lingua galega , 16 5 Wikipedia , 17 4 Dinastía almorábide , 18 4 Gorka Otxoa , 19 4 Localia Vigo , 20 4 Pica de gorxa rubia , 21 4 Caravasar , 22 4 Socorro García Conde , 23 4 Partido Comunista de Alemaña , 24 4 Corneta , 25 4 Eyjafjallajökull

mai 2010: 1 8 Fútbol Club Barcelona , 2 8 Susana Seivane , 3 7 Club Baloncesto Breogán , 4 7 Uxío Novoneyra , 5 6 Antón Lamazares , 6 6 Gato , 7 5 Filipe V de España , 8 5 Vaca , 9 5 Vilasobroso, Mondariz , 10 5 Historia da lingua galega , 11 5 Hórreo , 12 4 Hermenexildo Aloitez , 13 4 Nuno II Mendes , 14 4 Dedo , 15 4 A Naifa , 16 4 Ronnie James Dio , 17 4 Eduardo Mondlane , 18 4 Intel 80386 , 19 4 Hórreo tipo Cedeira , 20 4 Reino de Murcia , 21 4 Reino de Córdoba , 22 4 Reino de Xaén , 23 4 Reino de Sevilla , 24 4 Reino de Toledo , 25 4 Descolonización

jun 2010: 1 10 Alfonso Daniel Rodríguez Castelao , 2 8 Galicia , 3 7 Suero Gómez de Soutomaior , 4 7 Galicia estremeira , 5 7 Paulo Carlos López , 6 6 Cegos: os meus compañeiros , 7 6 Hepatotoxicidade , 8 6 Nefrotoxicidade , 9 6 Garcilaso de la Vega , 10 6 Xoana de Habsburgo , 11 6 Mundial de Fútbol de 2010 , 12 6 Historia da lingua galega , 13 6 Vilalba , 14 6 José Saramago , 15 5 Diario 1921 , 16 5 Sabuxo , 17 5 Tour de Francia 2006 , 18 5 A homosexualidade na historia , 19 5 Nordés (vento) , 20 5 Bugs Bunny , 21 5 Dose letal media , 22 5 Brian Joubert , 23 5 Alto alemánico , 24 5 Servizo Galego de Saúde , 25 5 Cambados

jul 2010: 1 6 Nigel Short , 2 6 Mundial de Fútbol de 2010 , 3 6 Xabi Alonso , 4 6 Vieiros (xornal) , 5 6 Historia da lingua galega , 6 5 Xesús Palmou , 7 5 Diego López Rodríguez , 8 5 Selena , 9 5 Francisco Asorey , 10 5 Reino de Galicia , 11 5 Deportivo da Coruña , 12 4 Caxato de Asclepio , 13 4 Telemadrid SAT , 14 4 Avaliación ambiental estratéxica , 15 4 Parque do Pasatempo , 16 4 Vitalismo , 17 4 Lêdo Ivo , 18 4 Annales Regni Francorum , 19 4 Vita Karoli Magni , 20 4 A Relíquia , 21 4 O Mandarim , 22 4 Roberto Fernández Alvarellos , 23 4 Kiko da Silva , 24 4 Juan Velasco Alvarado , 25 4 Mundial de Fútbol de 2010 - Final

ago 2010: 1 6 Trastorno por déficit de atención con hiperactividade , 2 6 Historia da lingua galega , 3 5 CNN+ , 4 5 Léxico da Galiza , 5 5 António Livramento , 6 5 Casi ángeles , 7 5 Schnauzer , 8 5 Hórreo galego , 9 5 Manu Chao , 10 5 Masaru Emoto , 11 4 BBC HD , 12 4 Mediaset España Comunicación , 13 4 Xerox Corporation , 14 4 Just Dance , 15 4 Endofenotipo , 16 4 Técnica de dominación , 17 4 Fernando Avecilla Porto , 18 4 Cuac FM , 19 4 Växjö , 20 4 Anxo Lorenzo , 21 4 Francisco Franco , 22 4 José Manuel Otero Novas , 23 4 Miticultura , 24 4 Pene , 25 4 Aves

set 2010: 1 9 Ana Kiro , 2 6 Xapón , 3 5 0 de xaneiro , 4 5 Freixo de folla estreita , 5 5 José Antonio Labordeta , 6 5 Arman , 7 5 Reino de Galicia , 8 5 Historia de Galicia , 9 5 Alfonso Daniel Rodríguez Castelao , 10 4 Premio COAG de Arquitectura , 11 4 Tomás Legido Sánchez , 12 4 Chema Gagino , 13 4 Monicreque (Internet) , 14 4 Manuel Oliveira Blanco , 15 4 Xosé Oliveira Blanco , 16 4 A Duquesa da rúa do Duque , 17 4 Alfonso Armada Rodríguez , 18 4 Diáspora galega , 19 4 IB3 Televisió , 20 4 Begoña Paz , 21 4 Templo de Santalla de Bóveda , 22 4 Anselmo López Carreira , 23 4 Raúl García Carnero , 24 4 Hórreo galego , 25 4 Diego Tristán

out 2010: 1 6 Tradución automática , 2 6 Bicicleta , 3 6 Lugo , 4 6 España , 5 5 Universidade de Oviedo , 6 5 Vocabulario Científico Internacional , 7 5 Giovanni Pierluigi da Palestrina , 8 5 Luis Caruncho , 9 5 Terra Eo-Navia , 10 5 Serea , 11 5 Galicia , 12 5 Arte , 13 4 Plotino , 14 4 Husqvarna , 15 4 Denominación común internacional , 16 4 Google Translate , 17 4 Qüestió de noms , 18 4 Blanca Andreu , 19 4 Xosé Iglesias Roura , 20 4 Olaf Haraldsson , 21 4 Biffy Clyro , 22 4 Escudo de Navarra , 23 4 Alexandre Deulofeu , 24 4 Serxio Pazos , 25 4 Néstor Kirchner

nov 2010: 1 6 Abella , 2 6 Deportivo da Coruña , 3 5 Antoni van Leeuwenhoek , 4 5 Conflito en Río de Xaneiro en novembro de 2010 , 5 5 Google Translate , 6 5 Futebol Clube do Porto , 7 5 Wikipedia en éuscaro , 8 5 Francisco Martínez Bouzas , 9 5 Costa da Morte , 10 5 Lugo , 11 4 Ponte Carreira, Gafoi, Frades , 12 4 Coroa de marqués , 13 4 Goenkale , 14 4 Emanuel Bouzon , 15 4 Sporting Clube de Portugal , 16 4 Concilio de Lugo , 17 4 Circuncisión , 18 4 Xinzo de Limia , 19 4 Baiona , 20 4 Lingua catalá , 21 4 Historia de Galicia , 22 3 Luis Cadarso Rey , 23 3 Josep Anglada , 24 3 Joan Puigcercós , 25 3 Eleccións ao Parlamento de Cataluña 2010

dez 2010: 1 9 Reino de Galicia , 2 6 Naked Lunch , 3 6 O Nadal na cultura popular galega , 4 5 Diadema de Moñes , 5 5 Marcos Valcárcel , 6 4 Crise económica de 2008-2013 , 7 4 Federico Guillerme II de Prusia , 8 4 Sufismo , 9 4 Pilar Rojo , 10 4 Proba matemática , 11 4 Mahabharata , 12 4 Imre Lakatos , 13 4 Santi Domínguez , 14 4 Guerra anglo-española de 1585-1604 , 15 4 New World Translation of the Holy Scriptures , 16 4 John Draper , 17 4 Novacaixagalicia , 18 4 Eleccións ao Parlamento de Cataluña 2010 , 19 4 Zimnie zametki o letnikh vpechlatleniyakh , 20 4 Castelo de Pambre , 21 4 Saudade , 22 4 Xabier Lete , 23 4 Castelo, Culleredo , 24 4 Bacallau , 25 4 Universidade da Coruña

jan 2011: 1 9 España , 2 7 Reino de Galicia , 3 7 Lugo , 4 6 Abioxénese , 5 6 Juan López Mella , 6 6 Vaca , 7 5 Daniel Day-Lewis , 8 5 Álvaro Negredo , 9 5 Jan Baptista van Helmont , 10 5 Tetractis , 11 5 Rally Dakar , 12 4 Blanca-Ana Roig , 13 4 Plauto , 14 4 Xardín Botánico de Mérida , 15 4 Tauromaquia , 16 4 Efecto Ferranti , 17 4 Guillermina I dos Países Baixos , 18 4 Capela de San Miguel de Ribadeo , 19 4 Acueduto de Lugo , 20 4 Mosteiro de San Pedro de Rocas , 21 4 Volkswagen Race Touareg , 22 4 Antoni van Leeuwenhoek , 23 4 Teoría da xeración espontánea , 24 4 Antonio Rodríguez Salvador , 25 4 Estado soberano

fev 2011: 1 7 2011 , 2 6 Castro de Burela , 3 6 Proxecto Galicia , 4 5 Antonio Risco , 5 5 Movemento do deseño intelixente , 6 5 Viktor Frankl , 7 5 Manuel García Blanco , 8 5 Deseño intelixente , 9 5 Lucía Pérez , 10 5 Viveiro , 11 4 José María Ruiz-Mateos , 12 4 Zapatones , 13 4 Peekskill, Nova York , 14 4 Bateas (equipo de billarda) , 15 4 Audiencia (medios de comunicación) , 16 4 Universidade Aberta , 17 4 La Regenta , 18 4 Paul Newman , 19 4 In the Name of the Father , 20 4 Lei de Fourier , 21 4 Escorras , 22 4 Nicole (cantante chilena) , 23 4 Xosé Oliveira Blanco , 24 4 Fútbol Club Barcelona , 25 4 Apalpador

mar 2011: 1 11 Terremoto e tsunami de Sendai de 2011 , 2 6 Praza de touros de Pontevedra , 3 6 Justin Bieber , 4 6 Manuel Oliveira Blanco , 5 6 Club Deportivo Lugo , 6 5 Torre de Bermúdez , 7 5 O chícharo psicótico , 8 5 José Fernández Canosa , 9 5 Fungato , 10 5 Parrocha , 11 5 Casnadagaia, San Mamede de Urrós, Allariz , 12 5 MagicValongo , 13 5 Sintetizador analóxico , 14 5 The Rescuers , 15 5 Charlotte's Web 2: Wilbur's Great Adventure , 16 5 Carlos Callón , 17 5 Catedral de Santiago de Compostela , 18 5 España , 19 4 Anne Philipe , 20 4 Diari Ara , 21 4 Juanjo Liñares , 22 4 Umami , 23 4 Diário Liberdade , 24 4 Rumble Fish , 25 4 Dionisio o Exiguo

abr 2011: 1 17 Barcelona , 2 10 Lois Pereiro , 3 9 Airas Bispo , 4 7 Historia da ciencia , 5 7 Wikipedia en éuscaro , 6 7 Ciencia , 7 6 Lista de monumentos da provincia de Pontevedra , 8 5 Río Corgo, río Sarela , 9 5 The Rescuers , 10 5 Luís Fábrega Coello , 11 4 Semana Santa de Viveiro , 12 4 Real Academia de Medicina e Cirurxía de Galicia , 13 4 Braña (revista) , 14 4 Grupo prostético , 15 4 Decrecemento , 16 4 Músculo pectoral menor , 17 4 Músculo subclavio , 18 4 Músculo pectoral maior , 19 4 Músculo redondo menor , 20 4 Comisario Maigret , 21 4 Hindi de Fidxi , 22 4 Ánxela Loureiro , 23 4 Demografía de Serbia , 24 4 Arte da antigüidade , 25 4 Manuel Antonio

mai 2011: 1 8 Lois Pereiro , 2 7 Luís Fábrega Coello , 3 7 Festival de Eurovisión 2011 , 4 7 G , 5 6 J. R. R. Tolkien , 6 6 H , 7 5 Nóumeno , 8 5 Droga de deseño , 9 5 Justin Bieber , 10 5 Deportivo da Coruña , 11 5 Galipedia , 12 4 Fracción , 13 4 Margaret Levi , 14 4 Evanxeo de Marcos , 15 4 Fenómeno , 16 4 José Luis Vázquez Vázquez , 17 4 Toxicoloxía do tabaco , 18 4 Declaración de Independencia dos Estados Unidos de América , 19 4 Liga de Campións da UEFA 2010-11 , 20 4 A Casiña, Arcos, Cuntis , 21 4 Converxencia 21 , 22 4 Lista de filmes con versión en galego , 23 4 Osama bin Laden , 24 4 España , 25 4 Ciencia

