Estatísticas da Wikipédia guzerate

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Articles per size range / Records per namespace / Most edited articles / Zeitgeist
 
  May 2016: The major overhaul of Wikistats reports has entered a new phase.  

  First phase focused on migrating the traffic analysis reports to our new infrastructure. Those are operational now.  
  The Analytics Team will now proceed to also migrate data collection and reporting about wiki content and contributors.  
  First results are expected later this year.  

  More info at this announcement
  You can still tell us which reports you want to see preserved, in this survey.
  

  

Most metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.

Some metrics have been collected from the full archive dump which runs on lower frequency than the usual monthly cycle.
These metrics are columns F,I,J,K,M,N,O,P,Q,R from the first table.


See also metrics definitions


 
Monthly counts & Quarterly rankings: dezembro 2016
 
DataWikipedistasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
dez 2016+1%   0%      +150%      +4%
nov 20160%   0%      +593%      +9%
out 2016+1%   0%      -41%      +1%
set 2016+2%   0%      +58%      0%
ago 2016+2%   0%      +49%      +3%
jul 20160%   0%      -9%      0%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P____Q____R____S__
dez 2016286413227 k  12   18 k      2,4 k
nov 201628216127 k 111,3   7,3 k      2,3 k
out 201628148127 k 311,1   1,1 k      2,1 k
set 2016277514327 k 211,1   1,8 k      2,1 k
ago 2016272515127 k 211   1,1 k      2,0 k
jul 2016267 7127 k 111   763      2,0 k
jun 2016267211127 k 211   838      2,0 k
mai 2016265312227 k 311   1,3 k      2,0 k
abr 2016262111127 k 211   930      1,9 k
mar 2016261111126 k 111   814      1,9 k
fev 2016260114126 k 110,9   946      1,9 k
jan 2016259318526 k 510,9   3,5 k      1,9 k
dez 2015256310226 k 410,9   1,5 k      1,9 k
nov 2015253511126 k 110,9   668      1,8 k
out 2015248215326 k 110,8   1,2 k      1,8 k
set 2015246310426 k 110,8   1,6 k      1,8 k
ago 2015243312126 k 210,8   975      1,8 k
jul 201524019226 k 210,8   829      1,8 k
jun 2015239412226 k 110,7   777      1,8 k
mai 2015235312326 k 210,7   1,2 k      1,7 k
abr 201523218226 k 310,7   850      1,7 k
mar 201523119126 k 110,7   1,2 k      1,7 k
fev 2015230210126 k 110,7   540      1,7 k
jan 201522827226 k 210,7   587      1,7 k
dez 2014226 12126 k 110,7   652      1,7 k
nov 2014226110225 k 210,7   1,2 k      1,7 k
out 2014225510325 k 110,6   901      1,7 k
set 201422019125 k 110,6   569      1,7 k
ago 201421917325 k 110,6   751      1,7 k
jul 201421825 25 k  10,6   350      1,7 k
jun 2014216110 25 k  10,6   457      1,7 k
mai 2014215212225 k 210,6   795      1,7 k
abr 2014213212425 k 310,6   1,4 k      1,6 k
mar 2014211210225 k  10,6   988      1,6 k
fev 2014209 7225 k25 k 10,5238189%9%822136 Mb8,3 M473 k7,9 k3,4 k44 k1,6 k
jan 201420929325 k25 k310,5239889%10%1,7 k137 Mb8,3 M470 k7,9 k3,4 k43 k1,6 k
dez 2013207110325 k25 k1910,5240189%10%1,9 k137 Mb8,3 M469 k7,9 k3,4 k43 k1,6 k
nov 2013206211424 k24 k3910,6243489%10%3,4 k135 Mb8,2 M459 k8,0 k3,4 k43 k1,6 k
out 2013204215623 k23 k2211246887%9%3,4 k131 Mb8,0 M443 k7,9 k3,4 k41 k1,6 k
set 2013202313423 k22 k111,2249686%9%1,5 k129 Mb7,9 M431 k8,8 k3,3 k40 k1,5 k
ago 2013199213223 k22 k111,1249486%9%802129 Mb7,9 M431 k8,8 k3,3 k40 k1,5 k
jul 201319719223 k22 k111,1249686%9%5,6 k129 Mb7,9 M430 k10,0 k3,3 k39 k1,5 k
jun 201319619323 k22 k410,9249686%9%19 k129 Mb7,9 M430 k10 k3,3 k39 k1,5 k
mai 2013195315322 k22 k110,1245184%9%3,3 k126 Mb7,7 M428 k10 k3,3 k39 k1,5 k
abr 2013192112122 k22 k 10239082%9%2,3 k124 Mb7,6 M425 k10 k3,3 k39 k1,5 k
mar 2013191320222 k22 k19,9234582%9%13 k122 Mb7,5 M424 k11 k3,3 k39 k1,5 k
fev 2013188421522 k22 k29,3213479%9%6,7 k119 Mb7,1 M417 k177 k3,3 k39 k1,5 k
jan 2013184522322 k22 k39213078%9%3,2 k118 Mb7,1 M416 k174 k3,2 k39 k1,5 k
dez 2012179627622 k22 k28,9212978%8%4,3 k117 Mb7,0 M414 k173 k3,1 k39 k1,4 k
nov 2012173317322 k22 k48,8210778%8%12 k116 Mb7,0 M413 k171 k3,1 k38 k1,4 k
out 2012170417322 k22 k18,2201975%8%12 k113 Mb6,8 M411 k170 k3,0 k38 k1,4 k
set 2012166714322 k22 k17,7200774%8%2,3 k112 Mb6,7 M410 k169 k2,9 k38 k1,4 k
ago 2012159614122 k22 k17,6200174%8%1,9 k112 Mb6,7 M410 k168 k3,0 k38 k1,4 k
jul 2012153216222 k22 k17,6200074%8%3,0 k112 Mb6,7 M410 k167 k3,0 k38 k1,4 k
jun 2012151518522 k21 k37,4199774%8%3,4 k111 Mb6,7 M408 k166 k3,0 k38 k1,4 k
mai 2012146516422 k21 k 7,3198773%8%2,7 k111 Mb6,7 M407 k165 k3,1 k38 k1,4 k
abr 2012141513222 k21 k17,2198273%8%2,2 k110 Mb6,6 M406 k164 k3,3 k37 k1,3 k
mar 2012136111122 k21 k17,1198373%8%1,9 k110 Mb6,6 M406 k163 k3,3 k37 k1,3 k
fev 2012135214322 k21 k17198273%8%2,3 k110 Mb6,6 M406 k162 k3,3 k37 k1,3 k
jan 2012133419322 k21 k36,9198273%8%3,2 k110 Mb6,6 M405 k162 k3,3 k37 k1,3 k
dez 2011129315522 k21 k46,8198073%8%3,8 k109 Mb6,6 M404 k160 k3,1 k37 k1,3 k
nov 201112639322 k21 k66,7197573%8%3,1 k108 Mb6,5 M401 k159 k3,0 k37 k1,3 k
out 2011123312321 k21 k96,6198273%8%3,0 k108 Mb6,5 M399 k158 k3,0 k37 k1,3 k
set 2011120 9321 k20 k116,5199772%8%3,6 k107 Mb6,4 M392 k157 k3,1 k37 k1,3 k
ago 2011120211221 k20 k76,5201372%8%2,9 k106 Mb6,4 M385 k157 k3,1 k37 k1,2 k
jul 2011118310220 k20 k136,4201872%8%3,6 k105 Mb6,3 M382 k156 k3,1 k36 k1,2 k
jun 2011115312320 k20 k126,3203071%7%3,4 k104 Mb6,3 M373 k155 k3,1 k36 k1,2 k
mai 2011112314420 k19 k146,3199270%7%5,0 k100 Mb6,0 M365 k153 k3,0 k35 k1,2 k
abr 201110919319 k19 k136,2196469%7%3,4 k96 Mb5,8 M357 k149 k3,0 k34 k1,1 k
mar 201110817319 k18 k136,1194868%7%4,1 k94 Mb5,7 M348 k147 k3,1 k33 k1,1 k
fev 2011107618319 k18 k136193463%7%3,1 k91 Mb5,5 M337 k145 k3,1 k32 k1,1 k
jan 2011101315518 k17 k136187160%7%4,4 k87 Mb5,2 M328 k142 k2,8 k30 k1,1 k
dez 201098114518 k17 k135,8184757%7%3,6 k84 Mb5,0 M320 k140 k2,6 k28 k1,1 k
nov 201097816517 k17 k135,8179756%7%3,8 k80 Mb4,8 M312 k137 k2,3 k27 k1,0 k
out 201089412517 k16 k145,7175152%7%4,1 k76 Mb4,5 M304 k134 k2,1 k25 k1,0 k
set 201085316617 k16 k155,6167650%6%3,8 k71 Mb4,2 M293 k130 k2,2 k23 k996
ago 201082115516 k15 k165,5155745%6%8,2 k65 Mb3,8 M280 k126 k1,8 k21 k965
jul 201081312416 k15 k155,2144442%6%3,5 k59 Mb3,4 M264 k121 k1,8 k18 k879
jun 201078311315 k14 k145,1134338%5%3,6 k53 Mb3,1 M247 k116 k1,7 k16 k853
mai 201075110415 k14 k145126034%5%4,1 k49 Mb2,8 M231 k113 k1,4 k14 k830
abr 201074110214 k13 k174,9125427%5%4,3 k47 Mb2,7 M223 k111 k1,4 k14 k817
mar 201073416214 k13 k274,7122822%5%5,2 k45 Mb2,6 M212 k108 k1,4 k13 k807
fev 201069415213 k12 k184,6115420%5%4,4 k40 Mb2,3 M190 k102 k1,5 k11 k793
jan 20106528212 k11 k214,5108619%5%4,2 k36 Mb2,0 M175 k96 k1,4 k9,3 k786
dez 20096329112 k10 k214,4108419%5%3,8 k34 Mb1,9 M164 k90 k1,4 k8,8 k726
nov 20096136111 k9,8 k254,3104119%5%3,3 k31 Mb1,7 M150 k84 k1,4 k7,4 k642
out 200958112310 k8,9 k294,3105020%5%3,4 k29 Mb1,6 M135 k79 k1,4 k6,9 k563
set 200957 949,4 k7,8 k374,395820%5%3,3 k24 Mb1,4 M115 k70 k1,2 k5,4 k526
ago 20095761538,3 k6,7 k334,594321%5%3,5 k21 Mb1,2 M96 k60 k9834,7 k366
jul 2009512827,3 k5,7 k254,698023%5%2,2 k19 Mb1,1 M82 k52 k1,0 k4,4 k326
jun 2009491726,5 k4,9 k214,9100624%5%2,0 k17 Mb996 k70 k46 k8904,2 k315
mai 200948 645,9 k4,3 k27575824%5%5,4 k12 Mb686 k53 k38 k7222,1 k284
abr 2009482925,1 k3,4 k604,878519%6%2,8 k11 Mb612 k43 k34 k7722,0 k255
mar 200946 823,3 k1,7 k196,689123%7%1,6 k7,6 Mb448 k25 k28 k7291,6 k250
fev 200946 1012,7 k1,1 k37,489225%8%7626,4 Mb369 k18 k25 k5861,3 k230
jan 200946 7 2,6 k1,1 k17,386725%8%8065,9 Mb348 k17 k24 k5721,2 k223
dez 20084626 2,6 k1,0 k17,177824%8%6145,5 Mb310 k16 k22 k534970215
nov 200844 712,6 k1,0 k16,974923%7%8825,2 Mb296 k16 k21 k514858211
out 2008441712,5 k96026,771422%7%7744,9 Mb277 k15 k20 k478784203
set 200843311 2,4 k88536,565220%6%8294,5 Mb246 k14 k19 k366635197
ago 20084031012,3 k851216,564220%6%1,9 k4,2 Mb233 k13 k19 k333595188
jul 200837 711,7 k638147,874524%7%1,9 k3,6 Mb194 k10 k17 k306540182
jun 2008372811,3 k59389,189330%9%1,1 k3,2 Mb170 k8,2 k16 k289496160
mai 2008354921,0 k5631510,2106435%10%1,2 k3,0 Mb160 k7,4 k14 k283458146
abr 20083125 538391217148044%14%5082,1 Mb118 k5,4 k14 k264421121
mar 200829151493346117,5149139%14%5612,0 Mb108 k5,0 k13 k261412114
fev 20082847 454303117,7154037%14%4831,8 Mb100 k4,7 k13 k251371109
jan 20082435 422280 17,9161638%14%4491,7 Mb96 k4,7 k13 k246373108
dez 20072135 411273117,3155137%14%4581,6 Mb90 k4,6 k12 k238332107
nov 20071821 395266 16,9152536%13%4031,6 Mb87 k4,4 k12 k235310106
out 200716 1 382265216,4152037%13%4851,6 Mb86 k4,4 k12 k235302106
set 20071612 334265 17,3171242%15%3401,5 Mb86 k4,4 k11 k234299104
ago 20071511 322261 16,9170743%15%2281,5 Mb85 k4,4 k11 k231285102
jul 200714   319261 16,3170042%15%731,5 Mb84 k4,4 k11 k232283101
jun 20071414 318260 16,2168442%15%2321,5 Mb84 k4,4 k11 k233278101
mai 20071313 315255115,6169742%16%3991,5 Mb83 k4,4 k11 k231276100
abr 200712141299242115,1142640%13%3851,2 Mb66 k3,7 k10,0 k22023699
mar 200711131267210115,4121639%12%497953 kb47 k3,3 k8,2 k19622481
fev 20071012 248196114,6126440%12%276867 kb45 k3,3 k7,7 k18223072
jan 20079   231180 14,5119936%10%261774 kb39 k3,0 k7,4 k16322471
dez 20069 1 228174 13,5121235%11%329760 kb39 k3,0 k7,0 k16321971
nov 20069   224171 12,3123235%10%44730 kb38 k3,0 k6,1 k16221270
out 2006911 223172 12,2123535%10%70730 kb38 k3,0 k6,0 k16321270
set 20068   218166 12,1122834%11%47709 kb37 k2,9 k6,0 k16321270
ago 20068   214165 12,1122335%11%75691 kb37 k2,9 k5,8 k16321270
jul 20068   211166 12122335%11%122689 kb37 k2,9 k5,7 k16321070
jun 20068   210165 11,4122235%11%130681 kb37 k2,9 k5,5 k16221070
mai 20068 1 208164 10,9121735%11%124668 kb36 k2,9 k5,3 k15920870
abr 20068   207164 10,4119635%10%150658 kb36 k2,9 k5,2 k16020869
mar 20068   205164 9,7119535%10%128651 kb36 k2,9 k4,9 k16020869
fev 20068 1 202163 9,3119636%10%25633 kb36 k2,9 k4,4 k16020868
jan 20068 21201162 9,2119836%9%217630 kb35 k2,9 k4,4 k16020868
dez 20058 1118714718,7135434%10%177611 kb37 k2,9 k3,7 k15721054
nov 20058 1 146117 9,9162641%12%24555 kb35 k2,7 k2,8 k12520345
out 20058   143117 10164541%13%15553 kb35 k2,7 k2,8 k12420345
set 20058 1 142117 9,9165542%13%29551 kb35 k2,7 k2,8 k12420345
ago 20058 1 141117 9,8165842%13%20549 kb35 k2,7 k2,7 k12420344
jul 20058 1 141117 9,7171442%13%42545 kb37 k2,7 k2,6 k12421844
jun 20058 3214111729,4170042%13%455516 kb36 k2,6 k2,5 k12422244
mai 2005823 907219,6168349%14%382315 kb24 k1,7 k9845414918
abr 20056 1 6449 7,5120941%6%84153 kb12 k676540155612
mar 20056 1 57391772033%5%9295 kb6,1 k574242104012
fev 2005611 4017 7,785328%8%2468 kb4,0 k389179896
jan 2005512 3616 7,974628%6%4661 kb3,4 k334147785
dez 20044 4 3115 7,677832%6%4753 kb3,3 k317146784
nov 2004412 2310 8,385626%9%6040 kb2,5 k237102463
out 20043 1 144 9,347429%7%2918 kb6967522343
set 20043 2 123 8,425517% 6111 kb2991420 32
ago 2004311 93 4,453733%11%1116 kb4654133 91
jul 2004211 63 4,891750%17%1415 kb4534127 91
jun 20041   2  7,5   111 kb     1
mai 20041   1  14   17,5 kb     1
abr 20041   1  13   37,5 kb     1
mar 20041   1  10   57,3 kb     1
fev 20041   1  5   27,3 kb     1
jan 20041   1  3   27,3 kb     1
dez 200311  1  1   12,7 kb      
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
The following table ranks this project in relation to projects in other languages with 1000+ articles
out 201689679610899 106191   99      237
jul 201691 10510899 123193   111      237
abr 2016901059510799 107193   103      237
jan 20168989816999 93193   76      237
out 20159094828399 124193   104      237
jul 201589105969098 106196   106      237
abr 2015891281039397 97195   107      237
jan 201589941029497 118194   118      237
out 20148964937997 126197   101      237
jul 20148888107 95  196   132      237
abr 20148697887695 97193   94      237
jan 201486107978794821001944334138976677746212173237
out 2013869776659585481903942144736878756311975237
jul 201386104958893841191903842144636677746411873237
abr 2013861118211492831601964254143976676747411872237
jan 2013867267838981104200536414112668757214911768237
out 201287747279867912120058711457266746915011764237
jul 2012918980988578125198577214311664716614511563237
abr 2012917083958375124197577114212664716614510361237
jan 2012917676858074100197566513911161706514310359237
out 201192828582797174198576213812459676414210459237
jul 201193809094787170194536213511159646513810258237
abr 201195111968177706219357681439960666213810458237
jan 201195808066777165191599814410861666413710262237
out 201098758269777364185631061399464696613711563237
jul 2010101768173807255181841231379770796813711769237
abr 20109911389888174621799214713810671837113812372237
jan 20101039395918478531761081571379178857914211981237
out 2009104103798090853917210815513510081898014711786237
jul 2009107103938994944816410714513114193999416013198237
abr 200910486848910310427161122147127115107112109167140112237
jan 200910413098131119138125150112137110162125124132172146123237
out 200810210894102119135106147122136111154126128132170147129236
jul 20081051449710913214256136110127108118135138140174163137235
abr 200811189110126160149105145145144142157145148151169161138235
jan 200812182118131157152152140140139138154144149149163155137231
out 2007134139167131151146113138138136136157144148146159149139230
jul 2007133141189122148143136130130129127172138145144151143137228
abr 2007133106111101147142120126126125123139139145144145135136223
jan 2007141121176122149144135122122122120145144148143144141129220
out 2006133101145118141133137114114114113160129136131135128122217
jul 2006126126161108131124120105105105105134119128120120119114205
abr 200611012016110512211811892929291119110117112111105103201
jan 20069910510577108106105868686851011011041001029491185
out 20059197125841041009881818180135999894988986184
jul 200582881068097928970707070104898685918481175
abr 200583839375959484595959598796909210194106168
jan 200580657262979776545454548598979210491129164
out 200484708155969870515151518310210710111687138163
jul 200480617150878659434343438188971128282114145
abr 200490   97      8985     131
jan 200480   85      8871     121
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
 WikipedistasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikipedistas (usuários registrados)
A = Wikipedistas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikipedistas que editaram pelo menos dez vezes desde que chegaram
C = Wikipedistas que contribuíram cinco vezes ou mais este mês
D = Wikipedistas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Artigos que contêm pelo menos uma ligação interna e 200 caracteres de texto legível, não contando códigos wiki e html,
      ligações ocultas, etc.; títulos também não contam (outras colunas são baseadas no método oficial de contagem)
G = Novos artigos por dia no mês passado
H = Número médio de revisões por artigo
I = Tamanho médio dos artigos em bytes
J = Porcentagem de artigos com pelo menos 0,5 kb de texto legível (veja F)
K = Porcentagem de artigos com pelo menos 2 kb de texto legível (veja F)

Base de dados
L = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
M = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
N = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
O = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
P = Total de ligações para outras wikipédias
Q = Total de imagens apresentadas
R = Total de ligações para outros sítios
S = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  2500  5  10  100  1000  10000  1  3  5  10  25  100  250  5  10  100  1000  1  3  5  10  25  100  250  5  10  100 
dez 201644161310522  3321117662211    156421     
nov 2016371363211  3211 115222111   1254211    
out 2016321588311  1    17953211    197522     
set 20164318149431  211  17662111    24141073  1  
ago 20165221155211  11   215222111   1862211    
jul 201632874211       17522211    193331  1  
jun 20163713118511  1    15873111    218632  1  
mai 20163113129721       19983311    2498531    
abr 20163012114411  1    15553111    2994221    
mar 20163214116311  1    18632211    2294211    
fev 20163717148411       198543111   207742     
jan 201646241812851  2111 23111063111   271310631 11 
dez 201531121010822  1    231165311    28128742 1  
nov 2015341411851   1    16753111    2685331    
out 20154218151193   21   1915118311    291310751 1  
set 20153915109842  211  2913117511    44201475  1  
ago 20154116127411  22   16753211    40118651 21 
jul 201536169852        18654211    451710631    
jun 20154417121152   1    17866411    401411641 1  
mai 201546191210631  211  14865411    41169742    
abr 2015331387521  1    2186421122223717882  11 
mar 201540139631   111  2596411111114114852  1  
fev 2015231110951        20872211    3611521     
jan 201528117632   11   14764111    4720123111   
out 2016321588311  1    17953211    197522     
jul 201632874211       17522211    193331  1  
abr 20163012114411  1    15553111    2994221    
jan 201646241812851  2111 23111063111   271310631 11 
out 20154218151193   21   1915118311    291310751 1  
jul 201536169852        18654211    451710631    
abr 2015331387521  1    2186421122223717882  11 
jan 201528117632   11   14764111    4720123111   
out 2014351410853   211  14554111    54211373     
jul 20142913533   11   9422111    502014741    
abr 20143715128541  22   1676531     542015751    
jan 2014321198632  331  9664411    53149631    
out 2013482215107631 1    17998721    5921119642   
jul 201334129742   4211 18874211    4711843  22 
abr 2013491812941   5411 1955421 1   56151072  43 
jan 201360272215931  24175  211296411    7723171181 761
out 20125929178431  261752 226553  111 11531188311841
jul 2012462416952   25147  21764321111 109381793  741
abr 20124722131072   22173  24118551     1023621883176 
jan 201261231913933  26215  1898541     12329191061 52 
out 20113417127332  28215  116642      98231352  97 
jul 201142161083221 28194  1022111     104291751  41 
abr 20113415954321 22164  74211      85241351  84 
jan 2011511915119511 26194  1665411     11327181331 118 
out 201046201286521 19124  86322      9922151031 73 
jul 2010552212119411 25183  137532      1163318114  63 
abr 201031191096211 18144  92222      87271263  83 
jan 20102811875211117122  136442      84221394  21 
out 200925131275321 20145  1065421     108292193  21 
jul 2009221187421  17132  128663      120312391     
abr 20091910985211 1815   168651      1454125137  4  
jan 20092311764   2114   96541      143402272  32 
out 200817107641   107   156321      130361982  3  
jul 200814875311  991  148421      1604832941 2  
abr 200887543   87   63321      1192716116  51 
jan 2008128542   85   83332      137321772  2  
out 2007741     851  711        18047281472 21 
jul 200752     4               1804725931 2  
abr 2007854331   42   63111      17458301252 2  
jan 20073      321  2          17754321571131 
out 200642111   1    2          170371872  11 
jul 20063      21   1          175542471     
abr 20063      111  1          1404621111     
jan 2006632111   11   521        16257271231 1  
out 20051                      9321103      
jul 20053111    11   3          92271831     
abr 200532111        32         74187411    
jan 20053221         1          391132      
out 2004431          321        199731     
jul 20042111         1          13541      
abr 20041                      2         
jan 2004                       1      1  