jun 2011: 1 5 Xinzo da Costa, Vilardecás, Maceda , 2 5 Manolo Otero , 3 5 Málaga Club de Fútbol , 4 5 Valentín Paz-Andrade , 5 5 Real Club Celta de Vigo , 6 5 Real Madrid Club de Fútbol , 7 4 Adolfo Muíños , 8 4 Historia da enfermaría , 9 4 Timgad , 10 4 Like a Rolling Stone , 11 4 Real Academia Galega de Belas Artes , 12 4 Universidade do Bío-Bío , 13 4 Mario Draghi , 14 4 Historia da cirurxía , 15 4 Lista de monumentos da provincia de Pontevedra , 16 4 Vía Televisión , 17 4 Alzamento de Pascua , 18 4 Xosé Fernández Ferreiro , 19 4 Ortiga , 20 4 Vilaboa, Valdoviño , 21 4 Canción do verán , 22 4 República Checa , 23 3 Grilo ceboleiro , 24 3 Ciclo celular , 25 3 Xeriatría

jul 2011: 1 6 Códice Calixtino , 2 5 Hipótese do mundo de ARN , 3 4 Eudoxo de Cnido , 4 4 H2O: Just Add Water , 5 4 Sociedade Deportiva Compostela , 6 4 2011 , 7 4 Vaca , 8 4 Deportivo da Coruña , 9 4 España , 10 3 Maret , 11 3 Plott hound , 12 3 Elementos de Euclides , 13 3 Pilar Prades , 14 3 Manuel Pérez Martínez \"Arenas\" , 15 3 Thomas J. Clarke , 16 3 Almaxesto , 17 3 Principio de Arquímedes , 18 3 Impulso (aerodinámica) , 19 3 Papiro Ebers , 20 3 ONCE , 21 3 Zhang Heng , 22 3 Willard Van Orman Quine , 23 3 La Plata , 24 3 Grupo Martín Códax , 25 3 ASSET

ago 2011: 1 6 Alejandro Tobar , 2 6 Catedral de Santiago de Compostela , 3 5 Historia da ciencia , 4 4 Panteón , 5 4 Solución (homónimos) , 6 4 KrioRus , 7 4 Mito da caverna , 8 4 Aparato , 9 4 Anthony Mann , 10 4 James Cameron's Avatar: The Game , 11 4 Dólar , 12 4 Ciencia , 13 3 Mestrado en administración de negocios , 14 3 Grupo Losán , 15 3 Taboleiro de madeira , 16 3 Sonoridade , 17 3 Mitoloxía galega , 18 3 Panteón (mitoloxía) , 19 3 Kevin Spacey , 20 3 Cadáver , 21 3 Antropometría , 22 3 Phoebe Tonkin , 23 3 Encoro do Eume , 24 3 Progresividade , 25 3 Tumultos en Inglaterra en 2011

set 2011: 1 5 Síndrome do aceite tóxico , 2 5 Lista de monumentos da provincia da Coruña , 3 5 Copa do Mundo de Rugby 2011 , 4 5 Traballo , 5 5 Pontevedra , 6 5 A Coruña , 7 4 Talófitas , 8 4 Pedro Benavente , 9 4 Nabo , 10 4 Cristino Álvarez Herrera , 11 4 Paciños, Requeixo de Valverde, Allariz , 12 4 Maguncia , 13 4 Illa da Toxa , 14 4 Paco Martín , 15 4 Estatuto de autonomía de Galicia de 1936 , 16 4 Nacións celtas , 17 4 Freddie Mercury , 18 4 Castrelo de Miño , 19 4 Reino de Galicia , 20 4 Vigo , 21 4 Ciencia , 22 3 Evencio Ferrero Rodríguez , 23 3 García Rodríguez de Valcarce , 24 3 Ángel Sobral , 25 3 A Nosa Terra (1977)

out 2011: 1 8 Fútbol Club Barcelona , 2 8 Valentín Paz-Andrade , 3 6 Estatuto de autonomía de Galicia de 1936 , 4 6 Vigo , 5 5 Victorious , 6 5 Kesha , 7 5 Extremo , 8 5 Steve Jobs , 9 4 Alcazaba , 10 4 Aurelio Joaniquet Extremo , 11 4 Extremo, Arcos de Valdevez , 12 4 In extremis , 13 4 Colexio Compañía de María de Santiago de Compostela , 14 4 Crioxenia , 15 4 Criopreservación , 16 4 Carlos Otero Díaz , 17 4 Muamar al-Qadafi , 18 4 Nomenclatura das unidades territoriais estatísticas , 19 4 Lingua lígur (románica) , 20 4 Red Bull Racing , 21 4 Pantón , 22 4 A Pobra do Brollón , 23 4 Pontedeume , 24 4 Outeiro de Rei , 25 4 As Pontes de García Rodríguez

nov 2011: 1 7 Xesús Constela , 2 7 Estatuto de autonomía de Galicia de 1936 , 3 6 Alzamento de Pascua , 4 6 Samaín , 5 5 Fernando Mosquera Martínez , 6 5 Black Sabbath , 7 4 Suxestopedia , 8 4 Francisco Candeira , 9 4 Libro das alquimias , 10 4 As humanas proporcións , 11 4 Músculo dorsal ancho , 12 4 Severiano Martínez Anido , 13 4 Acelular , 14 4 Exposición Internacional de París de 1937 , 15 4 Olláparo (revista) , 16 4 Guernica (cadro) , 17 4 Eleccións xerais de España de 2011 , 18 4 Fernando Díaz-Castroverde , 19 4 Cidade da Cultura de Galicia , 20 4 2011 , 21 4 Roi Xordo , 22 4 Pedro Madruga , 23 4 Catedral de Santiago de Compostela , 24 4 11 de novembro , 25 4 Galipedia

dez 2011: 1 7 Real Club Celta de Vigo , 2 6 Valentín Paz-Andrade , 3 6 Lugo , 4 5 Vea cubital , 5 5 Mitoloxía galega , 6 5 Complexo dunar de Corrubedo e lagoas de Carregal e Vixán , 7 5 The Strokes , 8 5 Cortegada , 9 4 Is This It , 10 4 Room on Fire , 11 4 Angles , 12 4 Vea basílica , 13 4 Vea mediana cubital , 14 4 Volta a Burgos , 15 4 Discografía de The Strokes , 16 4 Julian Casablancas , 17 4 Arteria axilar , 18 4 Fraga , 19 4 A Ribeira , 20 4 Miguel Tranquilo , 21 4 Lista de senadores galegos desde a Transición , 22 4 Resistência Galega , 23 4 Segunda República Española , 24 4 Universidade de Santiago de Compostela , 25 4 Álvaro Cunqueiro

jan 2012: 1 9 Manuel Fraga , 2 8 Isaac Díaz Pardo , 3 6 Valentín Paz-Andrade , 4 6 Slash , 5 6 Reino de Galicia , 6 5 Parabola GNU/Linux-libre , 7 5 Unión Club Cee , 8 5 Historia de Europa , 9 5 Historia dos eslavos do sur , 10 5 Alzamento de Pascua , 11 5 Nación constituínte , 12 5 Castro Caldelas , 13 5 Lugo , 14 4 Crédito académico , 15 4 Ratatouille , 16 4 Annam , 17 4 Indochina , 18 4 Antípodas , 19 4 Castas (hinduísmo) , 20 4 Raza aria , 21 4 José Domingo Cipriano Oreiro , 22 4 Liña ecuatorial , 23 4 Matrimonio entre persoas do mesmo sexo en España , 24 4 Montserrat Caballé , 25 4 Reggaeton

fev 2012: 1 8 Galería de imaxes de casas dos concellos de Galicia , 2 5 Adele , 3 5 Pecado , 4 5 Wikilusa , 5 5 Praza Pública , 6 5 Centro Oncolóxico de Galicia , 7 5 Reggaeton , 8 4 Angrois, Sar, Santiago de Compostela , 9 4 Ty Segall , 10 4 Deposición de Cristo , 11 4 Moncef Marzouki , 12 4 Feliciano Barrera , 13 4 Estevo Dragutin , 14 4 Sergio Álvarez Moya , 15 4 Parador de turismo , 16 4 Emilio Alonso Paz , 17 4 Segunda división española 2011/12 , 18 4 Primeira división española 2011/12 , 19 4 Día da Candeloria , 20 4 Millennium Centar , 21 4 Libertalia , 22 4 Xetafe , 23 4 Castromao, A Veiga , 24 4 Morte , 25 4 Dozón

mar 2012: 1 8 Juan Antonio Posse , 2 7 Monbus , 3 7 Galería de imaxes de casas dos concellos de Galicia , 4 6 Que fermoso é vivir , 5 6 Frank Capra , 6 6 Ética para o meu fillo , 7 6 Ricardo Mella Serrano , 8 6 O señor das moscas (novela) , 9 6 Cristianismo , 10 5 Mitos platónicos , 11 5 The Fear of Freedom , 12 5 La peste , 13 5 Der Steppenwolf , 14 5 Antíxeno , 15 5 Alicia do outro lado do espello , 16 5 La philosophie expliquée à ma fille , 17 5 Podoloxía , 18 5 Podólogo , 19 5 Colorimetría , 20 5 A Pobra do Brollón , 21 5 Partido Nacionalista Galego-Partido Galeguista , 22 5 Alemaña , 23 5 A Coruña , 24 5 Vigo , 25 4 Leite Río

abr 2012: 1 6 Dominio de Internet , 2 6 The Lost Thing , 3 6 Facultade das Ciencias Económicas e Empresariais de Santiago de Compostela , 4 6 Galería de imaxes de casas dos concellos de Galicia , 5 6 Gerardo Conde Roa , 6 6 Ponte, Silleda , 7 5 Clero , 8 5 Festival de teatro grecolatino de Lugo , 9 5 The Red Tree , 10 5 Xesús Veiga , 11 5 Abella raíña , 12 5 Valentín Paz-Andrade , 13 5 Fernando VII , 14 5 Fragas do Eume , 15 4 Corinna zu Sayn-Wittgenstein , 16 4 Los Fresones Rebeldes , 17 4 Jeff Koons , 18 4 Sémele , 19 4 Ángel Currás Fernández , 20 4 .am , 21 4 .at , 22 4 .au , 23 4 Cows, Pigs, Wars and Witches , 24 4 Banda Artística de Merza , 25 4 Hiperpaxinación

mai 2012: 1 9 Valentín Paz-Andrade , 2 7 A arañeira de Charlotte , 3 6 Outono Fotográfico , 4 6 Victorious , 5 6 Vaca , 6 6 Ácido desoxirribonucleico , 7 6 Francia , 8 5 Chain of Responsibility (padrón de deseño) , 9 5 Álex Lombardero , 10 5 José Juan Figueras , 11 5 Borja Golán , 12 5 CB Estudiantes , 13 5 Barreiros (automoción) , 14 5 Vigo , 15 4 Manuel Allendesalazar Muñoz , 16 4 Memento (padrón de deseño) , 17 4 Facade (padrón de deseño) , 18 4 Macronutriente , 19 4 Strategy (padrón de deseño) , 20 4 Tella (construción) , 21 4 José Vega , 22 4 Composite (padrón de deseño) , 23 4 Laura del Río García , 24 4 Factory Method (padrón de deseño) , 25 4 François Hollande

jun 2012: 1 9 José Muíño Domínguez , 2 9 Real Club Celta de Vigo , 3 7 Vaca , 4 6 Ángel Carballeira Rego , 5 6 Compromiso por Galicia , 6 6 Eurocopa de Fútbol Polonia/Ucraína 2012 , 7 6 Roberto Vidal Bolaño , 8 5 Txetxu Rojo , 9 5 O Ciprianillo , 10 5 Manuel Preciado , 11 5 Joaquín Sabina , 12 5 O Grove , 13 5 A Coruña , 14 5 Galicia , 15 5 Deportivo da Coruña , 16 4 Carlos Vila Varela , 17 4 Marineda City , 18 4 Ismail Qemali , 19 4 Festa do Esquecemento , 20 4 Concurso de Cultura Clásica Odisea , 21 4 Andrés Balsa , 22 4 Carlos Aimar , 23 4 Nisargadatta Maharaj , 24 4 Vime , 25 4 Javier Maté

jul 2012: 1 9 A Coruña , 2 7 Códice Calixtino , 3 6 Arduino , 4 6 Museo Nacional de Ciencia e Tecnoloxía , 5 6 Marineda City , 6 5 Plásticos Ferro , 7 5 Eurocopa de Fútbol Polonia/Ucraína 2012 , 8 5 Estrella Galicia , 9 5 Zlatan Ibrahimović , 10 5 Roberto Vidal Bolaño , 11 5 Historia da lingua galega , 12 5 Real Academia Galega , 13 4 Polpa de remolacha , 14 4 Zona económica exclusiva , 15 4 O Gran Burato , 16 4 Refinería da Coruña , 17 4 Galegos nos Xogos Olímpicos de 2012 , 18 4 Alén de Ancos , 19 4 Castromil (autocares) , 20 4 Quempallou (álbum) , 21 4 A Chousa Nova , 22 4 Concentración parcelaria , 23 4 Francisco Doblas , 24 4 Postojna , 25 4 Kumrovec

ago 2012: 1 7 Chavela Vargas , 2 6 Galegos nos Xogos Olímpicos de 2012 , 3 6 Rocío Jurado , 4 6 Gato , 5 5 Manuela Santalla , 6 5 Mireia Belmonte , 7 5 Décatlon , 8 5 Caso do metílico , 9 5 Lobos de Arga , 10 5 Támara Echegoyen , 11 5 Aborixes australianos , 12 5 Sancho Gracia , 13 5 Xogos Olímpicos de 2012 , 14 5 Lista de medallistas olímpicos galegos , 15 5 David Cal , 16 5 Galicia , 17 4 Conservatorio profesional de música de Santiago de Compostela , 18 4 A Vilerma, Maside, Sarria , 19 4 O Souto, Xinzo, Ponteareas , 20 4 Rata negra , 21 4 El Telegrama , 22 4 Lee See-young , 23 4 Hóspede , 24 4 Penso (alimento) , 25 4 Encoro das Tres Gargantas

set 2012: 1 11 Eleccións ao Parlamento de Galicia 2012 , 2 7 Anova - Irmandade Nacionalista , 3 5 José Calavera Ruiz , 4 5 Caso do metílico , 5 5 Ribadeo , 6 4 Elena Filatova , 7 4 Canón de pau , 8 4 Cadea , 9 4 Adolfo Domínguez Otero , 10 4 Sitio paleontolóxico de Ediacara , 11 4 Compromiso por Galicia , 12 4 Galería de imaxes de casas dos concellos de Galicia , 13 4 Francisco Jorquera , 14 4 Narciso Heredia Begines de los Ríos , 15 4 Esperanza Aguirre , 16 4 Toponimia , 17 4 Adolf Hitler , 18 4 Pontevedra , 19 3 Scórpio , 20 3 Pilar de Lara , 21 3 Parra virxe , 22 3 FSC , 23 3 Coca (mitoloxía) , 24 3 Rosario (cristianismo) , 25 3 Francisco Rodríguez

out 2012: 1 8 Prestige , 2 7 Alternativa Galega de Esquerda , 3 6 Shinya Yamanaka , 4 6 Eleccións ao Parlamento de Galicia 2012 , 5 6 Samaín , 6 6 Praga , 7 5 Ivano Balić , 8 5 Xoel Yáñez , 9 5 Aulas de hospitalidade , 10 5 Joseph Lancaster , 11 5 Mariana Expósito , 12 5 Historia de Lugo , 13 5 Cataluña , 14 4 Microsoft Word , 15 4 Walter Model , 16 4 Sociedad Española de Ornitología , 17 4 Xosé Silva Martínez , 18 4 Amber Heard , 19 4 Santillana , 20 4 Ancylomenes pedersoni , 21 4 Madame Tussauds , 22 4 Jean Denys Cochin , 23 4 Tero Pitkämäki , 24 4 Joshua Redman , 25 4 Angus Young

nov 2012: 1 6 Praga , 2 6 Real Club Celta de Vigo , 3 5 Miña terra galega , 4 5 Pussy Riot , 5 5 Grosso modo , 6 5 Etcétera , 7 5 Gato , 8 5 Prestige , 9 4 Xardinaxe , 10 4 Françoise Hardy , 11 4 Das Kapital (grupo) , 12 4 Joaquín Queizán Taboada , 13 4 Don't Forget , 14 4 Lagoa de Caque , 15 4 Lucrecia , 16 4 Galicia Confidencial , 17 4 Manuel Rodríguez Pazó , 18 4 Pablo González Couñago , 19 4 Ex cathedra , 20 4 Ex aequo , 21 4 Exempli gratia , 22 4 Et cetera , 23 4 Carly Rae Jepsen , 24 4 Salvador García-Bodaño , 25 4 Tony Leblanc

dez 2012: 1 5 Andrea Iannone , 2 5 Sébastien Loeb , 3 5 2012 , 4 4 Carlos Piñeiro (piloto) , 5 4 The Hobbit: An Unexpected Journey , 6 4 Mar de Arousa , 7 4 Oriol Junqueras , 8 4 Yolanda López López , 9 4 Miguel Aleksandrovich Romanov , 10 4 Manuel Rodríguez López , 11 4 Xesta , 12 4 Campo , 13 4 Universidade de Santiago de Compostela , 14 4 Selección de fútbol de Galicia , 15 4 18 de decembro , 16 4 23 de decembro , 17 4 7 de decembro , 18 3 IES Santa Irene , 19 3 El Luís , 20 3 Samba Martine , 21 3 Arriba , 22 3 Briga , 23 3 Igrexa de Santiago de Breixa , 24 3 A Copa do Castro , 25 3 Arma de fogo

jan 2013: 1 6 The Beatles , 2 6 Santa Cruz de Moeche, Moeche , 3 4 CEIP de Randufe , 4 4 Princesa Sherezade , 5 4 Corrosión , 6 4 ITER , 7 4 Benni McCarthy , 8 4 Sonthonnax-la-Montagne , 9 4 Saint-Martin-du-Mont, Ain , 10 4 Saint-Germain-les-Paroisses , 11 4 Saint-Denis-lès-Bourg , 12 4 Le Petit-Abergement , 13 4 Pérouges , 14 4 Neuville-les-Dames , 15 4 L'Abergement-Clémenciat , 16 4 York , 17 4 Arata Isozaki , 18 4 Las Grecas , 19 4 José Posada , 20 4 Enrique Peña Nieto , 21 4 Brais González Pérez , 22 4 Endovelico , 23 4 Elvira Ribeiro Tobío , 24 4 RMS Titanic , 25 4 Pedroso, Narón

fev 2013: 1 8 A Coruña , 2 8 España , 3 7 Noli me tangere , 4 7 Mecos FG Ogrobe , 5 6 Víctor Campio Pereira , 6 5 Memento mori , 7 5 In vitro , 8 5 V de Vendetta (filme) , 9 5 Zanfona , 10 5 Santa Cruz de Moeche, Moeche , 11 5 Bieito XVI, papa , 12 5 Neda , 13 4 Silencio (música) , 14 4 Galería de imaxes de Cabalar, A Capela , 15 4 In vino veritas , 16 4 Paul Virilio , 17 4 Ens Públic de Radiotelevisió de les Illes Balears , 18 4 Chula Vista , 19 4 Malnutrición , 20 4 Popular Televisión Galicia , 21 4 Tucson , 22 4 RMS Titanic , 23 4 Samieira, Poio , 24 4 Cabalar, A Capela , 25 4 Galipedia

mar 2013: 1 11 Francisco, papa , 2 10 Real Club Celta de Vigo , 3 6 Bono lixo , 4 6 Skyranger , 5 5 Arne Næss , 6 5 Manuel Barreiro Núñez , 7 5 Lenin , 8 5 Galipedia , 9 4 Explosivo , 10 4 Rinoceronte laúdo , 11 4 Ramón Santamarina , 12 4 EMedicine , 13 4 Django Unchained , 14 4 O divino sainete , 15 4 Catania , 16 4 Caldas de Luna , 17 4 Kelley Deal , 18 4 Morte digna , 19 4 Fontes de información , 20 4 Partitura , 21 4 Escribenta riscada , 22 4 Caraveleira , 23 4 Asociación de Técnicos de Informática , 24 4 Refuxio de Sigüeiro , 25 4 Santiago Cortegoso

abr 2013: 1 7 Historia de Serbia , 2 7 Alemaña , 3 6 Si vis pacem, para bellum , 4 6 Sequoia xigante , 5 6 Lista de xefes de estado de México , 6 6 Lenin , 7 5 Escola Superior de Conservación e Restauración de Bens Culturais de Galicia , 8 5 Conservación e restauración , 9 5 Andrea Motis , 10 5 Seixo Branco , 11 5 Mexicas , 12 5 Demi (álbum) , 13 5 Vox populi , 14 5 Ruínas de San Domingos , 15 5 Historia da ciencia , 16 5 Margaret Thatcher , 17 5 Real Club Celta de Vigo , 18 4 Contactor , 19 4 Maj Sjöwall , 20 4 Narcose de nitróxeno , 21 4 Avanti! (filme) , 22 4 Gladys Vázquez Montes , 23 4 Nocilla , 24 4 Mazarico chiador , 25 4 José Miguel de Barandiarán

mai 2013: 1 7 Roberto Vidal Bolaño , 2 6 Coursera , 3 6 Seúl , 4 5 Ramón Garrido Vidal , 5 5 Niño y Pistola , 6 5 Casa dos Austria , 7 5 Francisco de Goya , 8 5 Londres , 9 5 Devesa , 10 5 Gato , 11 4 Festa da filloa de Muimenta , 12 4 Senén Bernárdez Ferrán , 13 4 Luciano García Alén , 14 4 Narcotráfico , 15 4 Canón Dora , 16 4 Praia dos Cristais , 17 4 Estela Estévez Barreiro , 18 4 Reiki , 19 4 Asanas , 20 4 Pedro de Betancur , 21 4 Giro de Italia 2013 , 22 4 Kaʻiulani , 23 4 Historia de Serbia , 24 4 Beixo , 25 4 Nikos Galis

jun 2013: 1 8 Xosé María Díaz Castro , 2 7 Real Club Celta de Vigo , 3 6 Oza-Cesuras , 4 6 Primeira división española 2012/13 , 5 6 Iago Aspas , 6 6 Celso Emilio Ferreiro , 7 5 Xosé Manuel Olveira \"Pico\" , 8 5 Vitoria , 9 5 Oza, Oza-Cesuras , 10 5 Kinshasa , 11 5 Concello de Cesuras , 12 5 Oviedo , 13 5 Moscova , 14 5 A Coruña , 15 5 Galicia , 16 5 Athletic Club , 17 5 Prestige , 18 4 Xeración de electricidade , 19 4 Singapur , 20 4 Gran Premio do Reino Unido de 2013 , 21 4 Orquestra Olympus , 22 4 Árbores senlleiras de Galicia , 23 4 José Solchaga Zala , 24 4 Parque de Castrelos , 25 4 Primeira división española 2013/14

jul 2013: 1 13 Catedral de Santiago de Compostela , 2 8 Accidente de Angrois , 3 7 Santiago de Compostela , 4 5 Suárbol , 5 5 Valouta , 6 5 Cataluña , 7 5 Galicia , 8 5 Real Club Celta de Vigo , 9 4 Sorbeira, Candín , 10 4 Vilarbón , 11 4 Jurbarkas , 12 4 Veni, Sancte Spiritus , 13 4 Amerindia , 14 4 William Elford Leach , 15 4 Gran Premio de Hungría de 2013 , 16 4 Anser , 17 4 Tristan und Isolde , 18 4 2013 , 19 4 Leite desnatado , 20 4 Catedral de Tui , 21 4 Museo Catedralicio de Santiago de Compostela , 22 4 Leite , 23 4 Florencia , 24 4 Edimburgo , 25 4 Brasilia