 

Distribuição de edições de artigos por wikipedistas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikipedistasEdições total
12,085100.0%136,131100.0%
363730.6%133,98498.4%
1028913.9%132,02197.0%
321266.0%129,24694.9%
100602.9%125,55892.2%
316341.6%121,38889.2%
1000170.8%112,38282.6%
316260.3%95,00169.8%
1000030.1%73,59454.1%
3162310.0%51,32037.7%

 

42 wikipedistas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdições 
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
 agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
સતિષચંદ્રUC1 051,320142,454-fev 15, 2008324117,4473--
KartikMistryUC2 012,1097263,932123jan 01, 2012182561121--
DsvyasUC4+18,805408,05212dez 13, 200733051431--
Vyom25UC9 01,87556313nov 17, 20111870157---
आर्यावर्तUC12+41,47238497418mai 17, 201313231106--
AniketUC13-11,3821412-mai 07, 2005425586---
Nizil ShahUC19 0889183405jun 30, 2008310533---
NehalDaveNDUC105+1542950-set 23, 2013119441--
ShwetamitsUC120+3833429--nov 28, 201632----
Dinesh akabariUC122...333355dez 10, 201620----
Gazal worldUC150+71261233jun 23, 2016190----
CoderzombieUC164+22312-ago 05, 20148782---
વિકાસ કૈલાUC171+18252221--jun 08, 2016205----
SaushuUC233+3413214-out 14, 201677----
Rakesh NikumUC270+15111--ago 24, 2016128----
Dakhara RutvikUC272...1111--dez 11, 201619----
פארוקUC310+17294--mar 08, 2014102832--
Bhavesh VasaniUC319...99--dez 26, 20164----
Ks-M9UC507+12351--out 04, 201687----
LotjeUC585+15841--fev 18, 20131411----
Ømkargiri gőswamiUC637...4422dez 03, 201627----
Tushargoyal12UC779+30731--mar 03, 2015668----
Khandeka satish kumar valji bhaiUC810+33631--nov 06, 201654----
JogranajesalUC812...3333dez 28, 2016211--
Arjunvarma jadejaUC1136+844212-abr 29, 2016245----
Vinod janiUC1159...22--dez 12, 201618----
Rakesh pandyaUC1160...22--dez 18, 201612----
Ravi Mak1UC1161...22--dez 28, 20162----
NitinMlkUC2072...11--dez 02, 201628----
Tarun chavdaUC2073...11--dez 03, 201627----
Iamkaran1994UC2074...1112-dez 04, 201626----
Atulbhai KathiriyaUC2075...11--dez 06, 201624----
Mr.SagarUC2076...11--dez 06, 201624----
Raeesh maniarUC2077...11--dez 09, 201621----
Sondigara parthUC2078...11--dez 15, 201615----
Ghanshyam SaradiyaUC2079...1111dez 16, 201614----
PinakinlunagariyaUC2080...11--dez 17, 201613----
RUSHIRAJSINH VAGHELAUC2081...11--dez 22, 20168----
Vaghela NimeshUC2082...11--dez 25, 20165----
Juhi TagoreUC2083...11--dez 27, 20163----
Mahendra 45UC2084...11--dez 27, 20163----
Ami.bangaliUC2085...11--dez 28, 20162----

 

20 wikipedistas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
  Primeira ediçãoúltima edição
 posiçãototaldatadias
atrás
datadias
atrás
Sushant savlaUC310,165nov 05, 20082977set 22, 201699
Ashok modhvadiaUC58,783ago 27, 20083047set 27, 2015460
PSPatelUC63,819abr 29, 20092802dez 26, 20111831
Maharshi675UC72,663set 29, 20073380jun 07, 2015572
વિહંગUC81,935jun 30, 20121644out 07, 2014815
Harsh4101991UC101,744jan 22, 20121804dez 01, 20131125
Sam.lditeUC111,648set 15, 20121567jun 07, 20131302
SpundunUC141,240jul 21, 20044545mai 01, 20073531
જીતેન્દ્રસિંહUC151,216set 14, 20083029mar 10, 20141026
SunilUC161,129mar 05, 20102492ago 09, 20131239
TekinaUC171,077jun 08, 20112032jun 30, 20121644
મહાથીUC18985set 22, 20131195fev 15, 20141049
DBhavsar709UC20735nov 08, 20121513ago 09, 20131239
Sanjay BalotiyaUC21664abr 13, 20112088dez 29, 2015367
JaishreeUC22568fev 07, 20102518jul 18, 20102357
Rangilo GujaratiUC23556out 17, 20111901out 03, 20131184
Akash96UC24535jul 20, 20121624dez 08, 2014753
SushilmishraUC25528nov 14, 2014777ago 14, 2016138
V dasUC26457fev 20, 20102505out 29, 20102254
ArbhattUC27424out 07, 2014815jul 04, 2015545

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 19.145 edições foram feitas por usuários anônimos, de um total de 323.414 edições ( 5e %)
  


50 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições 
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
 datadias
atrás
datadias
atrás
GubotUC141,816mai 17, 20092784dez 27, 2016351
KartikBotUC223,237nov 10, 201650dez 31, 2016-9897
HarshBotUC315,932set 27, 20121555nov 16, 20121505--
SamkbotUC412,470nov 23, 20121498jun 04, 20131305--
EmausBotUC58,769jul 09, 20102366dez 25, 2016531
XqbotUC67,263jan 19, 20092902mai 06, 2014969--
Luckas-botUC75,851nov 30, 20082952mai 20, 20121685--
SieBotUC84,136ago 18, 20073422jan 25, 20112166--
AddbotUC94,054mar 06, 20131395ago 27, 20131221--
MerlIwBotUC103,318abr 24, 20112077ago 08, 20131240--
TXiKiBoTUC113,273dez 12, 20063671dez 20, 20121471--
WikitanvirBotUC122,320out 20, 20102263mai 15, 20121690--
VolkovBotUC132,277abr 20, 20073542fev 28, 20131401--
ZéroBotUC142,268out 16, 20102267mar 06, 20131395--
MelancholieBotUC152,217abr 03, 20083193nov 28, 20092589--
EscarbotUC162,069jul 01, 20063835fev 07, 20131422--
ArthurBotUC171,602jan 07, 20092914out 07, 20121545--
ChuispastonBotUC181,373dez 14, 20102208abr 28, 20121707--
FoxBotUC191,334out 01, 20092647fev 04, 20121791--
JAnDbotUC201,196nov 08, 20063705jul 03, 20131276--
Thijs!botUC211,090dez 12, 20063671jul 30, 20121614--
KamikazeBotUC221,051jul 04, 20102371jan 26, 20131434--
RedBotUC23943set 01, 20102312ago 21, 20121592--
CommonsDelinkerUC24818mai 31, 20073501dez 31, 2016-2-
TjBotUC25790jun 01, 20102404mar 06, 20131395--
LegobotUC26650mar 11, 20131390abr 02, 20131368--
JotterbotUC27629jul 27, 20092713jan 22, 20131438--
AlexbotUC28623jan 30, 20083257ago 23, 20111956--
HRoestBotUC29586jun 19, 20102386mar 05, 20131396--
Idioma-botUC30581set 05, 20083038mar 03, 20131398--
LaaknorBotUC31554jul 27, 20083078mar 07, 20131394--
JackieBotUC32542out 21, 20102262nov 16, 2014775--
YurikBotUC33534mar 10, 20063948ago 25, 20063780--
Ripchip BotUC34533mar 10, 20112122fev 17, 20121778--
PtbotgourouUC35521set 29, 20083014mar 05, 20131396--
SynthebotUC36518jun 07, 20083128jan 31, 20131429--
AlleborgoBotUC37510out 28, 20073351dez 03, 20082949--
Dinamik-botUC38494fev 07, 20102518dez 23, 20121468--
Movses-botUC39459dez 21, 20102201mar 18, 20121748--
RubinbotUC40449abr 06, 20092825mar 04, 20131397--
AvicBotUC41408jun 20, 20112020dez 09, 20121482--
YFdyh-botUC42379jun 20, 20121654fev 24, 20131405--
AvocatoBotUC43373out 21, 20111897fev 27, 20131402--
DragonBotUC44347out 19, 20073360fev 04, 20131425--
ZorrobotUC45342set 07, 20083036set 06, 20121576--
VagobotUC46340set 20, 20111928set 06, 20121576--
MystBotUC47334mai 16, 20102420mar 03, 20121763--
MastiBotUC48333nov 29, 20092588fev 28, 20131401--
CarsracBotUC49332nov 17, 20082965mar 01, 20131400--
RobbotUC50324jul 08, 20054193jan 03, 20131457--

 

Artigos que contêm pelo menos uma ligação interna e .. caracteres de texto legível, não contando códigos wiki e html,
ligações ocultas, etc.; títulos também não contam  (excluindo páginas de redirecionamento)