ago 2013: 1 8 Tristan und Isolde , 2 7 Catedral de Santiago de Compostela , 3 6 Rosalía Mera , 4 5 Mosteiros e conventos de Galicia , 5 5 Figueroa, Abegondo , 6 5 Pontedeume , 7 5 Vigo , 8 4 Liga Galega de Fútbol Gaélico 7 contra 7 , 9 4 Accidente de Angrois , 10 4 As Córneas, San Salvador de Asma, Chantada , 11 4 Sarandós, Abegondo , 12 4 Kama Sutra , 13 4 Oia , 14 4 Redondela , 15 4 O Grove , 16 4 Leonardo da Vinci , 17 4 Deportivo da Coruña , 18 3 Castro da Roda , 19 3 Castro de Boado , 20 3 Cono de violación , 21 3 Eva Almazán , 22 3 Orde sacerdotal , 23 3 Río Gobia , 24 3 Río Barcés , 25 3 Ricardo de Barreiro

set 2013: 1 6 Federación Española de Actividades Subacuáticas , 2 6 Tristan und Isolde , 3 5 Castro das Muradellas , 4 5 Cortello dos Lobos , 5 5 Cultura castrexa , 6 5 Galicia , 7 4 Francisco María Rivas Taboada , 8 4 Baleeiro , 9 4 Iria Morgade , 10 4 Igrexa de Nuestra Señora del Azogue , 11 4 Vuelta a España 2013 , 12 4 Carl Theodor Dreyer , 13 4 Automóbil de turismo , 14 4 Cephalorhynchus , 15 4 Estatua de Che Guevara en Oleiros , 16 4 Triodos Bank , 17 4 Homo floresiensis , 18 4 El Greco , 19 4 Seabra , 20 4 Candorca , 21 4 Río Mississippi , 22 4 Sarria , 23 4 Pontedeume , 24 4 Redondela , 25 4 Virus

out 2013: 1 6 Iniciativa pol Asturianu , 2 5 Electrónica dixital , 3 5 Jessica Lange , 4 5 Francisco Porto Rey , 5 5 Galicia , 6 4 Igrexa de Santa María de Goó , 7 4 Queima de libros , 8 4 Unidad Castellana , 9 4 Winnipeg (barco) , 10 4 Michael Bublé , 11 4 Mirabel , 12 4 Overclocking , 13 4 Diego San José , 14 4 Caza de baleas en Galicia , 15 4 Nacionalismo castelán , 16 4 Allo porro , 17 4 Hábeas corpus , 18 4 Fiat lux , 19 4 Caso do metílico , 20 4 Corpus delicti , 21 4 Ad libitum , 22 4 Alea iacta est , 23 4 A irmandade da uva , 24 4 Samaín , 25 4 Lou Reed

nov 2013: 1 7 SIDA , 2 5 A matanza caníbal dos garrulos lisérxicos , 3 5 Fábula , 4 5 Pelicano , 5 5 Roberto Vidal Bolaño , 6 4 Salmonete de lama , 7 4 Panda vermello , 8 4 Winx Club , 9 4 Cadros de Leonardo da Vinci , 10 4 Revolución Belga , 11 4 Halle , 12 4 Errare humanum est , 13 4 Angrois, Sar, Santiago de Compostela , 14 4 Vincent van Gogh , 15 4 Cracovia , 16 4 Bandeira de Galicia , 17 4 Estados Confederados de América , 18 4 Violín , 19 4 Pedrafita do Cebreiro , 20 4 Xosé Manuel Beiras , 21 4 Santiago de Compostela , 22 4 Galicia , 23 3 Prochlorococcus , 24 3 Susana de Italia , 25 3 Marco Español de Cualificación para a Educación Superior

dez 2013: 1 10 Nelson Mandela , 2 7 Manuel Quiroga Losada , 3 7 Redondela , 4 5 Tampa , 5 5 Ramón Cabanillas , 6 5 SIDA , 7 4 AD Fogar da Xuventude , 8 4 Símbolos monetarios , 9 4 Xosé Manuel Pacho Blanco , 10 4 Mundial de Fútbol de 2010 , 11 4 Vilariño Frío, Montederramo , 12 4 Gaita galega , 13 4 Pataca , 14 4 Martín Sarmiento , 15 3 Partido Demócrata Cristiano (Chile) , 16 3 Conserveras La Coca , 17 3 Conservatorio profesional de música Manuel Quiroga , 18 3 Raydibaum , 19 3 Pavo bravo , 20 3 Charouvía , 21 3 Parque Natural das Serras de Cazorla, Segura e Las Villas , 22 3 Festa da pataca de Coristanco , 23 3 Slackware , 24 3 Blas de Lezo , 25 3 Tux

jan 2014: 1 7 Guerras médicas , 2 7 Redondela , 3 5 Requián, Frades, A Estrada , 4 5 Will Champion , 5 5 Blas de Lezo , 6 5 Historia de Lugo , 7 5 Islay , 8 5 Illa de Ons , 9 5 Judo , 10 5 Portugal , 11 4 Xesta de Ons , 12 4 Constancia , 13 4 Thonon-les-Bains , 14 4 Florence Griffith Joyner , 15 4 Rocamadour , 16 4 Póvoa de Lanhoso , 17 4 Pedro Costa , 18 4 Brčko , 19 4 Eparquía ortodoxa rusa da Arxentina e Suramérica , 20 4 Universidade Nacional de La Plata , 21 4 Ada Colau , 22 4 Fundación Barrié , 23 4 Håkan Hellström , 24 4 Pacto Federal Castelán , 25 4 Viaduto de Madrid (Redondela)

fev 2014: 1 9 Plauto , 2 6 Galicia , 3 5 Facsímile , 4 5 Finados en 2014 , 5 5 Shirley Temple , 6 5 Vaca , 7 5 Portugal , 8 4 Monitor de estudio , 9 4 Mir , 10 4 República Soviética de Baviera , 11 4 Número transcendente , 12 4 In pectore , 13 4 Emily Dickinson , 14 4 Micetozoos , 15 4 Philip Seymour Hoffman , 16 4 Karis , 17 4 Xoán Paulo I, papa , 18 4 Redondela , 19 4 Lugo , 20 4 Gato , 21 3 Os Bolechas , 22 3 Xosé Couceiro Bugallo , 23 3 Louis-Augustin Bosc d’Antic , 24 3 Henry James , 25 3 RSI

mar 2014: 1 10 Adolfo Suárez , 2 9 Nova Zelandia , 3 6 Gubernia de Tavria , 4 6 República Popular de Crimea , 5 6 Salto de esquí , 6 6 Sebastopol , 7 6 Crimea , 8 6 Euclides , 9 5 Cabalo de mar , 10 5 Sebastian Bieniek , 11 5 Premios Mestre Mateo 2013 , 12 5 Finados en 2014 , 13 5 Aeroporto de Madrid-Barajas , 14 5 Teixeiro, Curtis, Curtis , 15 5 Iosif Stalin , 16 4 Demografía de Nova Zelandia , 17 4 Vladimir Sorokin , 18 4 Contos Estraños , 19 4 Xosé Duncan , 20 4 Swissquote , 21 4 Rus de Kiev , 22 4 Brest, Belarús , 23 4 Historia de Ucraína , 24 4 British Racing Partnership , 25 4 Marabedí

abr 2014: 1 6 Atlanta , 2 6 Xosé María Díaz Castro , 3 6 Xoán Paulo II, papa , 4 5 Coro Universitario Galego de Barcelona , 5 5 Dourado , 6 5 Krzysztof Penderecki , 7 5 Miguel-Anxo Murado , 8 5 Kenya , 9 5 Lingua inglesa , 10 4 Mateo (nome) , 11 4 Antonio López Díaz , 12 4 Ignacio , 13 4 Jorge Larraz , 14 4 Latvijas Televizija , 15 4 Mitílidos , 16 4 Tito Vilanova , 17 4 Isabel Risco , 18 4 Zoë Kravitz , 19 4 Anna Paquin , 20 4 Dalai Lama , 21 4 Naufraxios de pesqueiros galegos , 22 4 Kosovo , 23 4 Xoán XXIII, papa , 24 4 Donostia , 25 4 Xesús de Nazaret

mai 2014: 1 7 Conchita Wurst , 2 6 Sanna Nielsen , 3 6 Quero ser tua , 4 6 Pablo Iglesias Turrión , 5 5 Boliña de peluxe do embigo , 6 5 András Kállay-Saunders , 7 5 Festival de Eurovisión 2014 , 8 5 Arte de Galicia , 9 5 Festa dos maios , 10 5 Motor eléctrico , 11 5 Mondragón, Guipúscoa , 12 5 Unión Progreso y Democracia , 13 5 Máquina de corrente continua , 14 5 Australia , 15 5 A Pobra do Caramiñal , 16 4 Luís Castedo , 17 4 Válvula magnética (refrixeración) , 18 4 Lee Miller , 19 4 Compresor centrífugo , 20 4 Freaky Fortune , 21 4 Catedral de Palencia , 22 4 Trampa chinesa , 23 4 Sebalter , 24 4 Mariia Yaremchuk , 25 4 O Gran Compadre

jun 2014: 1 12 Centola , 2 8 Filipe VI de España , 3 6 Refrixerante , 4 6 Xoán Carlos I de España , 5 6 Deportivo da Coruña , 6 5 Recipiente de líquido refrixerante , 7 5 Giovanni Anselmo , 8 5 Mundial de Fútbol de 2014 , 9 5 Manuel Fraga , 10 4 Consulado (Francia) , 11 4 Miguel Veloso , 12 4 Chicago Fire Soccer Club , 13 4 Cadea humana polo dereito a decidir do País Vasco do 2014 , 14 4 Condensador multitubular , 15 4 Mamede de Capadocia , 16 4 Tubo capilar , 17 4 Compresor alternativo frigorífico , 18 4 Claude Cahun , 19 4 Pablo Iglesias Turrión , 20 4 Revista Gallega , 21 4 Baldo Ramos , 22 4 Ovidio Murguía , 23 4 Svenska hockeyligan , 24 4 Carol Henning , 25 4 Claudio Abbado

jul 2014: 1 12 Xosé Filgueira Valverde , 2 9 Real Club Celta de Vigo , 3 7 Pontedeume , 4 6 Mansour bin Zayed Al-Nahyan , 5 6 Dorothé Schubarth , 6 5 Sulaiman Al-Fahim , 7 5 Cúpula de Ferro , 8 5 Finados en 2014 , 9 5 Institucións españolas do Antigo Réxime , 10 5 Alfoz , 11 5 A Coruña , 12 4 Valdegeña , 13 4 Margarida de Inglaterra , 14 4 Mònica Oltra , 15 4 Prefixo aeronáutico , 16 4 Rafael González Villar , 17 4 Santuario Virxe da Pena de Congosto , 18 4 Amfíkleia , 19 4 Amfikleia-Elateia , 20 4 Helicicultura , 21 4 Caracol xigante africano , 22 4 Holanda (tecido) , 23 4 Lingua waray-waray , 24 4 Supreme Petroleum Council , 25 4 Manal bint Mohammed bin Rashid Al Maktoum

ago 2014: 1 6 Ébola , 2 6 Robin Williams , 3 6 Arqueas , 4 5 Época arcaica , 5 5 Sirius , 6 5 Peret , 7 4 Batumi , 8 4 Evanxeo da Verdade , 9 4 Shantala , 10 4 Liga Galega de Fútbol Gaélico , 11 4 Estefanía de Borgoña , 12 4 August Burns Red , 13 4 Cota de malla , 14 4 Architects , 15 4 Reganosa , 16 4 Selección de fútbol de Galicia , 17 4 Alfoz , 18 4 Real Club Celta de Vigo , 19 3 Ezio Flavio Bazzo , 20 3 Paio (ermitán) , 21 3 Pereion , 22 3 Liocarcinus navigator , 23 3 Chaceon , 24 3 Schangnau , 25 3 Bonet

set 2014: 1 6 Jean Sibelius , 2 5 Manuel Tomé Piñeiro , 3 4 Alcaldes de Santiago de Compostela , 4 4 Fervenza de Férveda , 5 4 Ioan Niculae , 6 4 Maurizio Malvestiti , 7 4 Salto de esquí , 8 4 Luciano García Alén , 9 4 Lista de circuítos da Fórmula 1 , 10 4 Mariano Rajoy , 11 4 Wolfgang Amadeus Mozart , 12 4 Dolmen de Dombate , 13 3 Iglú , 14 3 Gatón do Bierzo , 15 3 Alicia Estévez , 16 3 Museo Marítimo Seno de Corcubión , 17 3 Mettius Pompusianus , 18 3 Mega Top 50 , 19 3 Copa do Mundo de Rugby 2015 , 20 3 Batalla de Galicia , 21 3 Empanada berciana , 22 3 Castelo de Sarracín , 23 3 Manuel García Diéguez , 24 3 Machado , 25 3 Arco de medio punto

out 2014: 1 8 Ébola , 2 5 Igrexa da Asunción de Benafarces , 3 5 Konstantinos Argyros , 4 5 República Federal da Illa de Arousa , 5 5 Árabes , 6 5 Historia dos xudeus de Tesalónica , 7 5 Magosto , 8 4 O Monte Lourido, A Ramallosa, Nigrán , 9 4 Baía de Baiona , 10 4 Francisco Granados , 11 4 Eladio y los seres queridos , 12 4 Lorena (homónimos) , 13 4 Cruz Martínez , 14 4 Salve Regina , 15 4 Mignons , 16 4 Mosteiro de Santa María de Palazuelos , 17 4 Igrexa de Santa María do Castelo de Castronuño , 18 4 Igrexa da Asunción de Castrillo de Duero , 19 4 Ponte e calzada romana de Becilla de Valderaduey , 20 4 Igrexa de San Martiño de Aldeamayor de San Martín , 21 4 Igrexa de Santiago Apóstolo de Alcazarén , 22 4 Igrexa de Santa María de Alaejos , 23 4 Vila romana de Almenara-Puras , 24 4 Canle de Castela , 25 4 Gatón do Bierzo

nov 2014: 1 7 Le Sacre du printemps , 2 6 Cayetana Fitz-James Stuart , 3 6 Historia dos xudeus de Tesalónica , 4 6 Dodro , 5 5 Vágar (concello) , 6 5 Tomás Batuecas Marugán , 7 5 Trinity College , 8 5 Asociación Cultural Cultura do País , 9 5 Laureano Araujo , 10 4 ACUDE , 11 4 Gloria Lago , 12 4 Harry Houdini , 13 4 Cruceiro da Santísima Trindade , 14 4 Día da Ciencia en Galego , 15 4 Novosibirsk , 16 4 La sombra del pasado , 17 4 Félix Calviño , 18 4 A esmorga (filme de 2014) , 19 4 Ans de Tellado, Paleo, Carral , 20 4 Michael Douglas , 21 4 Diocese católica latina de Tui-Vigo , 22 4 Xoana de Arco , 23 4 Michael Jackson , 24 4 Vincent van Gogh , 25 4 Economía dos Estados Unidos de América

dez 2014: 1 5 Norma de repertorio , 2 5 Norma sistémica , 3 4 Flag Fen , 4 4 Mestre de Sobrado , 5 4 Vetóns , 6 4 Intersistema cultural , 7 4 Proxecto Ronsel , 8 4 José Manuel García-Margallo , 9 4 José María Solé , 10 4 Inquietude , 11 4 Vontade , 12 4 Amizade , 13 4 Emotivismo , 14 4 Xenreira , 15 4 Satisfacción , 16 4 Lusofonía , 17 4 Javier Gómez Noya , 18 4 Michelangelo , 19 4 Dodro , 20 4 Baiona , 21 3 Capitanía Xeneral de Galicia , 22 3 Curtis Axel , 23 3 A coroa de fogo , 24 3 Microscopio óptico , 25 3 Handsup

jan 2015: 1 7 Galicia , 2 5 Banda de Música Municipal de Valga , 3 5 Gia Carangi , 4 5 Mundial de Fútbol de 2010 - Fase final , 5 5 Revolución de Outubro , 6 5 Rubia galega , 7 5 Condados de Romanía , 8 5 Generalitat de Cataluña , 9 5 Galipedia , 10 4 Cyperus eragrostis , 11 4 Frances Bean Cobain , 12 4 Manuel Jiménez de Parga , 13 4 Karl Gegenbaur , 14 4 Víctor Muñoz , 15 4 Víctor Muñoz Baijón , 16 4 Serramoura , 17 4 Charlie Hebdo , 18 4 Matt Damon , 19 4 Mundial de Fútbol de 2014 , 20 4 Mundial de Fútbol de 2010 , 21 4 Unión Progreso y Democracia , 22 4 Vilarraso, Aranga , 23 4 Sudoku , 24 4 Algoritmo , 25 3 Eslovenia no Festival de Eurovisión

fev 2015: 1 8 Gato , 2 7 West Side Story (musical) , 3 7 Revolución de Outubro , 4 7 Taboada , 5 6 Afundación , 6 5 Faun , 7 5 Apóutega , 8 5 The Monochrome Set , 9 5 Sinfonía nº 8 (Sibelius) , 10 5 Silingos , 11 5 Lista de xefes de estado de México , 12 5 Ourense , 13 4 Capo , 14 4 The Pillars of the Earth , 15 4 Iana Kudriavtseva , 16 4 Abraham Olano , 17 4 Giro de Lombardía , 18 4 París-Tours , 19 4 José Antonio Hermida , 20 4 Amstel Gold Race , 21 4 Manifestación polo galego en febreiro de 2015 , 22 4 Xoaquín de Arévalo Rodríguez , 23 4 Rebeliom do Inframundo , 24 4 Castelo de Montealegre de Campos , 25 4 Teresa Rodríguez

mar 2015: 1 7 Festas Minervais , 2 6 Ramon Barnils i Folguera , 3 6 Festival de Eurovisión 2015 , 4 5 Herberto Helder , 5 5 Eclipse de Sol do 20 de marzo de 2015 , 6 5 Ibai Gómez , 7 5 Club de piragüismo Altruán de Ribadeo , 8 5 Festa dos Fachós , 9 4 Asociación Irimia , 10 4 Arsenie Boca , 11 4 Cecilia Payne-Gaposchkin , 12 4 Mar dos Argazos , 13 4 Fame Neghra , 14 4 Redes (TVE) , 15 4 Carmen Acuña , 16 4 Gwenda Thomas , 17 4 Casa Galicia de Nova York , 18 4 Jesús María Zamora , 19 4 Sam Simon , 20 4 Stana Katić , 21 4 Eleccións municipais de 2015 en Galicia , 22 4 Campionato do Mundo de Fútbol Gaélico , 23 4 CMS , 24 4 Finados en 2015 , 25 4 Eloi Caldeiro

abr 2015: 1 9 Contorna Persoal de Aprendizaxe , 2 8 Arquitectura en repositorio , 3 8 Rúa da Acibechería (Santiago de Compostela) , 4 7 Competencia dixital , 5 7 Arquitectura en pipeline , 6 7 Curación de contidos , 7 6 Eleccións municipais de 2015 en Galicia , 8 6 Rede social , 9 6 Slipknot , 10 6 Web 2.0 , 11 6 Xosé Filgueira Valverde , 12 5 Congreso da Emigración Galega , 13 5 Tallaght Stadium , 14 5 Tecnoloxía adecuada , 15 5 Arquitectura mestre-escravo , 16 5 María Francisca de Isla y Losada , 17 5 Agrupación Cultural Lóstrego , 18 4 Rescate financeiro , 19 4 Precursores , 20 4 Inscricións de Bir El Qutt , 21 4 Sistema experto , 22 4 Estrutura de datos , 23 4 Vieiros (revista) , 24 4 Instituto Galego de Información , 25 4 Lluís-Anton Baulenas

mai 2015: 1 7 Eleccións municipais de 2015 en Galicia , 2 6 Transpiración vexetal , 3 6 Fundación Rosalía de Castro , 4 6 Xosé Filgueira Valverde , 5 6 Galicia , 6 5 Compostela Aberta , 7 5 Aleida March , 8 5 Alóctono , 9 5 Carlos López García-Picos , 10 5 María do Carme Kruckenberg , 11 5 Revolución de Febreiro , 12 5 Carballo (homónimos) , 13 5 Charles Darwin , 14 5 Lingua galega , 15 4 Enrique Vázquez Lescaille , 16 4 Club Karepas , 17 4 Euphorbia ipecacuanhae , 18 4 Ipecacuaña , 19 4 Garbage plate , 20 4 Arnoglossus , 21 4 Enciclopedia Libre Universal en Español , 22 4 Módulo de Thiele , 23 4 Globo de Betanzos , 24 4 Hippoglossus hippoglossus , 25 4 Sidhe

jun 2015: 1 7 Le Sacre du printemps , 2 6 Eleccións municipais de 2015 en Galicia , 3 6 Johann Sebastian Bach , 4 5 Germán Garmendia , 5 5 Pablo Ruiz , 6 5 Rafael Nadal , 7 5 Eleccións municipais en Pontedeume , 8 5 Redondela , 9 5 Ourense , 10 5 Deportivo da Coruña , 11 4 Antonio Gómez Carneiro , 12 4 Anel de Nardó , 13 4 Code Lyoko: l'esercito dal nulla , 14 4 Code Lyoko: Il castello sotterraneo , 15 4 Tambores metálicos de Trinidad e Tobago , 16 4 Xogos Europeos de 2015 , 17 4 Bachfest Leipzig , 18 4 Liber chronicarum , 19 4 Intercambiador de calor , 20 4 Da terra asoballada , 21 4 MEO (servizo) , 22 4 CMTV , 23 4 Certeza , 24 4 Nomes da folla do piñeiro en Galicia , 25 4 Festival de Eurovisión 2015

jul 2015: 1 9 J. R. R. Tolkien , 2 8 Georg Friedrich Händel , 3 6 Asociación Galega de Fútbol Gaélico , 4 6 Xosé Neira Vilas , 5 6 Johann Sebastian Bach , 6 5 Liu Gang , 7 5 Galicia Bilingüe , 8 5 Prado, Lalín , 9 5 Michelangelo , 10 5 Velocidade da luz , 11 5 Manuel María , 12 4 Francisco Domínguez Romero , 13 4 Rocío Leira , 14 4 Falcón da raíña , 15 4 Curuxa gabián , 16 4 Amizade por correspondencia , 17 4 Fra Angelico , 18 4 Dorna FG , 19 4 Pigargo , 20 4 Michel Azama , 21 4 Smaug (xénero) , 22 4 DiSEqC , 23 4 Adonis (poeta) , 24 4 Jacob Frank , 25 4 Gastroenterite

ago 2015: 1 8 Angkor Wat , 2 7 Finados en 2015 , 3 6 Georg Friedrich Händel , 4 5 Henrique Mitchell de Paiva Couceiro , 5 5 Cristóval , 6 5 Louredo, Maside , 7 4 Maccabi Tel Aviv F.C. , 8 4 Nosa Señora de Lourdes , 9 4 Arciprestado de Montes-Mondariz , 10 4 Illa Roti , 11 4 Terra de Montes , 12 4 Explosión no porto de Tianjin , 13 4 Guarda Nacional Republicana , 14 4 Cevide , 15 4 Praia de Covas , 16 4 Praia de Areas , 17 4 Praia de Bascuas , 18 4 Alireza Panahian , 19 4 Estevo Vladislau II da Serbia , 20 4 Igrexa de San Nicolao de Portomarín , 21 4 David (Michelangelo) , 22 4 PubChem , 23 4 Xudit e Holofernes (Donatello) , 24 4 Oleiro valenciano , 25 4 As Ferrarías, A Veiga de Valcarce

set 2015: 1 10 Edward Elgar , 2 7 Carlos López García-Picos , 3 6 Angkor Wat , 4 5 The Martian , 5 5 432 Park Avenue , 6 5 Casa consistorial do Porriño , 7 5 Holguín , 8 5 Diamante mandarín , 9 5 Hospital Álvaro Cunqueiro , 10 5 Laika , 11 5 Buenos Aires , 12 4 Porta do Sol , 13 4 One World Trade Center , 14 4 Parlamento de Croacia , 15 4 Cronoloxía do descubrimento dos planetas do Sistema Solar e os seus satélites naturais , 16 4 Igrexa da Soidade de Vigo , 17 4 Colexiata de Cangas , 18 4 Ricard Terré , 19 4 ChEMBL , 20 4 Campionato europeo de baloncesto de 2015 , 21 4 New England Revolution , 22 4 Necrofaxia , 23 4 OwnCloud , 24 4 Gálea , 25 4 Vila do Bispo