DataArtigos
 < 32 ch< 64 ch< 128 ch< 256 ch< 512 ch< 1 k ch< 2 k ch< 4 k ch< 8 k ch< 16 k ch< 32 k ch< 64 k ch
out 20100.1%0.3%1.1%9.8%48.6%89.6%93.5%95.9%97.0%97.8%98.6%99.6%
set 20100.1%0.3%1.2%10.2%50.9%89.8%93.8%96.2%97.2%97.9%98.7%99.6%
ago 20100.1%0.3%1.2%10.4%55.5%90.1%94.0%96.3%97.3%98.0%98.7%99.5%
jul 20100.2%0.4%1.3%11.2%59.1%90.6%94.4%96.7%97.7%98.3%98.9%99.6%
jun 20100.2%0.4%1.3%11.6%62.4%90.9%94.7%96.9%97.9%98.5%99.0%99.7%
mai 20100.2%0.4%1.4%12.2%66.6%91.3%95.0%97.2%98.2%98.8%99.2%99.8%
abr 20100.2%0.4%1.4%12.5%73.2%91.4%95.0%97.2%98.2%98.8%99.2%99.8%
mar 20100.2%0.4%1.4%13.0%78.6%91.3%94.9%97.1%98.1%98.6%99.0%99.6%
fev 20100.2%0.4%1.5%14.2%80.0%91.3%95.0%97.3%98.3%98.8%99.2%99.7%
jan 20100.2%0.4%1.6%14.8%80.5%91.4%95.0%97.3%98.3%98.8%99.2%99.6%
dez 20090.2%0.5%2.4%15.9%81.4%91.5%95.1%97.4%98.5%99.0%99.4%99.8%
nov 20090.2%0.5%3.4%16.4%81.0%91.3%95.1%97.5%98.6%99.1%99.5%99.9%
out 20090.2%0.5%3.6%17.7%80.3%90.9%94.8%97.2%98.4%98.9%99.3%99.7%
set 20090.3%0.7%5.2%21.3%80.0%91.1%95.1%97.4%98.6%99.1%99.5%99.8%
ago 20090.3%0.7%5.7%23.9%78.9%90.9%95.1%97.4%98.6%99.1%99.5%99.8%
jul 20090.4%0.9%6.3%26.8%77.4%90.5%95.0%97.4%98.7%99.2%99.6%99.9%
jun 20090.4%0.9%6.7%30.2%76.0%90.0%94.7%97.3%98.5%99.0%99.4%99.8%
mai 20090.5%1.1%7.4%33.5%76.5%90.3%95.0%97.8%99.1%99.7%100.0%100.0%
abr 20090.5%1.2%8.2%38.8%81.0%89.4%94.3%97.3%98.7%99.3%99.6%99.8%
mar 20090.8%1.9%12.3%57.4%76.8%85.8%92.7%96.7%98.8%99.5%99.9%100.0%
fev 20091.0%2.3%14.7%62.7%74.4%84.2%91.7%96.2%98.6%99.4%99.7%99.9%
jan 20091.0%2.4%15.2%62.9%74.8%84.3%91.7%96.2%98.7%99.5%99.8%100.0%
dez 20081.1%2.5%15.5%64.1%75.8%85.2%92.3%96.6%99.0%99.7%100.0%100.0%
nov 20081.1%2.5%15.6%64.8%76.4%85.6%92.6%96.6%98.8%99.5%99.9%100.0%
out 20081.1%2.6%16.0%66.6%77.9%86.6%92.9%96.8%98.9%99.7%100.0%100.0%
set 20081.2%2.7%16.4%68.4%79.7%88.0%93.9%97.2%98.9%99.6%99.9%100.0%
ago 20081.2%2.8%17.0%68.6%79.8%88.1%94.1%97.5%99.1%99.8%100.0%100.0%
jul 20081.8%4.1%22.2%65.1%75.6%85.5%93.1%96.9%98.8%99.6%100.0%100.0%
jun 20082.4%5.4%30.5%55.7%69.3%81.6%91.3%96.0%98.6%99.4%100.0%100.0%
mai 20083.1%6.6%20.6%47.0%63.1%78.1%89.2%95.0%98.1%99.0%99.7%99.8%
abr 20086.2%12.9%17.4%31.6%54.7%72.4%85.8%92.9%97.0%98.7%99.8%100.0%
mar 20086.8%14.3%19.7%34.6%58.7%73.4%86.1%92.7%96.6%98.3%99.8%100.0%
fev 20089.0%17.6%21.1%36.8%60.2%73.2%85.7%92.4%96.6%98.2%99.8%100.0%
jan 20088.7%17.1%19.9%34.7%58.1%71.8%84.5%91.9%96.2%98.2%99.7%100.0%
dez 20078.8%17.6%20.2%35.5%59.9%72.9%85.9%92.6%96.5%98.3%99.9%100.0%
nov 20079.3%17.8%20.7%36.6%61.2%73.9%86.6%92.7%96.4%98.3%99.9%100.0%
out 20079.3%17.8%20.7%36.9%61.3%74.0%86.7%92.5%96.2%98.1%99.7%100.0%
set 20070.3%2.8%6.0%25.2%54.5%69.3%84.4%91.0%95.4%97.6%99.5%99.8%
ago 20070.3%2.5%6.0%25.2%55.2%69.9%84.3%91.3%95.5%97.7%99.6%99.9%
jul 20070.3%2.5%6.0%25.2%55.9%70.3%84.4%91.4%95.6%97.8%99.7%100.0%
jun 20070.6%2.8%6.3%26.0%56.3%70.6%84.3%91.3%95.4%97.6%99.5%99.8%
mai 20070.6%3.2%6.7%26.7%56.7%70.2%84.1%91.2%95.4%97.7%99.6%99.9%
abr 20070.7%3.4%6.8%27.5%58.0%72.2%86.4%93.2%96.6%98.3%100.0%100.0%
mar 20070.4%3.5%9.2%31.0%59.7%73.9%88.1%95.4%98.1%98.5%100.0%100.0%
fev 20071.3%2.6%7.2%29.0%58.0%73.1%87.4%95.4%97.9%98.3%100.0%100.0%
jan 20072.2%3.5%8.4%30.8%61.7%76.0%89.0%95.7%97.5%97.9%99.7%99.7%
dez 20062.3%3.7%8.7%31.2%62.4%75.7%89.0%95.9%97.7%98.2%100.0%100.0%
nov 20061.9%2.4%6.7%29.7%61.8%76.2%89.1%95.8%97.7%98.2%100.0%100.0%
out 20061.4%1.9%6.2%29.2%61.7%76.1%89.0%95.7%97.6%98.1%100.0%100.0%
set 20061.0%1.5%6.4%31.8%63.0%78.1%88.8%95.6%97.6%98.1%100.0%100.0%
ago 20061.0%1.5%5.9%31.9%62.8%78.5%88.8%95.7%97.7%98.2%100.0%100.0%
jul 20061.0%1.5%5.9%31.9%62.8%78.5%88.8%95.7%97.7%98.2%100.0%100.0%
jun 20061.0%1.5%6.9%32.4%62.8%78.5%88.8%95.7%97.7%98.2%100.0%100.0%
mai 20060.5%1.0%6.4%32.1%62.8%78.6%89.0%95.4%97.4%97.9%99.9%99.9%
abr 20060.5%1.0%6.4%32.1%63.3%79.1%90.0%95.4%97.4%97.9%99.9%99.9%
mar 20060.5%1.0%6.0%32.2%63.4%79.2%90.1%95.5%97.5%98.0%100.0%100.0%
fev 20060.5%1.0%6.0%32.2%62.9%79.2%90.1%95.5%97.5%98.0%100.0%100.0%
jan 20060.5%1.0%6.0%32.4%62.7%79.1%90.5%95.5%97.5%98.0%100.0%100.0%
dez 20050.5%1.6%6.5%33.3%64.4%79.2%89.6%94.5%96.7%97.2%99.9%99.9%
nov 20050.7%2.1%8.3%27.5%58.3%74.1%87.8%93.3%96.0%96.7%100.0%100.0%
out 20050.7%2.8%7.0%26.4%58.3%73.6%87.5%93.1%95.9%96.6%100.0%100.0%
set 20050.7%2.1%6.3%25.9%58.1%73.5%87.5%93.1%95.9%96.6%100.0%100.0%
ago 20050.7%2.1%6.3%25.9%58.1%73.5%87.5%93.1%95.9%96.6%100.0%100.0%
jul 20050.7%2.1%6.3%25.9%58.1%73.5%87.5%93.1%95.9%96.6%100.0%100.0%
jun 20050.7%2.1%6.3%25.9%58.1%73.5%87.5%93.1%95.9%96.6%100.0%100.0%
mai 20051.1%4.3%11.7%26.6%52.1%68.1%86.2%93.6%95.7%97.8%99.9%99.9%
abr 20050.0%4.6%9.2%27.7%58.5%75.4%93.9%97.0%98.5%98.5%100.0%100.0%
mar 20053.6%9.0%14.4%35.8%66.2%80.5%94.8%98.4%100.0%100.0%100.0%100.0%
fev 20053.2%9.7%22.6%45.2%64.6%80.7%90.4%96.9%100.0%100.0%100.0%100.0%
jan 20053.3%10.0%23.3%46.6%66.6%83.3%93.3%96.6%99.9%99.9%99.9%99.9%
dez 20043.6%10.7%25.0%46.4%64.3%82.2%92.9%96.5%100.0%100.0%100.0%100.0%
nov 20045.0%15.0%30.0%45.0%70.0%85.0%90.0%95.0%100.0%100.0%100.0%100.0%
out 200418.2%45.5%45.5%54.6%63.7%91.0%91.0%100.0%100.0%100.0%100.0%100.0%
set 200425.0%37.5%37.5%50.0%75.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
ago 200437.5%37.5%37.5%50.0%62.5%87.5%87.5%100.0%100.0%100.0%100.0%100.0%
jul 20040.0%0.0%0.0%20.0%40.0%80.0%80.0%100.0%100.0%100.0%100.0%100.0%

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.

See also Category Overview Complete
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110GifJpgPdfPngSvg
dez 201629 k1,7 k1,9 k1041105,0 k151,3 k       3891101
nov 201629 k1,7 k1,9 k1041105,0 k151,3 k       3891101
out 201629 k1,7 k1,8 k1041105,0 k151,3 k       3891101
set 201629 k1,7 k1,8 k1041105,0 k151,3 k       3891101
ago 201629 k1,7 k1,8 k1041094,9 k141,2 k       3891101
jul 201629 k1,7 k1,8 k1041094,9 k141,2 k       3891101
jun 201629 k1,7 k1,7 k1041094,9 k141,2 k       3891101
mai 201629 k1,7 k1,7 k1041094,8 k141,2 k       3891101
abr 201628 k1,7 k1,6 k1041094,8 k141,2 k       3891101
mar 201628 k1,7 k1,6 k1041094,8 k141,2 k       3891101
fev 201628 k1,6 k1,5 k1041094,8 k141,2 k       3891101
jan 201628 k1,6 k1,5 k1041094,7 k131,2 k       3891101
dez 201528 k1,6 k1,4 k1041084,7 k131,2 k       3891101
nov 201528 k1,6 k1,4 k1041064,7 k121,2 k       3891101
out 201528 k1,6 k1,4 k1041064,6 k121,2 k       3891101
set 201528 k1,6 k1,3 k1041064,5 k121,2 k       3891101
ago 201528 k1,6 k1,3 k1041054,5 k121,2 k       3891101
jul 201528 k1,6 k1,2 k1041054,5 k121,2 k       3891101
jun 201528 k1,6 k1,2 k1041054,5 k121,2 k       3891101
mai 201528 k1,5 k1,1 k1041024,5 k121,2 k       3891101
abr 201527 k1,5 k1,1 k1041024,5 k121,1 k       3891101
mar 201527 k1,5 k1,1 k1041024,5 k121,1 k       3891101
fev 201527 k1,5 k1,0 k1041024,5 k121,1 k       3891101
jan 201527 k1,5 k9901041024,5 k121,1 k       3891101
dez 201427 k1,5 k9681041024,4 k121,1 k       3891101
nov 201427 k1,5 k9261041024,4 k111,1 k       3891101
out 201427 k1,5 k8901041024,4 k111,1 k       3891101
set 201427 k1,5 k8631041024,4 k111,1 k       3891101
ago 201427 k1,5 k8291041024,4 k111,1 k       3891101
jul 201427 k1,5 k7911041024,4 k111,1 k       3891101
jun 201427 k1,5 k7561041024,3 k111,1 k       3891101
mai 201427 k1,5 k7361041014,3 k111,1 k       3891101
abr 201427 k1,4 k7051041004,3 k111,1 k       3891101
mar 201427 k1,4 k6701031004,3 k101,1 k       389191
fev 201427 k1,4 k613103994,3 k91,1 k      497389191
jan 201427 k1,4 k592103994,2 k91,1 k      1211389191
dez 201327 k1,4 k569103994,2 k91,1 k      1787389191
nov 201326 k1,4 k555103984,2 k91,1 k      2848389191
out 201325 k1,4 k543102974,2 k91,0 k      2992389181
set 201324 k1,4 k516102974,1 k91,0 k      1035389181
ago 201324 k1,4 k495102974,1 k91,0 k      519389181
jul 201324 k1,3 k474102974,1 k9995      505389181
jun 201324 k1,3 k440102974,1 k9986      803389181
mai 201324 k1,3 k414102974,1 k9974      750389181
abr 201324 k1,3 k379102974,0 k9960      401389181
mar 201324 k1,3 k331102964,0 k9960      861389181
fev 201324 k1,3 k302102964,0 k9951      1513389181
jan 201324 k1,2 k277102964,0 k9940      1137389181
dez 201224 k1,2 k242102943,9 k9935      2256389181
nov 201224 k1,2 k212101883,7 k8884      1146388181
out 201223 k1,1 k200101863,6 k8850      822388181
set 201223 k1,1 k189101833,6 k8839      834388181
ago 201223 k1,1 k156100833,5 k8831      521388171
jul 201223 k1,1 k141100833,5 k8830      690388171
jun 201223 k1,1 k138100823,4 k8821      1372388171
mai 201223 k1,0 k136100773,1 k8814      1315388171
abr 201223 k1,0 k132100772,8 k6805      695388171
mar 201223 k980130100772,5 k6797      481388171
fev 201223 k95912795772,5 k6793      871387131
jan 201223 k93812395772,5 k6789      1545387131
dez 201123 k90312192772,4 k6757      1677384131
nov 201123 k88612192772,3 k6716      1226384131
out 201123 k85212092772,3 k6706      1492384131
set 201122 k83611792772,2 k6697      1521384131
ago 201122 k81911492772,2 k6686      1078384131
jul 201122 k80611491772,2 k6683      1710384121
jun 201121 k78711491772,2 k5679      1733384121
mai 201121 k77411287772,2 k5675      2021380121
abr 201120 k75911084772,2 k5669      2027377121
mar 201120 k74711083772,1 k5660      2232376121
fev 201120 k73411081772,1 k5653      1529374121
jan 201119 k71911077752,1 k5650      2459370121
dez 201019 k70110877752,1 k5616      1996370121
nov 201018 k68910876752,0 k5609      2287369121
out 201018 k67810876752,0 k5599      2249369121
set 201017 k66610476752,0 k5584      2611369121
ago 201017 k65210476752,0 k5575      2912369121
jul 201016 k62010275751,9 k5558      198836912 
jun 201016 k60610173751,9 k5540      240036712 
mai 201016 k58210170751,9 k5526      2917365 2 
abr 201015 k57110169751,8 k5498      2529364 2 
mar 201015 k55910167751,8 k5484      3678263 2 
fev 201014 k53410060751,8 k5466      3022256 2 
jan 201013 k52010056751,8 k5408      3061252 2 
dez 200912 k5009956751,8 k5390      2674252 2 
nov 200912 k4909956751,7 k5371      2145252 2 
out 200911 k4759956751,7 k5360      2150252 2 
set 20099,9 k4719956751,7 k5343      2396252 2 
ago 20098,7 k4569956751,7 k5299      1876252 2 
jul 20097,6 k4339854751,6 k5263      1284250 2 
jun 20096,8 k4159750751,6 k5241      1271246 2 
mai 20096,2 k4059749751,6 k5222      1407245 2 
abr 20095,3 k3989547751,6 k5198      2219243 2 
mar 20093,5 k3839537751,5 k5149      1086233 2 
fev 20092,9 k3749237751,5 k5118      319233 2 
jan 20092,8 k3619137751,5 k5117      326233 2 
dez 20082,8 k3488837751,5 k5113      233233 2 
nov 20082,8 k3388837751,5 k5112      331233 2 
out 20082,7 k3208731751,5 k5106      397228 1 
set 20082,6 k2978525751,4 k597      428222 1 
ago 20082,5 k2848523751,4 k480      936220 1 
jul 20081,9 k2698523751,4 k476      705220 1 
jun 20081,4 k2518421751,4 k475      598218 1 
mai 20081,2 k2278421751,4 k370      839218 1 
abr 20086592158318751,4 k370      220215 1 
mar 20086072088318751,3 k368      301215 1 
fev 20085631958313741,3 k356      192210 1 
jan 20085301908212721,3 k356      170110 1 
dez 2007518181809721,3 k356      14717 1 
nov 2007501176796721,2 k356      3714 1 
out 2007488171795721,2 k356      2213 1 
set 2007438160725721,2 k350      2713 1 
ago 2007424156705721,1 k350      1113 1 
jul 2007420148675721,1 k350      1413 1 
jun 2007419144665721,1 k350      5113 1 
mai 2007415139665721,1 k348      9013 1 
abr 2007398134665711,1 k347      20813 1 
mar 200734812358518998236      23313 1 
fev 200732011354417934235      9512 1 
jan 200730210353217924235      41  1 
dez 200629910153217607235      151  1 
nov 20062949453117598235      2   1 
out 20062939353117584235      33   1 
set 20062889053117583235      3   1 
ago 20062848752117582235      3   1 
jul 20062818051117576235      4   1 
jun 20062807751117574234      7   1 
mai 20062787651117558234      13   1 
abr 20062767251117556234      4   1 
mar 20062747151117547234      2   1 
fev 20062706951117538234      8   1 
jan 20062696751117461234      179   1 
dez 20052414447117372129      123   1 
nov 20051914347116319128      13   1 
out 20051883946116317 27      2   1 
set 20051873846116311 27      7   1 
ago 20051853646116310 27      7   1 
jul 20051853444116304 27      17   1 
jun 20051853043116300 27      444   1 
mai 20051082932 16245 22      284     
abr 2005762630 16149 19      62     
mar 2005692227 1657 13      90     
fev 2005462126 1643 2      16     
jan 2005411726 1633 2      26     
dez 2004351625 1632 2      40     
nov 2004261423 1528 2      47     
out 2004171321 1521 2      23     
set 200414916 1513 1      34     
ago 200410612 147              
jul 20047410 147              
jun 2004349 144              
mai 2004229 104              
abr 2004225 64              
mar 20042 4 63              
fev 20042 2 63              
jan 20042 1 62              
dez 20031 1  1              

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

jan 2004: 1 1 HomePage

mar 2004: 1 1 મુખપૃષ્ઠ

abr 2004: 1 1 મુખપૃષ્ઠ

mai 2004: 1 1 મુખપૃષ્ઠ

jul 2004: 1 2 મુખપૃષ્ઠ , 2 1 પ્રતિજ્ઞા પત્ર

ago 2004: 1 1 મહાત્મા ગાંધી

set 2004: 1 2 ગુજરાત , 2 1 Main Page

out 2004: 1 2 ભારત , 2 2 મીરાંબાઈ , 3 2 ગુજરાતી દૈનિકપત્રોની યાદી

nov 2004: 1 3 મુખપૃષ્ઠ , 2 2 પાકિસ્તાન , 3 2 ૧૯૯૩ , 4 2 કાશ્મીર , 5 1 દયારામ

dez 2004: 1 2 બિહાર , 2 2 વર્જિન એટલાંટિક , 3 2 ઢાકા , 4 1 વેલિંગ્ટન

jan 2005: 1 2 આસામ

fev 2005: 1 2 ગૉડફ્રે હારૉલ્ડ હાર્ડિ , 2 2 અમદાવાદ

mar 2005: 1 2 ઐશ્વર્યા રાય , 2 2 જગદીશચંદ્ર બોઝ , 3 2 આશિત દેસાઈ , 4 2 નરેન્દ્ર મોદી , 5 2 મીરાંબાઈ , 6 1 અબૅલ

abr 2005: 1 2 મહાત્મા ગાંધી , 2 2 મુખપૃષ્ઠ , 3 1 ભારત

mai 2005: 1 3 ભુજ , 2 3 વડોદરા , 3 2 ચંદ્ર , 4 2 કાર્બન , 5 2 મોહનદાસ કરમચંદ ગાંધી , 6 2 સૂર્યમંડળ , 7 2 ભારતના વડાપ્રધાન , 8 2 ભારતના રાષ્ટ્રપતિ , 9 1 ભારત

jun 2005: 1 3 નક્ષત્ર , 2 3 અમદાવાદ , 3 2 ભારત , 4 2 છત્તીસગઢ , 5 2 મધ્ય પ્રદેશ , 6 2 મહારાષ્ટ્ર , 7 2 બળ , 8 2 દળ , 9 2 તરંગલંબાઇ , 10 2 વિદ્યુત-ચુંબકીય તરંગો , 11 2 ગંગા નદી , 12 2 ક્ષ-કિરણો , 13 2 ધૂમકેતુ , 14 2 ઉષ્મા

jul 2005: 1 1 ધૂમકેતુ

ago 2005: 1 1 ભૂમિતિ

set 2005: 1 1 ખગોળ શાસ્ત્ર

out 2005: 1 1 જન ગણ મન

nov 2005: 1 1 ઇમરાન ખાન

dez 2005: 1 2 ચલાલા (તા. ધારી) , 2 2 લોકશાહી , 3 1 ભારત

jan 2006: 1 3 કેટલાક જાણીતા ગુજરાતીઓ , 2 2 ગાંધીનગર , 3 2 સાબરકાંઠા જિલ્લો , 4 2 ચલાલા (તા. ધારી) , 5 2 ઇમરાન ખાન , 6 2 હિન્દુ-અરેબીક અંકો , 7 2 અમિતાભ બચ્ચન , 8 2 ગુજરાત , 9 1 ભારત

fev 2006: 1 2 સુરત , 2 1 રોટલી

mar 2006: 1 1 ઇસ્‍લામ

abr 2006: 1 1 ભારત

mai 2006: 1 2 કનૈયાલાલ મુનશી , 2 1 હીન્દી

jun 2006: 1 1 રમેશ પારેખ

jul 2006: 1 1 પાલનપુર

ago 2006: 1 1 ગાંધી આશ્રમ

set 2006: 1 1 સત્ય ઇસુ દેવળ

out 2006: 1 2 રાની મુખર્જી , 2 1 યાક

nov 2006: 1 1 ચીન

dez 2006: 1 1 નેપાલ સ્કાઉટ

jan 2007: 1 1 મુખપૃષ્ઠ/જુનું-૧

fev 2007: 1 2 ભારતના ભાગલા , 2 2 ચાણક્ય , 3 2 રામાયણ , 4 1 શ્રીમદ્ ભગવદ્ ગીતા

mar 2007: 1 3 મુખપૃષ્ઠ/જુનું-૧ , 2 2 વાદળ , 3 2 સંસ્કૃત ભાષા , 4 2 કુરોવ , 5 2 વેગમાન સંરક્ષણનો નિયમ , 6 2 કાઠમંડુ , 7 2 મૌર્ય વંશ , 8 2 રામાયણ , 9 2 વંદે માતરમ્ , 10 1 ભારત

abr 2007: 1 3 સરદાર પટેલ , 2 3 સુભાષચંદ્ર બોઝ , 3 3 સ્વામી વિવેકાનંદ , 4 3 અકબર , 5 3 અશોક , 6 3 આર્યભટ્ટ , 7 3 કાલિદાસ , 8 2 ભારત , 9 2 કરમસદ , 10 2 રાજા રવિ વર્મા

mai 2007: 1 2 સરદાર પટેલ , 2 2 મહાભારત , 3 2 સુરત , 4 2 અમદાવાદ , 5 1 યજ્ઞ

jun 2007: 1 2 ભારત , 2 2 સંયુક્ત રાજ્ય અમેરિકા , 3 2 જામનગર , 4 2 ગુજરાત

jul 2007: 1 1 ભરૂચ

ago 2007: 1 1 સંસ્કૃત

set 2007: 1 1 રવિશંકર રાવળ

out 2007: 1 1 લોયાધામ

nov 2007: 1 1 ઝૂલતા મિનારા

dez 2007: 1 4 ગુજરાત , 2 2 વડનગર , 3 1 ચૈતન્ય મહાપ્રભુ

jan 2008: 1 5 ગુજરાત , 2 3 સત્ય ઇસુ દેવળ , 3 2 બાઇબલ , 4 2 ઇસ્કોન , 5 2 દાળ , 6 2 અમેરિકન ગૅંગ્સ્ટર , 7 1 ભારત

fev 2008: 1 2 ભારત , 2 2 સંગણક , 3 2 વડોદરા જિલ્લો , 4 2 રાજકોટ જિલ્લો , 5 2 રણોત્સવ , 6 2 ડેબિયન , 7 2 મરાઠી લોકો , 8 2 બ્રિટીશ એશિયન , 9 2 અમરેલી , 10 2 વઘઇ

mar 2008: 1 3 નરસિંહ મહેતા , 2 2 ઉમરગામ , 3 2 વ્યારા , 4 2 આદિવાસી , 5 2 ઝઘડીયા , 6 2 તિથલ , 7 2 નારેશ્વર , 8 2 હાલોલ તાલુકો , 9 2 ઉનાઇ , 10 2 પંચમહાલ જિલ્લો , 11 2 બીગરી , 12 2 મઢી , 13 2 ભગવદ્ ગીતા , 14 2 લોયા , 15 2 ઇશ્વર પેટલીકર , 16 2 કલાપી , 17 2 દલપતરામ , 18 2 મનસુખલાલ ઝવેરી , 19 2 કે. કા. શાસ્ત્રી , 20 2 નાનાભાઈ ભટ્ટ , 21 2 બકુલ ત્રિપાઠી , 22 2 ભગવતીકુમાર શર્મા , 23 2 તારક મહેતા , 24 2 નિર્મિશ ઠાકર , 25 2 ધીરુબેન પટેલ