out 2015: 1 10 Ribadeo , 2 8 Ácido desoxirribonucleico , 3 7 Ruta da Ría , 4 7 Svetlana Alexievich , 5 6 Cronoloxía do descubrimento dos planetas do Sistema Solar e os seus satélites naturais , 6 6 CIFP Porta da Auga , 7 6 Xirafa , 8 6 Avespa asiática , 9 6 A Coruña , 10 5 Caspar Friedrich Wolff , 11 5 Avia Veira , 12 5 Premio de poesía Avelina Valladares , 13 5 A praia dos afogados (filme) , 14 5 A praia dos afogados , 15 5 Oza, A Coruña , 16 5 Charles Darwin , 17 5 Covelas, Ribadeo , 18 4 José Barral Souto , 19 4 2014 MU69 , 20 4 Akita Inu , 21 4 Cinto de Kuiper , 22 4 Premio de Teatro Mome Varela Buxán , 23 4 Coral Polifónica de Ribadeo , 24 4 Sant'Angelo Lodigiano , 25 4 Premio xornalístico Manuel Reimóndez Portela

nov 2015: 1 9 Xosé Neira Vilas , 2 7 Eleccións xerais de España de 2015 , 3 6 Economía na Hispania romana , 4 6 Carlos Oroza , 5 5 En Marea , 6 5 Kyle XY , 7 5 Premio San Martiño de normalización lingüística , 8 5 Rocío de Frutos , 9 5 Montreal Canadiens , 10 5 Xosé Chao Rego , 11 5 Darío Villanueva , 12 5 Graba, Silleda , 13 5 Catedral de Santiago de Compostela , 14 4 Ricardo Llovo , 15 4 Urxa , 16 4 Casa do Consulado , 17 4 Xogo de mesa , 18 4 Cloruro de guar hidroxipropiltrimonio , 19 4 Antón Gómez-Reino , 20 4 Castelo de Aranga , 21 4 Teoría da Conspiración Jade Helm 15 , 22 4 Mareas cidadás , 23 4 Pingüín emperador , 24 4 Finados en 2015 , 25 4 Galiciencia

dez 2015: 1 10 Eleccións xerais de España de 2015 , 2 6 En Marea , 3 6 Erythrura gouldiae , 4 6 Preste Xoán , 5 6 Pensamento crítico , 6 6 Fauna de Ediacara , 7 5 Baixo (voz) , 8 5 Liña Ribadeo - Vilaoudriz , 9 5 Rhodospingus cruentus , 10 5 Juan Manuel , 11 5 La Philosophie dans le boudoir , 12 5 Podemos , 13 5 Historia dos xudeus de Tesalónica , 14 5 Galicia , 15 4 Lorenzo Piretto , 16 4 Platycercus eximius , 17 4 Frayre de Joy e Sor de Plaser , 18 4 A Roda, Tapia , 19 4 Sorpresa , 20 4 Chernóbil , 21 4 El Libro del cavallero Zifar , 22 4 Periquito , 23 4 Les Merveilles de Rigomer , 24 4 Aymeric Laporte , 25 4 Razoamento

jan 2016: 1 9 Galegofobia , 2 8 Escultura románica , 3 8 España , 4 7 Carles Puigdemont , 5 6 Golgona Anghel , 6 6 Edificio Itatiaia , 7 6 Certificado de estudos de lingua galega , 8 6 David Bowie , 9 5 José Julio Fernández Rodríguez , 10 5 Rachel McAdams , 11 5 Der Zauberberg , 12 5 Naturopatía , 13 5 Sos del Rey Católico , 14 5 Guillermo Lago , 15 5 Televés , 16 5 Antón Losada Diéguez , 17 5 Fragas do Eume , 18 4 Glutón , 19 4 Múon , 20 4 Chaetophractus vellerosus , 21 4 Columnas galegas , 22 4 Giovanni Battista Ramusio , 23 4 Reserva da biosfera Río Eo, Oscos e Terras de Burón , 24 4 Steam , 25 4 Hematémese

fev 2016: 1 9 Arteixo , 2 8 Xesús de Nazaret , 3 7 Israel , 4 6 IES María Sarmiento , 5 6 Xornadas de Xullo , 6 5 David Mackenzie , 7 5 Xavier Estévez Ferreiro , 8 5 Vilacide de Abaixo, Oroso, Oroso , 9 5 Veronica Guerin , 10 5 Janko Kamauf , 11 5 Celeirós, Pedrafita, A Teixeira , 12 5 Manor Racing , 13 5 Finados en 2016 , 14 5 Bloque Nacionalista Galego , 15 5 Entroido , 16 4 José Pascual López Cortón , 17 4 Le Journal d'une femme de chambre , 18 4 Campións do Aberto de Australia (individual mulleres) , 19 4 Veleučilište VERN' , 20 4 Mattsee , 21 4 Illa de San Borondón , 22 4 Parada na porta da escola , 23 4 Fuji Television , 24 4 Luís VII de Francia , 25 4 Zengi

mar 2016: 1 7 Antía Nara , 2 7 Atlanta Flames , 3 7 Ángela Ruiz Robles , 4 6 Georgii Chicherin , 5 6 As Pontes de García Rodríguez , 6 5 Lingua diula , 7 5 Carlos de la Peña , 8 5 Las Lajas, Neuquén , 9 5 Ryder Hesjedal , 10 5 Cruz do Monte, Trasmonte, Oroso , 11 5 Golpe de estado de Kornilov , 12 5 Grandes Voltas , 13 5 Audioslave , 14 5 Anxo Quintana , 15 5 Manuel María , 16 5 Bloque Nacionalista Galego , 17 5 Ada Lovelace , 18 5 Rosalía de Castro , 19 5 Galicia , 20 4 Padroado da cultura galega de México , 21 4 Airbnb , 22 4 London Palladium , 23 4 Will Ferrell , 24 4 John Deacon , 25 4 Bear Grylls

abr 2016: 1 14 Curación de contidos , 2 11 Rede social , 3 10 Competencias básicas , 4 9 Web 2.0 , 5 8 Contorna Persoal de Aprendizaxe , 6 8 Coala , 7 8 Kilimanjaro , 8 7 Competencia dixital , 9 7 Arteixo , 10 6 Boletín de Estudios del Seminario Fontán-Sarmiento de Hagiografía, Toponimia y Onomástica de Galicia , 11 6 Terra Chá (poemario) , 12 6 Krzysztof Penderecki , 13 6 Grigorii Rasputin , 14 6 Amy Winehouse , 15 6 Universidade de Vigo , 16 5 Centro Gallego de La Habana , 17 5 Jean Giraudoux , 18 5 Festas de interese turístico de Galicia , 19 5 Conflito entre Uber e os taxis , 20 5 Padroado da cultura galega de México , 21 5 Finados en 2016 , 22 5 Einojuhani Rautavaara , 23 5 Chus Lampreave , 24 5 Onésimo Redondo , 25 5 Manuel María

mai 2016: 1 7 Osíxeno , 2 5 Xornadas da Cultura Galega , 3 5 Pelegrín , 4 5 Implantes de polipropileno , 5 5 Festival de Eurovisión 2017 , 6 5 Xosé Duncan , 7 5 Camiño Francés , 8 5 Vicente Peña Saavedra , 9 5 Aborixes australianos , 10 5 Feísmo , 11 5 Coala , 12 5 Arteixo , 13 5 Día das Letras Galegas , 14 5 Xadrez , 15 4 Asistente persoal intelixente , 16 4 Rafael Cadenas , 17 4 Baxar Uarda , 18 4 Valerià Paül Carril , 19 4 Monte Alto, A Coruña , 20 4 Caldeira , 21 4 Enórmic Banda , 22 4 Compresor scroll , 23 4 Lucas Vázquez , 24 4 Arquieparquía católica caldea de Arbil , 25 4 Festival de Eurovisión Júnior 2016

jun 2016: 1 8 Eleccións xerais de España de 2016 , 2 7 Kathleen Ferrier , 3 7 Acción Integralista Brasileira , 4 5 Malandrómeda , 5 5 Partido Comunista da Federación Rusa , 6 5 Negociacións Vikzhel , 7 5 O'Brien Trophy , 8 5 Deméter , 9 5 Pedro Pablo Kuczynski , 10 5 Barcala, A Baña , 11 5 A Baña, A Baña , 12 4 Henrietta Swan Leavitt , 13 4 Curro da Valga , 14 4 Aligátor do Mississippi , 15 4 Palacio de Aquisgrán , 16 4 Estación de Liubliana , 17 4 Meme (Internet) , 18 4 Illas Senkaku , 19 4 Partido Social Nacionalista Sirio , 20 4 Microevolución , 21 4 Michał Kwiatkowski , 22 4 Cor pulmonale , 23 4 Diego Giráldez , 24 4 Prince of Wales Trophy , 25 4 Clarence S. Campbell Bowl

jul 2016: 1 8 India , 2 7 Schachnovelle (ópera) , 3 6 Atentado de Niza de 2016 , 4 6 Finados en 2016 , 5 6 Escultura da Roma antiga , 6 5 Caimán almiscreiro común , 7 5 Batalla de Carabobo (1814) , 8 5 Federación Mundial de Sociedades Galegas , 9 5 Área Metropolitana de Vigo , 10 4 Teatro romano de Mérida , 11 4 Gaetano Bresci , 12 4 La Nueva España , 13 4 Joan Ridao , 14 4 Teatro romano , 15 4 Micaela Navarro , 16 4 Manuel Valls , 17 4 Rebecca Clarke , 18 4 Desterro , 19 4 Tetrodotoxina , 20 4 Estado de Chuuk , 21 4 Depresión Meridiana , 22 4 Ragnar Sigurðsson , 23 4 Humanismo (filosofía) , 24 4 Auckland Grammar School , 25 4 Kathleen Ferrier

ago 2016: 1 11 Deportivo da Coruña , 2 6 Escultura da Roma antiga , 3 6 Richard Wagner , 4 5 Meliloto , 5 5 Ortiga morta , 6 5 Rosa de Lima , 7 5 Michele Angiolillo , 8 5 Luís Villares , 9 5 Lista de réptiles de Galicia , 10 5 Gonzalo Caballero , 11 5 Baiona , 12 4 Igrexa de Santa María do Azougue , 13 4 Bárbara Iglesias , 14 4 Anatoli Boukreev , 15 4 Sapo parteiro común , 16 4 Cadrifollo , 17 4 London Overground , 18 4 Herba da prata , 19 4 Víctor Mora , 20 4 Partido xudicial de Lalín , 21 4 Praia do Son , 22 4 Picanzo isabel , 23 4 Dique , 24 4 Irmán , 25 4 Pazo das Torres de Cereixo

set 2016: 1 16 Eleccións ao Parlamento de Galicia 2016 , 2 8 Richard Wagner , 3 7 Reparación do ADN , 4 6 Aletta Ocean , 5 6 Frankenstein ou o moderno Prometeo , 6 6 Alberto Núñez Feijóo , 7 6 Alzhéimer , 8 5 My Little Pony , 9 5 Miss Mundo , 10 5 Caimán negro , 11 5 Trindade, Goiás , 12 5 Baía de Baiona , 13 5 Porto do Son , 14 5 Castelo de Santo Antón , 15 5 India , 16 5 Florentino López Cuevillas , 17 5 Vigo , 18 5 Galicia , 19 4 Pato castaño , 20 4 Luis Álvarez Martínez , 21 4 Tancredo de Hauteville , 22 4 Vibo Valentia , 23 4 Síndrome da muller branca desaparecida , 24 4 Universidade Johns Hopkins , 25 4 Pilar Pérez Solano

out 2016: 1 9 Vigo , 2 8 Cerdedo-Cotobade , 3 8 Lei orgánica para a mellora da calidade educativa , 4 6 Miranda do Corvo , 5 6 Torre de Guimarei , 6 6 Iago Fernández , 7 6 España , 8 5 Āyurveda , 9 5 Manuel Diz Ramos , 10 5 Edificio Curbera , 11 5 Aleksandr Sokúrov , 12 5 Concerto delle donne , 13 5 Fran Cortegoso , 14 5 Onda electromagnética , 15 5 Camiño Portugués , 16 5 Orcadas , 17 5 Duna , 18 4 The Hunger Games (libros) , 19 4 IES San Rosendo , 20 4 Tea (planeta) , 21 4 Georg Leisner , 22 4 Asociación Coro Gospel Vida , 23 4 Gurumelo , 24 4 Geraldine Chaplin , 25 4 Lista de soberanos de Sicilia e Nápoles