abr 2008: 1 3 હિંદુ ધર્મ , 2 2 વીર નર્મદ દક્ષિણ ગુજરાત યુનિવર્સિટી, સુરત , 3 2 રામનવમી , 4 2 હનુમાન ચાલીસા , 5 2 ત્રિકમ સાહેબ , 6 2 રંગ અવધૂત , 7 2 દાસી જીવણ , 8 2 ભિક્ષુ અખંડાનંદ , 9 2 શ્રીમદ્ રાજચંદ્ર , 10 2 પૂ. મોટા , 11 2 પુનિત મહારાજ , 12 2 પૃથિવીવલ્લભ , 13 2 સત્યના પ્રયોગો અથવા આત્મકથા , 14 2 જ્યોતીન્દ્ર હ. દવે , 15 2 સાત પગલાં આકાશમાં , 16 1 ખીજડીયા પક્ષી અભયારણ્ય

mai 2008: 1 5 બગસરા , 2 3 ગણેશ , 3 3 શિવ , 4 3 ઓખાહરણ , 5 3 સી. વી. રામન , 6 3 વીણા , 7 3 વલ્લભાચાર્ય , 8 3 નેલ્સન મંડેલા , 9 3 સિહોર , 10 3 હિંદુ ધર્મ , 11 3 અમદાવાદ , 12 2 આઇઝેક ન્યુટન , 13 2 માઉન્ટ આબુ , 14 2 મિર્ઝા ગ઼ાલિબ , 15 2 રતન તાતા , 16 2 સોનીપત જિલ્લો , 17 2 રોહતક જિલ્લો , 18 2 સિરસા જિલ્લો , 19 2 કરનાલ જિલ્લો , 20 2 ફરીદાબાદ જિલ્લો , 21 2 યમુનાનગર જિલ્લો , 22 2 પાનીપત જિલ્લો , 23 2 અંબાલા જિલ્લો , 24 2 કરસનભાઇ પટેલ , 25 2 પશ્ચિમી સિંહભૂમ જિલ્લો

jun 2008: 1 4 આસારામ બાપુ , 2 3 અંજા જિલ્લો , 3 3 લખનૌ , 4 3 ઇટાનગર , 5 3 ઓખાહરણ , 6 3 ઝવેરચંદ મેઘાણી , 7 3 સુરત , 8 2 ગાઝિયાબાદ , 9 2 નેધરલેંડ , 10 2 બ્લૉગ , 11 2 હંસ , 12 2 અત્રિ , 13 2 ભારદ્વાજ , 14 2 અગસ્ત્ય , 15 2 કુર્નૂલ જિલ્લો , 16 2 પશ્ચિમ ગોદાવરી જિલ્લો , 17 2 પૂર્વ ગોદાવરી જિલ્લો , 18 2 નાલગોંડા જિલ્લો , 19 2 નેલ્લોર જિલ્લો , 20 2 પ્રકાસમ જિલ્લો , 21 2 રંગારેડ્ડી જિલ્લો , 22 2 ચિત્તૂર જિલ્લો , 23 2 મહેબૂબનગર જિલ્લો , 24 1 બસ્તી

jul 2008: 1 3 ઉલૂપી , 2 3 ભીષ્મ , 3 3 શાંતનુ , 4 3 પુરી જિલ્લો , 5 3 નવોદય વિદ્યાલય , 6 3 ગુજરાત , 7 2 ઉત્તરા , 8 2 અંબાલિકા , 9 2 અંબિકા , 10 2 વિચિત્રવિર્ય , 11 2 નાગેશ્વર , 12 2 અર્જુન , 13 2 ચિત્રાંગદા , 14 2 ચિત્રાંગદ , 15 2 ત્ર્યંબકેશ્વર , 16 2 તમિલ ભાષા , 17 2 કારેલું , 18 2 દૂધી , 19 2 સફરજન , 20 2 રીંગણ , 21 2 જાન્યુઆરી ૩૦ , 22 2 સિરોહી , 23 2 સવાઇ માધોપુર , 24 1 સિમન્ટેક વૅબ ક્રૉલીંગ

ago 2008: 1 4 જુનાગઢ , 2 3 પાલનપુર , 3 2 આસો , 4 2 અષાઢ , 5 2 ડિસેમ્બર , 6 2 નવેમ્બર , 7 2 ઓક્ટોબર , 8 2 સપ્ટેમ્બર , 9 2 ઓગસ્ટ , 10 2 જુલાઇ , 11 2 જૂન , 12 2 મે , 13 2 એપ્રિલ , 14 2 માર્ચ , 15 2 ફેબ્રુઆરી , 16 2 જાન્યુઆરી , 17 2 મૈથિલી ભાષા , 18 2 કસ્તુરબા , 19 2 સંજય , 20 2 ભવભૂતિ , 21 2 ગયા , 22 2 ભોજપુરી ભાષા , 23 1 ભેંસાણ, જૂનાગઢ જિલ્લો

set 2008: 1 3 મિથુન રાશી , 2 3 વૃષભ રાશી , 3 3 મેષ રાશી , 4 3 રાશી , 5 3 શ્રી નાથજીદાદાની જગ્યા - દાણીધાર , 6 3 જામનગર જિલ્લો , 7 2 મહાબળેશ્વર , 8 2 કલિંગનુ યુધ્ધ , 9 2 કૃષ્ણા નદી , 10 2 ભક્ત કવિઓ , 11 2 કાળું કાણું , 12 2 મીન રાશી , 13 2 કુંભ રાશી , 14 2 વૃશ્ચિક રાશી , 15 2 કન્યા રાશી , 16 2 સિંહ રાશી , 17 2 કર્ક રાશી , 18 2 ગજહ મદ , 19 2 વેદવ્યાસ , 20 2 ખેડા , 21 2 વિક્રમ સંવત , 22 2 સાતારા જિલ્લો , 23 2 ડૉ. ભીમરાવ રામજી આંબેડકર , 24 2 ઉપનિષદ , 25 1 પાટણ, મહારાષ્ટ્ર

out 2008: 1 3 ગુજરાત , 2 2 ધન તેરસ , 3 2 પ્રાથમિક સારવાર , 4 2 દીપ , 5 2 પંચાંગ , 6 2 વાઘ બારસ , 7 2 નોબેલ પારિતોષિક વડે સન્માનીત મહિલાઓ , 8 2 ભારતનાં વિશ્વ ધરોહર સ્થળો , 9 2 દશેરા , 10 2 રામચકલી-પીળી ચોટલી , 11 2 દિવાળી , 12 2 ભીષ્મ , 13 2 શનિદેવ , 14 2 ધોરાજી , 15 2 ગુજરાતના મુખ્યમંત્રીઓ , 16 2 પોરબંદર જિલ્લો , 17 2 મહેસાણા , 18 2 અશોક , 19 2 ગિરનાર , 20 2 બનાસકાંઠા જિલ્લો , 21 2 રાજકોટ , 22 1 નોબેલ પારિતોષિક વડે સન્માનીત મહાનુભાવો

nov 2008: 1 3 આદિલ મન્સુરી , 2 3 ભરૂચ , 3 2 પ્રભાશંકર પટ્ટણી , 4 2 કાર્બ્યુરેટર , 5 2 અચલેશ્વર , 6 2 ચિત્રવિચિત્રનો મેળો , 7 2 ઉપગ્રહ પ્રક્ષેપણ યાન , 8 2 ગીતા પ્રેસ , 9 2 પ્રમબનન , 10 2 વિસાવાડા , 11 2 ભગત સિંહ , 12 2 અભિમન્યુ , 13 2 શ્રી નાથજીદાદાની જગ્યા - દાણીધાર , 14 2 અબુલ ફઝલ

dez 2008: 1 3 દેવાયત પંડિત , 2 3 મદીના , 3 3 મક્કા , 4 3 નવા સુદાસણા , 5 3 રાવણ , 6 3 નરસિંહ મહેતા , 7 2 લીરબાઈ , 8 2 હમીરજી ગોહિલ , 9 2 ઝીંઝરી , 10 2 કેરી , 11 2 કમળ , 12 2 વડ , 13 2 માણાવદર , 14 2 અંશુમાન ગાયકવાડ , 15 2 દ્વારકા , 16 2 ભીષ્મ , 17 2 ગાયત્રી , 18 2 શિવ , 19 2 કુતિયાણા , 20 2 અંજીર , 21 2 દાસી જીવણ , 22 2 ભારત , 23 2 હેમચંદ્રાચાર્ય , 24 2 ઇસ્લામ , 25 1 ખરોિલ

jan 2009: 1 4 કનકાઈ-ગીર , 2 3 પ્રબોધિની એકાદશી , 3 3 જુનાગઢ , 4 2 અડાલજની વાવ , 5 2 કાળાપાણ , 6 2 મકર સંક્રાંતિ , 7 2 કામદા એકાદશી , 8 2 પાપમોચિની એકાદશી , 9 2 આમલકી એકાદશી , 10 2 જયા એકાદશી , 11 2 ષટતિલા એકાદશી , 12 2 પુત્રદા એકાદશી , 13 2 સફલા એકાદશી , 14 2 મોક્ષદા એકાદશી , 15 2 ઉત્પતિ એકાદશી , 16 2 બહાદુર શાહ ઝફર , 17 2 એકાદશી વ્રત , 18 2 આગ્રાનો કિલ્લો , 19 2 ગુરુત્વાકર્ષણ , 20 1 કે.લાલ

fev 2009: 1 3 અવાજની ઝડપ , 2 3 તારાપુર , 3 3 વડ , 4 3 નોબેલ પારિતોષિક વડે સન્માનીત મહિલાઓ , 5 3 સ્વામી વિવેકાનંદ , 6 2 અપ્પુઘર , 7 2 વિશ્વની સાત મોટી ભૂલો , 8 2 અંબિકા નદી , 9 2 નવનીત મદ્રાસી , 10 2 વલંદી, વલસાડ તાલુકો , 11 2 વાંકલ (તા.વલસાડ) , 12 2 વેજલપોર, વલસાડ તાલુકો , 13 2 સારંગપુર, વલસાડ તાલુકો , 14 2 કુબેર , 15 2 ભગવદ્ગોમંડલ , 16 2 બાગેફિરદોશ કમ્યુનિટિ હોલ,સી.ટી.એમ. , 17 2 કે.લાલ , 18 2 એરિસ્ટોટલ , 19 2 કૃતવર્મા , 20 2 દિવાળી , 21 1 વાંઝણા

mar 2009: 1 4 ક્ષત્રિય , 2 3 બોપલ , 3 3 જાન્યુઆરી ૧ , 4 3 માર્ચ ૨૪ , 5 3 વિશ્વ જળ દિન , 6 3 સારાવાક ગુફા , 7 3 નાસિક , 8 3 નથુરામ ગોડસે , 9 2 માર્ચ ૨૩ , 10 2 સિદ્ધગિરિ ગ્રામજીવન સંગ્રહાલય , 11 2 માર્ચ ૨૧ , 12 2 ઓગસ્ટ ૧૫ , 13 2 વિશ્વ ક્ષય દિન , 14 2 આંતરરાષ્ટ્રીય મહિલા દિન , 15 2 માર્ચ ૧૨ , 16 2 માર્ચ ૮ , 17 2 માર્ચ ૨૦ , 18 2 માર્ચ ૨૨ , 19 2 ઔદિચ્ય બ્રાહ્મણ , 20 2 પ્રહલાદ , 21 2 શનિવાર , 22 2 શુક્રવાર , 23 1 સાદડવેરા

abr 2009: 1 4 રાજકોટ , 2 3 ગીઝાનો મહાન પિરામિડ , 3 3 પિરામિડ , 4 2 વૈશાખ સુદ ૬ , 5 2 એપ્રિલ ૨૭ , 6 2 ચૈત્ર વદ ૦)) , 7 2 પ્રમુખ સ્વામી , 8 2 એપ્રિલ ૨૨ , 9 2 એપ્રિલ ૨૦ , 10 2 એપ્રિલ ૨૧ , 11 2 કુતુબ મિનાર , 12 2 એપ્રિલ ૧૪ , 13 2 ખારાઘોડા , 14 2 પીઝાનો ઢળતો મિનારો , 15 2 સરદાર પટેલ યુનિવર્સિટી , 16 2 એપ્રિલ ૧૦ , 17 2 એપ્રિલ ૯ , 18 2 એપ્રિલ ૮ , 19 2 આજી નદી , 20 2 ચૈત્ર સુદ ૧૧ , 21 2 ચૈત્ર સુદ ૯ , 22 2 એપ્રિલ ૨ , 23 2 એપ્રિલ ફૂલ્સ ડે , 24 2 ભીચરી , 25 2 મંગળના ચંદ્રો

mai 2009: 1 4 ગુજરાત , 2 3 બોલપેન , 3 2 ઉપાસની મહારાજ , 4 2 ૧૦ (અંક) , 5 2 ૧૦૨ (અંક) , 6 2 આંબેડકર નેશનલ કોંગ્રેસ , 7 2 કાચબો , 8 2 સંચળ , 9 2 મે ૧૧ , 10 2 મે ૯ , 11 2 ગુજરાતના અભયારણ્યો તથા રાષ્ટ્રીય ઉદ્યાનો , 12 2 મે ૬ , 13 2 આંતરરાષ્ટ્રીય પરીચારિકા દિવસ , 14 2 આંતરરાષ્ટ્રીય દાયણ દિવસ , 15 2 મે ૫ , 16 2 મે ૪ , 17 2 મે ૨ , 18 2 મે ૧ , 19 2 શક્તિ દર્શનમ્ , 20 2 વિરસા મુંડા , 21 2 કઠોર (કામરેજ) , 22 2 રાજપૂત , 23 2 કોલોસીયમ , 24 2 ભગવદ્ગોમંડલ , 25 2 હઠ યોગ

jun 2009: 1 3 ઇજનેરી , 2 3 ટેક્લોબેન , 3 3 બાહુબલી , 4 3 માઉન્ટ એવરેસ્ટ , 5 3 કંથારીયા (તા.ભરૂચ) , 6 3 કેરી , 7 3 શ્રી નાથજીદાદાની જગ્યા - દાણીધાર , 8 3 વેરાવળ , 9 3 ખોડિયાર , 10 3 નવકાર મંત્ર , 11 2 અષાઢ સુદ ૬ , 12 2 વાર , 13 2 માઇકલ જેકસન , 14 2 વૈશ્વિક સ્થળનિર્ધારણ પ્રણાલી , 15 2 અષાઢ સુદ ૨ , 16 2 બેસતુ વર્ષ , 17 2 પાંડુરંગ શાસ્ત્રી આઠવલે , 18 2 જૂન ૧૩ , 19 2 શુકલતીર્થ , 20 2 બિલ ગેટ્સ , 21 2 છાણીયું ખાતર , 22 2 જેઠ વદ ૪ , 23 2 જેઠ સુદ ૧૫ , 24 2 નગોદ (કામરેજ) , 25 2 નેત્રંગ

jul 2009: 1 5 ગાંઠિયા , 2 4 બાહુબલી , 3 4 શ્રી નિષ્કલંક મહાદેવ કોળિયાક , 4 3 ઉરુગ્વે , 5 3 અષાઢ સુદ ૧૧ , 6 3 હાલોલ તાલુકો , 7 3 ગુજરાતી સાહિત્યકારો , 8 2 અમરસિંહ ચૌધરી , 9 2 શ્રાવણ સુદ ૭ , 10 2 શ્રાવણ સુદ ૬ , 11 2 શ્રાવણ સુદ ૫ , 12 2 સુરીનામ , 13 2 ભીખુદાન ગઢવી , 14 2 સાબરમતી આશ્રમ , 15 2 જુલાઇ ૨૧ , 16 2 મહાત્મા ગાંધી સેતુ (બિહાર) , 17 2 ગુજરાતી ભોજન , 18 2 અષાઢ વદ ૯ , 19 2 બાજરો , 20 2 અષાઢ સુદ ૧૫ , 21 2 અષાઢ સુદ ૧૩ , 22 2 બાર્ટન પુસ્તકાલય , 23 2 બાંદ્રા-વરલી સમુદ્રસેતુ , 24 2 એપ્રિલ ફૂલ્સ ડે , 25 2 ખરોલિ

ago 2009: 1 7 રોઝવા (તા. છોટાઉદેપુર) , 2 6 રોઝકુવા (તા. છોટાઉદેપુર) , 3 6 વલ્લભભાઈ પટેલ , 4 6 તુલસીદાસ , 5 5 રાણીખેડા , 6 5 ઓળી આંબા (તા. છોટાઉદેપુર) , 7 5 નાના રામપુરા (તા. છોટાઉદેપુર) , 8 5 સીમળ ફળીયા (તા. છોટાઉદેપુર) , 9 5 રૂનવાડ (તા. છોટાઉદેપુર) , 10 5 બ્લેકપૂલનો ટાવર , 11 5 કચ્છ જિલ્લો , 12 4 સીંગળાજા , 13 4 રીંછવેલ (તા. છોટાઉદેપુર) , 14 4 રાયસીંગપુરા (હરવાંટ) , 15 4 પુનીયાવાંટ , 16 4 પોટીયા (તા. છોટાઉદેપુર) , 17 4 પીપલેજ (તા. છોટાઉદેપુર) , 18 4 ઓઢી (તા. છોટાઉદેપુર) , 19 4 ઓડી (તા. છોટાઉદેપુર) , 20 4 નવાગામ (તા. છોટાઉદેપુર) , 21 4 નાની સાધલી , 22 4 સનાડા (તા. છોટાઉદેપુર) , 23 4 સીલોદ (તા. છોટાઉદેપુર) , 24 4 પંડિત રામ નારાયણ , 25 4 વિશ્વ કાચબા દિવસ

set 2009: 1 3 એલિફન્ટાની ગુફાઓ , 2 3 તૌરાત , 3 3 સિંગાપુર , 4 3 નબીપુર , 5 3 વામકુક્ષિ , 6 3 ઈમાન , 7 3 માઉન્ટ એવરેસ્ટ , 8 3 નમાજ઼ , 9 3 અરવિંદ આશ્રમ , 10 3 ઇસ્લામ , 11 2 હઠીસિંહનાં દેરા , 12 2 વિદ્યા બાલન , 13 2 આસો સુદ ૮ , 14 2 અર્ધનારીશ્વર , 15 2 આકાશગંગા , 16 2 કચ્છનો અખાત , 17 2 વચનામૃત , 18 2 દુર્વાસા ઋષિ , 19 2 મનોવિજ્ઞાન , 20 2 એસોટેરિક , 21 2 પ્રારંભિક જાહેર ભરણું (આઈપીઓ) , 22 2 બાળગીતો , 23 2 કવ્વાલી , 24 2 અઝેરબીજાન , 25 2 આર્મેનિયા

out 2009: 1 4 રોટલી , 2 3 ધારી , 3 3 ગીગાસણ , 4 3 મનુષ્ય ગૌરવદિન , 5 3 સ્વામિનારાયણ સંપ્રદાય , 6 3 ભારતનાં વિશ્વ ધરોહર સ્થળો , 7 3 ભારત , 8 2 લોદરા , 9 2 મહાબલીપુરમ , 10 2 હમ્પી , 11 2 કારતક સુદ ૧૦ , 12 2 છત્રપતિ શિવાજી ટર્મિનસ , 13 2 લોહલંગરી આશ્રમ (ગોંડલ) , 14 2 છપિયા , 15 2 ફૉકલેન્ડ ટાપુઓ , 16 2 બોલીવિયા , 17 2 સ્વિત્ઝરલૅન્ડ , 18 2 નિત્યાનંદ સ્વામી , 19 2 ઓક્ટોબર ૧૨ , 20 2 ઓક્ટોબર ૧૧ , 21 2 મોલ્દોવા , 22 2 વાસદ (તા. આણંદ) , 23 2 શરદ પૂર્ણિમા , 24 2 આસો સુદ ૧૫ , 25 2 લક્ઝેમ્બર્ગ

nov 2009: 1 3 મહાબોધિ મંદિર , 2 3 વાયુ , 3 3 મીરાંબાઈ , 4 2 ગળધરા , 5 2 ચંદ્રયાન-૨ , 6 2 કારતક વદ ૦)) , 7 2 જિહાદ , 8 2 કારતક વદ ૭ , 9 2 દશરથ , 10 2 ઇલોરાની ગુફાઓ , 11 2 ભારતની પર્વતીય રેલ્વે , 12 2 પત્તાદકલ , 13 2 ભીમ બેટકાની ગુફાઓ , 14 2 મહાબલીપુરમ , 15 2 ખજુરાહો , 16 2 નદીસર (તા. ગોધરા) , 17 2 જૈન ધર્મ , 18 2 વેડચ (તા.જંબુસર) , 19 2 દીવા (તા.અંકલેશ્વર) , 20 2 મોહણી(તા.ચોર્યાસી) , 21 2 મૈથિલીશરણ ગુપ્ત , 22 2 ધામણ , 23 2 ચામુંડા , 24 2 ભારતનાં વિશ્વ ધરોહર સ્થળો , 25 2 મહેમદાવાદ

dez 2009: 1 3 ઉસ્તીયા (તા. અબડાસા) , 2 3 ગીગાસણ , 3 3 નારગોલ , 4 3 અબ્દુલ કલામ , 5 3 જંબુસર , 6 2 પક્ષી , 7 2 ક્રિકેટનું મેદાન , 8 2 ડિસેમ્બર ૨૫ , 9 2 મનોવિષ્લેષણ , 10 2 ડિસેમ્બર ૧૯ , 11 2 કૃષિ , 12 2 તોરણીયા , 13 2 જળ , 14 2 ઓપન શોર્ટેસ્ટ પાથ ફર્સ્ટ , 15 2 અનિદ્રા , 16 2 ડિસેમ્બર ૧૭ , 17 2 સ્લમડોગ મિલિયોનેર , 18 2 ફિઝિયોથેરાપી , 19 2 પીપળો , 20 2 રૂપિયાપુરા , 21 2 નંદાદેવી રાષ્ટ્રીય ઉદ્યાન , 22 2 માનસ રાષ્ટ્રીય ઉદ્યાન , 23 2 કેવલાદેવ રાષ્ટ્રીય ઉદ્યાન , 24 2 કાઝીરંગા રાષ્ટ્રીય ઉદ્યાન , 25 2 અજંતાની ગુફાઓ

jan 2010: 1 3 આમેરનો કિલ્લો , 2 3 ઇએમઇ મંદિર , 3 3 લહેરીપુરા દરવાજા , 4 3 સયાજી બાગ (કમાટી બાગ) , 5 3 હવા મહેલ , 6 3 વાંસદા રાષ્ટ્રીય ઉદ્યાન , 7 3 દરિયાઈ રાષ્ટ્રીય ઉદ્યાન અને અભયારણ્ય , 8 3 ક્રિસમસ દ્વીપ , 9 3 સુએઝ નહેર , 10 3 જય વસાવડા , 11 2 કુંભ મેળો , 12 2 મહારાજા ફતેહસિંહ મ્યુજીયમ , 13 2 અશોક કુરજીભાઇ પટેલ , 14 2 ચેતેશ્વર પુજારા , 15 2 જલ મહેલ , 16 2 વિશ્વામિત્રી નદી , 17 2 નજર બાગ મહેલ , 18 2 કીર્તિ મંદિર, વડોદરા , 19 2 સરદાર પટેલ પ્લેનેટેરીયમ , 20 2 ઈંડિયા ગેટ , 21 2 રણછોડરાય , 22 2 પ્રાણી , 23 2 રોક ગાર્ડન , 24 2 સુવર્ણ મંદિર, અમૃતસર , 25 2 જાન્યુઆરી ૧૫