nov 2016: 1 7 Dicionario da Real Academia Galega , 2 7 Xosé Docampo Vázquez , 3 6 Narf , 4 6 Donald Trump , 5 6 Ángel Castro Argiz , 6 6 Moaña , 7 5 Diccionario da Real Academia Galega , 8 5 Sicixia (filme) , 9 5 Sword Art Online , 10 5 Catedral de Palermo , 11 5 Clara Clemens , 12 5 Música para piano de Gabriel Fauré , 13 5 Uxío Abuín , 14 5 Batalla de Elviña , 15 5 Carta xeométrica de Galicia , 16 5 Vaca , 17 5 Fidel Castro , 18 4 Johan Hegg , 19 4 Caneiro de Don Eduardo , 20 4 Massimo Spadano , 21 4 Manuel Lesteiro Martínez , 22 4 PlayStation 4 , 23 4 Melania Trump , 24 4 Literatura do Romanticismo en Alemaña , 25 4 Templo de Xúpiter Óptimo Máximo

dez 2016: 1 9 Finados en 2016 , 2 7 Faro das Illas Sisargas , 3 6 Premio Estornela , 4 5 Mare Ingenii , 5 5 Mar lunar , 6 5 Cousas que trouxo a chuvia , 7 5 Atentado de Berlín de 2016 , 8 5 Persecucións aos cristiáns , 9 5 Antonio Palacios Ramilo , 10 5 Bibiano , 11 4 Singin' in the Rain , 12 4 Mofeta , 13 4 José Grande Juncal , 14 4 Cara visible da Lúa , 15 4 Mare Australe , 16 4 Lista de mares lunares , 17 4 Lista de cráteres lunares , 18 4 Antoine Goüan , 19 4 John Keats , 20 4 Carrie Fisher , 21 4 Nir Yaniv , 22 4 Tetronarce nobiliana , 23 4 Instituto do Templo , 24 4 Escola de Borgoña , 25 4 Biblioteca Pública Central de Vigo

jan 2017: 1 8 Finados en 2017 , 2 6 Troglodítidos , 3 6 Arrival (filme) , 4 6 Partícula beta , 5 6 Golpe de estado en Irán de 1953 , 6 6 Gran viaxe da familia Mozart , 7 5 Río Romeán , 8 5 Axencia Galega de Noticias , 9 5 Gran Mesquita de Djenné , 10 5 Guerra civil chinesa , 11 5 Mozart en Italia , 12 5 Alcrique , 13 5 Segunda guerra mundial , 14 5 Israel , 15 5 A Illa de Arousa , 16 5 Galicia , 17 4 Lion (filme de 2016) , 18 4 A Brea, Bascuas, Lugo , 19 4 Bascuas, Bascuas, Lugo , 20 4 Brumado , 21 4 Carassius , 22 4 Brema , 23 4 Manchester by the Sea (filme) , 24 4 Leboreiro, Seoane Vello, Montederramo , 25 4 La La Land (filme)

fev 2017: 1 9 Jane Joseph , 2 8 Lista de científicas , 3 8 Vera Zasulich , 4 7 Revolución de Maio , 5 7 República Soviética Húngara , 6 6 Carmen Santos , 7 6 Rosalía de Castro , 8 5 Castro de Ferreira , 9 5 Dygra Films , 10 5 Sabre , 11 5 Revista Galega de Filoloxía , 12 5 Carrapucho , 13 5 Finados en 2017 , 14 5 Miguel Tellado , 15 5 Pataca , 16 5 Galicia , 17 4 Sudario , 18 4 Cama elástica , 19 4 Chris Bristow , 20 4 Coada , 21 4 Vera Popova , 22 4 Tim Behrens , 23 4 Fosa común , 24 4 Arciprestado de Ferreira de Pantón , 25 4 Celia Brañas

mar 2017: 1 10 Rosalía de Castro , 2 8 Sinfonía coral , 3 8 Catedral de Santiago de Compostela , 4 6 Mariano Fragueiro , 5 6 Sandra Ortega , 6 6 Xoana de Arco , 7 5 Geranium , 8 5 Ética do dereito , 9 5 Couza guatemalteca , 10 5 A Balsa da Medusa , 11 5 Wismichu , 12 5 Mary Wollstonecraft , 13 5 Cobre , 14 5 O Grove , 15 5 Narón , 16 5 Estados Unidos de América , 17 4 Irmandade Galeguista do Uruguai , 18 4 Pobo masai , 19 4 Beauty and the Beast (filme de 2017) , 20 4 A Bela e a Besta , 21 4 Cleopatra (filme de 1917) , 22 4 Atlantismo , 23 4 Intercambio colombiano , 24 4 Hidróxido , 25 4 Kazuyoshi Hoshino

abr 2017: 1 8 Rosalía de Castro , 2 6 Obras variadas para piano só (Rachmaninov) , 3 6 Xornadas de Cine de Ourense , 4 6 Georges Bizet , 5 6 Carme Chacón , 6 6 Segunda guerra mundial , 7 5 Ramón Ferro , 8 5 Óscar Graña , 9 5 Exposición Rexional Galega , 10 5 Justo Pico de Coaña , 11 5 Nadezhda Krupskaia , 12 5 Sítidos , 13 5 Golpe de Estado do 18 de xullo de 1936 , 14 5 Fely Manzano , 15 5 Alfonso Daniel Rodríguez Castelao , 16 5 Esperanto , 17 4 Universitarios. Revista de la F.U.E. , 18 4 La Jetée , 19 4 Romanceiro popular galego de tradizon oral , 20 4 Exequias da Raíña Margarida , 21 4 Once portas , 22 4 Igrexa de Santo Antoíño de Baíñas , 23 4 Antía Veres , 24 4 Leopoldina Fortunati , 25 4 José Eleicegui López

mai 2017: 1 12 Carlos Casares , 2 8 Basílica de Santo Isidoro de León , 3 7 Certame Literario Musical de O'Galiciano , 4 7 Matusa Barros , 5 7 Galicia , 6 6 Manel Navarro , 7 6 José María Rodríguez Díaz , 8 6 Alleeiros , 9 6 Editorial Citania , 10 5 Gerda Taro , 11 5 Net.art , 12 5 O Mono da Tinta , 13 5 Grupo 1500 , 14 5 Semana Santa de Lugo , 15 5 Festival de Eurovisión 2018 , 16 5 Aleksandr Kolchak , 17 5 Festival de Eurovisión 2017 , 18 5 Chris Cornell , 19 5 Istambul , 20 5 Real Club Celta de Vigo , 21 4 José Miguélez Pampín , 22 4 Esa-Pekka Salonen , 23 4 Nicky Hayden , 24 4 Galería de imaxes de placas altimétricas dos concellos da provincia de Lugo , 25 4 Galería de imaxes de placas altimétricas dos concellos da provincia da Coruña

jun 2017: 1 8 Maite Veiga , 2 8 María Victoria Moreno , 3 7 Finados en 2017 , 4 6 Andrés Toxeiro , 5 6 Andrea Dworkin , 6 5 Mar adiante , 7 5 Teorías da aprendizaxe , 8 5 Imperio de Malí , 9 5 Santiago Lopo , 10 5 Narf , 11 5 Anagnórise (novela) , 12 5 Noite de san Xoán , 13 4 Espionaxe , 14 4 Óscar García Junyent , 15 4 Shih-tzu , 16 4 My Little Pony: Friendship Is Magic , 17 4 Cámaras Time of Flight , 18 4 Arundhati Roy , 19 4 Clarice Lispector , 20 4 Morteiro (arma) , 21 4 Tomorrowland , 22 4 Peaxes , 23 4 Precuela , 24 4 Obxecto de aprendizaxe , 25 4 Pablo Fernández Barba

jul 2017: 1 9 Crocodilianos , 2 7 Estrea da Sinfonía n.º 7 de Shostakovich en Leningrado , 3 7 Finados en 2017 , 4 7 Corazón , 5 5 Diario da luz e a sombra , 6 5 Poruchik Kizhe (Prokofev) , 7 5 Miguel Blesa , 8 5 Rosario Mariño de Lobeira , 9 5 Ser humano , 10 4 Olavo de Carvalho , 11 4 Paulo Ricardo , 12 4 Leonardo e os fontaneiros , 13 4 Maryam Mirzakhani , 14 4 Nina Hagen , 15 4 Isaac Fernández , 16 4 Monte da Picaraña , 17 4 Clarice Lispector , 18 4 Six moments musicaux (Rachmaninov) , 19 4 George A. Romero , 20 4 Praia dos Cristais , 21 4 Rafael Berges , 22 4 Historia dos eslavos do sur , 23 4 Centro Galego de Artes da Imaxe , 24 4 Anagnórise (novela) , 25 4 Laureano Sanabria

ago 2017: 1 9 Atentados de Cataluña de 2017 , 2 8 Olaia Ledo Díaz , 3 7 Finados en 2017 , 4 6 Rico , 5 5 Fidel Diéguez , 6 5 Arnau Pons , 7 5 Petrotilapia chrysos , 8 5 Abelmoschus manihot , 9 5 Carlos Vasallo , 10 5 Píseň bohatýrská , 11 5 Poruchik Kizhe (Prokofev) , 12 5 Día das Letras Galegas , 13 4 Castelanización , 14 4 Santa Isabel (barco) , 15 4 Marroio , 16 4 Alas de papel , 17 4 María Alonso Seisdedos , 18 4 Ana María Bejarano Escanilla , 19 4 Svetlana Ražnatović , 20 4 Greenwashing , 21 4 Illa Nelson (Alasca) , 22 4 Pablo Rubén Eyré , 23 4 Kindness , 24 4 Vireo caribaeus , 25 4 Jaume Collboni

set 2017: 1 7 Cromatóforo , 2 6 David Ortiz , 3 6 Manuela Varela , 4 6 Golf , 5 5 Vítor Manuel II de Italia , 6 5 Masculino xenérico , 7 5 Finados en 2017 , 8 5 María Victoria Moreno , 9 5 Xohana Torres , 10 5 Severo Ochoa , 11 5 Israel , 12 4 Democracia Ourensana , 13 4 Eric Voegelin , 14 4 Cabalos e lobos , 15 4 Test de Bechdel , 16 4 Arde amor , 17 4 Pamela Palenciano , 18 4 Aterosclerose , 19 4 Uvas e granito , 20 4 Calouste Gulbekian , 21 4 Referendo sobre a independencia de Cataluña de 2017 , 22 4 Magdalena Aguinaga Alfonso , 23 4 Pobo xudeu , 24 4 Carlos Negreira , 25 4 Rafael Nadal

out 2017: 1 12 Cataluña , 2 9 República Catalá , 3 9 Carles Puigdemont , 4 8 Vaga de incendios forestais de 2017 en Galicia , 5 7 Claude Lorrain , 6 7 Referendo sobre a independencia de Cataluña de 2017 , 7 7 Traité d'instrumentation et d'orchestration , 8 6 Satenta , 9 6 Finados en 2017 , 10 6 Alberto Núñez Feijóo , 11 6 Dodo , 12 5 Rafael Bárez , 13 5 Marcos Abalde , 14 5 Baldo Ramos , 15 5 Roberto Vidal Bolaño , 16 5 Calgary Flames , 17 5 Galicia , 18 4 Proceso independentista catalán , 19 4 Roubo de identidade , 20 4 Biblioteca da Universidade da Coruña , 21 4 Beni Yáñez , 22 4 Louza de Delft , 23 4 Furacán Ophelia de 2017 , 24 4 Illa Bray , 25 4 As flores radioactivas

nov 2017: 1 8 Pixar , 2 7 Intempo , 3 7 Carl von Linné , 4 7 Mozilla Firefox , 5 6 Xesús Culebras , 6 6 Eastern Telegraph Company , 7 5 Mario Diz , 8 5 Termas romanas , 9 5 1I/ʻOumuamua , 10 5 Orquestra de Espazo de Cámara da Universidade de Santiago de Compostela , 11 5 Pórtico do Paraíso , 12 5 Penicilina , 13 5 Proxecto Manhattan , 14 5 Isidro Parga Pondal , 15 4 Premio de novela por entregas de La Voz de Galicia , 16 4 Clara Millán González , 17 4 Río Bouzós , 18 4 Schenkenschanz , 19 4 José Luis de Frutos , 20 4 Barbara Walters , 21 4 Hedda Hopper , 22 4 Rider técnico , 23 4 Derivación (lingüística) , 24 4 Fodiña , 25 4 Orquestra sinfónica

dez 2017: 1 8 Carl von Linné , 2 6 Charlotte Perkins Gilman , 3 6 Biblia Kennicott , 4 6 Anton van Dyck , 5 5 Tabarnia , 6 5 Eleccións ao Parlamento de Cataluña 2017 , 7 5 Salvador Peña Martín , 8 5 Dominio real francés , 9 5 Manuel Marín , 10 5 Discriminación , 11 5 Age of Empires II: The Age of Kings , 12 5 Children of Men , 13 5 María Victoria Moreno , 14 5 Max Born , 15 5 Literatura galega do século XX , 16 5 Cataluña , 17 5 Xosé Luís Franco Grande , 18 4 À Punt Mèdia , 19 4 Ezio Auditore , 20 4 Vitoria Ogando , 21 4 Gabriella Morreale , 22 4 Julián Sánchez Bort , 23 4 Las Maestras de la República , 24 4 Artigo 155 da Constitución española de 1978 , 25 4 Bibliofilia

jan 2018: 1 7 Cultura da violación , 2 7 Albert Camus , 3 7 Galicia , 4 6 Alan Lee , 5 6 Biblia Kennicott , 6 6 Rosa Luxemburg , 7 6 India , 8 5 Roger Torrent i Ramió , 9 5 Casilda Rodrigáñez , 10 5 Cristina Pardo , 11 5 Ricardo Dorado Janeiro , 12 5 Ara de Eiras , 13 5 Finados en 2018 , 14 5 Sinfonía núm. 3 (Górecki) , 15 5 Persoas supercentenarias e centenarias galegas , 16 5 Penicilina , 17 5 Kazuo Ishiguro , 18 4 Nella Larsen , 19 4 Cormac mac Cuilennáin , 20 4 Daniel Ripa , 21 4 7 Wonders (xogo de mesa) , 22 4 Ponte da Amizade , 23 4 Lope de Ulloa y Lemos , 24 4 Juan Benet , 25 4 Dogville

fev 2018: 1 7 Eugenia Osterberger , 2 7 Finados en 2018 , 3 6 Licaón (mitoloxía) , 4 6 Maternidade , 5 6 Galicia , 6 5 Rebeca Atienza , 7 5 Elisa Díaz , 8 5 Ramona Vaamonde , 9 5 Dolores Lombardero , 10 5 Manuela Barreiro , 11 5 Billy Graham , 12 5 Alicia do Reino Unido , 13 5 Lingua mirandesa , 14 4 Arquivo de Galicia , 15 4 Ángel Durán Álvarez , 16 4 Balbina López Somoza , 17 4 Dolores Lorenzo Salgado , 18 4 Ascensión Vidal Piazuelo , 19 4 Helmuth Koinigg , 20 4 Irish Independent , 21 4 Novas do Eixo Atlántico , 22 4 Revolta das Pedradas , 23 4 Germán Sierra Paredes , 24 4 Costumari Català , 25 4 Día dos Medios en Galego

mar 2018: 1 8 Día Internacional da Muller , 2 7 Ramiro Vidal Carrera , 3 6 O coelliño branco , 4 6 Eugenia Pereira Rodríguez , 5 6 Dhogs , 6 6 Margaret Brown , 7 6 Stephen Hawking , 8 6 Reino de Galicia , 9 5 Obdulia Díaz , 10 5 Irmás Touza , 11 5 Fariña (serie de televisión) , 12 5 Irene Milleiro , 13 5 Eugenia Osterberger , 14 5 Anticorpo , 15 5 Wernher von Braun , 16 5 Ricardo Carballo Calero , 17 5 Belarús , 18 5 Illas Malvinas , 19 4 Pretérito Imperfeito (1927-1961) , 20 4 Españolada , 21 4 Joe Sugg , 22 4 Zoella , 23 4 José Imaz Baquedano , 24 4 Os Artistiñas , 25 4 Castelo do Príncipe

abr 2018: 1 9 Cristina Cifuentes , 2 8 Nelson Mandela , 3 7 María Victoria Moreno , 4 6 Partido Froilanista , 5 5 Koke Resurrección , 6 5 Latrodectus , 7 5 Facultade de Xeografía e Historia de Santiago de Compostela , 8 5 Casahamlet , 9 5 Praza da Universidade , 10 5 Praza de Mazarelos , 11 5 Instituto Xelmírez , 12 5 Luz Darriba , 13 5 Sotelo Blanco Edicións , 14 5 Juan Manuel de Prada , 15 5 Finados en 2018 , 16 5 Ramiro Vidal Carrera , 17 5 Manuel María González López , 18 5 Illas Malvinas , 19 4 Mauro Pezzente , 20 4 Doctrina nazonalista , 21 4 Every Breath You Take , 22 4 Gonzalo Jar Couselo , 23 4 Praia de Caldebarcos , 24 4 Soto , 25 4 Premios Martín Codax da Música

mai 2018: 1 8 España , 2 7 Festa do melindre de Melide , 3 7 Execución da familia Romanov , 4 6 Adriano Domínguez , 5 6 Máis alá! , 6 5 Nós Televisión , 7 5 Sobreiral do Arnego , 8 5 Boops boops , 9 5 Mensajes de poesía , 10 5 Pilar Bermejo Barrera , 11 5 Finados en 2018 , 12 5 Pagellus , 13 5 Conan o bárbaro (filme) , 14 5 Castañeta encarnada , 15 5 Ollomol , 16 5 Grupo Brais Pinto , 17 5 María Victoria Moreno , 18 5 Maragota , 19 5 Berta Cáccamo , 20 5 Río de Xaneiro , 21 4 Antón de Borbón , 22 4 Loris Karius , 23 4 A Viñeta de Schrödinger , 24 4 Día das Galegas nas Letras , 25 4 Moeda bizantina

jun 2018: 1 12 Pedro Sánchez , 2 9 Nadia Calviño , 3 7 Mariano Rajoy , 4 6 Beatriz Guiance Rostro , 5 6 Castañeta encarnada , 6 6 Xabier P. DoCampo , 7 5 Ernst Jünger , 8 5 Aspazija , 9 5 Isaac Cordal , 10 5 Adriano Domínguez , 11 5 Plácido Betanzos , 12 5 Carles Puigdemont , 13 5 José Luis Meilán Gil , 14 5 Maragota , 15 5 Fermín Penzol , 16 5 Afonso VIII de León e Galicia , 17 5 Uxío Carré Aldao , 18 5 Copa do Mundo de Fútbol Masculino , 19 4 Libelloides coccajus , 20 4 Ferran Hurtado Sanchis , 21 4 Bugalliña , 22 4 Giovanni Papini , 23 4 Nae Ionescu , 24 4 Ferran Martín , 25 4 Corneliu Zelea Codreanu

jul 2018: 1 6 Aladdin Sane , 2 6 Antón Fraguas , 3 6 Benigno Andrade García , 4 6 Panteón Real da catedral de Santiago , 5 6 Reino de Galicia , 6 5 Ministerio de Economía e Empresa , 7 5 Neumünster , 8 5 Coral de Ruada , 9 5 Kathrine Switzer , 10 5 Cadea de bloques , 11 5 Fernando Osorio do Campo , 12 5 Camilo Díaz Baliño , 13 5 Galipedia , 14 4 Ministerio de Sanidade, Consumo e Benestar Social , 15 4 Ministerio para a Transición Ecolóxica , 16 4 Ministerio de Traballo, Migracións e Seguridade Social , 17 4 Prisión de Neumünster , 18 4 Eva Xanim , 19 4 Eduardo de Wessex , 20 4 André, duque de York , 21 4 Helen Fielding , 22 4 Indara Rodríguez , 23 4 Dorothea Pertz , 24 4 Elisa Leonida Zamfirescu , 25 4 Grace Hopper

ago 2018: 1 8 Finados en 2018 , 2 7 Niall Horan , 3 6 Kendall Jenner , 4 6 Kourtney Kardashian , 5 6 Liam Payne , 6 6 Marica Campo , 7 5 Xesús Costa Rodil , 8 5 Kylie Jenner , 9 5 Rob Kardashian , 10 5 Louis Tomlinson , 11 5 Ernesto Chao , 12 5 Betanzos , 13 4 Xade , 14 4 Entremés de Bora , 15 4 Gregorio Couto , 16 4 Celidonia , 17 4 Prang (arquitectura) , 18 4 Asociación Internacional de Federacións de Atletismo , 19 4 Lista de voces dos animais , 20 4 Elza Medeiros , 21 4 Manuela Sáenz , 22 4 María Belén Toimil , 23 4 José María Seoane , 24 4 Khmers vermellos , 25 4 Bikini

set 2018: 1 6 García II de Galicia , 2 6 Bloque Nacionalista Galego , 3 5 Alberto Ruz Lhuillier , 4 5 Excalibur (filme) , 5 5 Nesgo de xénero na Wikipedia , 6 5 Viradeira , 7 5 Fernanda Tabarés , 8 5 Cefalexina , 9 5 Metronidazol , 10 5 Inés Pérez de Ceta , 11 5 Campionato de Europa de hóckey a patíns masculino 2018 , 12 5 Misión Krulak-Mendenhall , 13 5 Relacións entre España e o Xapón , 14 5 Victoria Álvarez Ruiz de Ojeda , 15 5 Scott Pilgrim vs. the World , 16 5 Ramón Nicolás , 17 5 Hildegard von Bingen , 18 5 Panteón Real da catedral de Santiago , 19 4 Rózsa Péter , 20 4 El mundo alrededor , 21 4 Re-TROS , 22 4 Gaélicos do Gran Sol , 23 4 Cefoxitina , 24 4 Puri Ameixide , 25 4 K'inich Janaab' Pakal

out 2018: 1 7 Finados en 2018 , 2 7 Gustavo Pernas , 3 7 Montserrat Caballé , 4 6 Xoán I de Inglaterra , 5 6 García II de Galicia , 6 5 Ecoembes , 7 5 Iria Pinheiro , 8 5 Litocranius walleri , 9 5 Díbatag , 10 5 Reino de Galicia , 11 4 Pompeyo Beltrán Camús , 12 4 Pentaedro , 13 4 Linda Nochlin , 14 4 Horace Waller , 15 4 Pedro Ignacio Wolcan Olano , 16 4 Eva Furnari , 17 4 Donna Strickland , 18 4 Ruth Rocha , 19 4 Phumzile Mlambo-Ngcuka , 20 4 Papamerda subantártico , 21 4 Uxía do Reino Unido , 22 4 A banda da Loba , 23 4 Jorge Prado , 24 4 Basílica de Santo Isidoro de León , 25 4 Wismichu

nov 2018: 1 7 Castelo de Maside , 2 7 Esperanza Mariño , 3 6 Lista de Wikipedias , 4 6 Moncha Fuentes , 5 6 Benxamín de Tudela , 6 5 Lågskär , 7 5 Diferenzas entre o galego e o portugués , 8 5 José Frau , 9 5 María Xesús Lama , 10 5 Xerardo Estévez , 11 5 Meda, A Veiga , 12 5 Cobre , 13 5 Reino de Galicia , 14 5 Real Club Celta de Vigo , 15 4 Eleccións municipais de 2019 en Galicia , 16 4 Accidente do Marisquiño , 17 4 Ida Vitale , 18 4 Consello Consultivo de Galicia , 19 4 Angela Carter , 20 4 Linguas iberorrománicas , 21 4 O Marisquiño , 22 4 Semente, Escolas de Ensino Galego , 23 4 Resolución 1 do Consello de Seguridade das Nacións Unidas , 24 4 As mulleres na Idade Media , 25 4 Resolución 1769 do Consello de Seguridade das Nacións Unidas

Wikipedias are initially ordered by number of speakers of the language

Speakers: Number of speakers of a language is the estimated total of primary and secondary speakers, is in many cases a very rough estimation (based on the page on the English Wikipedia about that language)
Regions are parts of the world where the language is spoken in substantial amounts (compared to total number of speakers). Regions where a language gained presence only by a recent diaspora are generally not included.
Region codes: AF:Africa, AS:Asia, EU:Europe, NA:North America, OC:Oceania, SA:South America, W:World Wide, CL:Constructed Language

Estatísticas geradas em Quinta-feira, 13 de dezembro 2018 01:16

Dump file glwiki-20181201-stub-meta-history.xml.gz (edits only), size 338 Mb as gz -> 2.2 Gb
Dump processed till Nov 30, 2018, on server stat1007, ready at Mon-03/12/2018-21:28 after 15 min, 37 sec.

Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.