fev 2010: 1 4 તુલસી , 2 4 ગુજરાત , 3 3 ગળતેશ્વર , 4 3 સંપ્રદાય , 5 3 પાનકી , 6 3 રણછોડરાય , 7 3 ભારત , 8 3 ડાકોર , 9 3 મહાભારત , 10 2 આતંકવાદ , 11 2 અસોસિએશન ફુટબોલ , 12 2 પ્રાગજી ભગત , 13 2 સેવપુરી , 14 2 સયાજી સરોવર , 15 2 કોથમીર-મરચાંની ચટણી , 16 2 ઈદડાં , 17 2 જે. બી. વોટસન , 18 2 પંડોળી , 19 2 મકબરા (હજીરા) , 20 2 ઝકાત , 21 2 ખંડેરાવ માર્કેટ , 22 2 માંડવી દરવાજા , 23 2 લાલબાગ , 24 2 શેર (તા. માંડલ) , 25 2 વડાપાવ

mar 2010: 1 3 બટાકાં , 2 3 મોગલબારા , 3 3 શેર (તા. માંડલ) , 4 2 એના નિકોલ સ્મિથ , 5 2 મહાકાળેશ્વર જ્યોતિર્લિંગ , 6 2 અરનાથ , 7 2 ચૈત્ર સુદ ૫ , 8 2 થુમ્બા , 9 2 ફાગણ વદ ૧૪ , 10 2 ટૅડગાફળિયુ(ઉમરપાડા) , 11 2 બ્રાહ્મણી નદી , 12 2 બળદ ગાડું , 13 2 જીરું , 14 2 કણભા (તા.કરજણ) , 15 2 શક્કરીયાં , 16 2 ડાંગર , 17 2 કામલી , 18 2 ખારા રૂપાલ , 19 2 ધાંધુસણ , 20 2 દેદીયાસણ , 21 2 આખજ , 22 2 દીવાનપુરા-અલીયાસ-અપાપુરા , 23 2 મેમદપુર (તા. જોટાણા) , 24 2 વીરસોડા (તા. જોટાણા) , 25 2 હાડવી

abr 2010: 1 3 લીંભોઈ , 2 3 ખારવા , 3 3 વલ્લભ વિદ્યાનગર , 4 3 સ્વામિનારાયણ સંપ્રદાય , 5 3 ઉચ્છલ , 6 3 સુરત , 7 2 બેગુની , 8 2 વિક્રમાદિત્ય , 9 2 ખીચડી , 10 2 કફોત્પાદક ગ્રંથિ , 11 2 રવાનો શીરો , 12 2 દૂધપાક , 13 2 સંદેશ , 14 2 દિવ્ય ભાસ્કર , 15 2 બરડીયા (તા. વિસાવદર) , 16 2 ભાગળ , 17 2 સુરતી બોલી , 18 2 ગામીત બોલી , 19 2 બોલી , 20 2 ભક્તિવેદાંત બુક ટ્રસ્ટ , 21 2 એ.સી. ભક્તિવેદાંત સ્વામી પ્રભુપાદ , 22 2 માર્કની લખેલી સુવાર્તા , 23 2 કડવા પાટીદારોની પેટા જ્ઞાતિ , 24 2 હરિલાલ ઉપાધ્યાય , 25 2 નરસિંહ

mai 2010: 1 3 સમરસ ગ્રામ પંચાયત , 2 3 ચેવડો , 3 3 ગૂગલ અનુવાદ , 4 3 કચ્છ જિલ્લો , 5 3 સુરત , 6 2 પરોઠા , 7 2 મિસળ , 8 2 એચએએલ તેજસ , 9 2 રોહિણી , 10 2 કૃષ્ણદાસ કવિરાજ , 11 2 ચૈતન્ય ચરિતામૃત , 12 2 જયપતાકા સ્વામી , 13 2 સંન્યાસ , 14 2 ભક્તિબલ્લભ તીર્થ ગોસ્વામી મહારાજ , 15 2 શુભા મુદ્ગલ , 16 2 તમાકુની ખળી , 17 2 થાળી , 18 2 જપમાળા , 19 2 બ્લેક સબાથ , 20 2 લોકનાથ સ્વામી મહારાજ , 21 2 ગોપાલ કૃષ્ણ ગોસ્વામી , 22 2 રાધાનાથ સ્વામી , 23 2 ડૉ. જીવરાજ મહેતા , 24 2 ગોપીપુરા , 25 2 લિંભોઇ

jun 2010: 1 3 મગની દાળનો શીરો , 2 3 ટાવર ઓફ લંડન , 3 3 કુલેર , 4 3 પેંડા , 5 3 દુધીનો હલવો , 6 3 વાવ , 7 3 ઇએમઇ મંદિર , 8 3 રતનપુર (કાંટડી) , 9 3 ગુજરાતી ભોજન , 10 2 અગ્રસેન , 11 2 પાલિ ભાષા , 12 2 ફૂલવડી , 13 2 પૌંઆ , 14 2 સમોસા , 15 2 શરીર વૃદ્ધી અંતઃસ્ત્રાવ , 16 2 કચોરી , 17 2 પંડિત દીનદયાળ પેટ્રોલિયમ યુનિવર્સિટી , 18 2 ગોળ , 19 2 ગુર્જીય્ફ , 20 2 ભગવદ્ દર્શન , 21 2 લેધરબેક કાચબો , 22 2 મેઘ , 23 2 સૈફ અલી ખાન , 24 2 સેવ , 25 2 બરફી

jul 2010: 1 3 રંગાવલી નદી , 2 3 દેવ-ચાંદની નદી , 3 3 આંકડો (વનસ્પતિ) , 4 3 ઝુલાસણ (તા. કડી) , 5 3 હરેલા ઉત્સવ , 6 3 અશોક ચક્ર , 7 3 આદમ અને હવા , 8 3 અમૃતા શેરગિલ , 9 3 રૂપાયતન આશ્રમશાળા , 10 3 યતી (હિમ માનવ) , 11 3 અગસ્ત્ય , 12 3 ગુજરાતી સાહિત્યકારો , 13 2 રુથ , 14 2 મીંઢોળા નદી , 15 2 ઇબ્રાહિમ , 16 2 કનોડા (તા. બહુચરાજી) , 17 2 ઇંગ્લેન્ડના એલિઝાબેથ પ્રથમ , 18 2 રવિ શંકર , 19 2 ધૌમ્ય , 20 2 શૃંગ , 21 2 ફ્રેન્ક લેમ્પાર્ડ , 22 2 રાપ્તી પ્રાંત (નેપાળ) , 23 2 ધવલાગિરી પ્રાંત (નેપાળ) , 24 2 લુમ્બિની પ્રાંત (નેપાળ) , 25 2 ગંડકી પ્રાંત (નેપાળ)

ago 2010: 1 4 શીખ , 2 4 દાલ બાટી , 3 4 મનમોહન સિંહ , 4 3 દૂરદર્શન , 5 3 ક્રોપ સર્કલ , 6 3 માછલીઘર , 7 3 શિક્ષક , 8 3 ઊંડ નદી , 9 3 દઢવાવ (તા. વિજયનગર) , 10 3 ભડીયાદ (તા. ધંધુકા) , 11 3 પૂ. મોટા , 12 3 કૃષ્ણ , 13 2 પિયાસણ (બતક) , 14 2 આન્દ્રે અગાસી , 15 2 મેનહટન , 16 2 ઑક્સફર્ડ વિશ્વવિદ્યાલય , 17 2 મહુડો , 18 2 જામીનગીરીઓ , 19 2 ભારતીય વાનગીઓ , 20 2 હ્યુસ્ટન , 21 2 ઇન્ડિયાના , 22 2 એમિથિસ્ટ , 23 2 ન્યાયશાસ્ત્ર , 24 2 ફોર્બ્સ , 25 2 બ્રુસ સ્પ્રિન્ગસ્ટીન

set 2010: 1 6 જાપાન , 2 4 ટિમ્બક્ટુ , 3 4 એ. આર. રહેમાન , 4 3 સોનલવા , 5 3 સ્ટેનફોર્ડ યુનિવર્સિટી , 6 3 વાળ ખરવા , 7 3 જયોર્જ સોરોસ , 8 3 નર્ક , 9 3 ચેસ્ટર કાર્લસન , 10 3 સોલોમન , 11 3 પાણી , 12 3 સરઢવ (તા. ગાંધીનગર) , 13 3 યુ.કે. પોસ્ટકોડ્સ , 14 3 ઓક્લાહોમા , 15 3 ૧૯૬૨નું ભારત-ચીન યુદ્ધ , 16 3 ચેરાપુંજી , 17 3 પાટણ , 18 3 ગુજરાતી , 19 2 કાંડુ (શરીર) , 20 2 એબીએન એમ્રો , 21 2 રાહુલ બજાજ , 22 2 સ્થાનકવાસી , 23 2 અન્ના કુર્નિકોવા , 24 2 વિરમપુર (તા. અમીરગઢ) , 25 2 ધ પ્રોડિજિ

out 2010: 1 3 એર ઈન્ડિયા ફ્લાઇટ ૧૮૨ , 2 3 કોર્ન , 3 3 ગ્રીક મૂળાક્ષરો , 4 3 ધનતેરશ , 5 3 પીરોજી માખીમાર , 6 3 દિવાળી , 7 3 માળીયા હાટીના , 8 3 મહાત્મા ગાંધી , 9 2 લાઓત્સે , 10 2 સિમા ગુઆંગ , 11 2 શાલીગ્રામ , 12 2 સીમા સુરક્ષા દળ , 13 2 પહાડિયા જનજાતિ , 14 2 શૈલી , 15 2 પીડોફિલિયા (બાળ યૌનશોષણ) , 16 2 હુઆંગ ઝીયાન-ફાન , 17 2 હરિવંશ , 18 2 સિમા કીઆન , 19 2 ડોનાલ્ડ ડક , 20 2 મિનેપોલિસ , 21 2 એલિસ ઇન ચેઇન્સ , 22 2 કેન્સાસ , 23 2 એલન શીયરર , 24 2 બજરંગ દળ , 25 2 સંચય

nov 2010: 1 3 પર્યાયોક્તિ , 2 3 કેસ્પિયન સમુદ્ર , 3 3 ઘડિયાલ , 4 3 આહિર , 5 2 કાતરા (ઈયળ) , 6 2 પોર્ટલેન્ડ, ઑરેગોન , 7 2 ચિત્રકૂટ ધામ , 8 2 પરસ્પરોપગ્રહો જીવાનામ્ , 9 2 સંસ્કૃતિ , 10 2 થોર , 11 2 ચિત્તભ્રમણા , 12 2 બ્લૂઝ , 13 2 સત્રીયા નૃત્ય , 14 2 પેટન્ટ , 15 2 સિટીગ્રુપ , 16 2 કપડાં , 17 2 નિવસન તંત્ર , 18 2 મદ્યાર્ક યુક્ત પીણું , 19 2 એશિયાઈ રમતોત્સવ , 20 2 એશિયન રમતોત્સવ ૨૦૧૦ , 21 2 કાળા મરી , 22 2 સિસ્કો , 23 2 કુપોષણ , 24 2 અનુકૂલન , 25 2 કાળો સમુદ્ર

dez 2010: 1 3 પેન્શન , 2 3 મડાણા ડાંગીયા (તા. પાલનપુર) , 3 3 વિલવણીકરણ , 4 3 સુવર્ણ માનક , 5 3 ફેડએક્સ , 6 3 વિંધ્યાચલ , 7 3 સૂર્યમંદિર, મોઢેરા , 8 3 વચનામૃત , 9 3 કૃષ્ણ વિવર , 10 3 પાલનપુર , 11 3 ચીન , 12 2 ઊન , 13 2 વિષ્ણુ સહસ્રનામ , 14 2 વાયરલેસ સુરક્ષા , 15 2 જળ શુદ્ધિકરણ , 16 2 સ્વચ્છતા , 17 2 હથિયારો , 18 2 વિટામિન બી૬ , 19 2 મેરેથોન , 20 2 ટ્યૂલિપ , 21 2 ઓર્લાન્ડો, ફ્લોરિડા , 22 2 કૅટરિના કૈફ , 23 2 કનિષ્ક , 24 2 યુનિલિવર , 25 2 કોલંબિયા, દક્ષિણ કેરોલિના

jan 2011: 1 5 પ્રાથમિક શાળા , 2 4 ડી. ડી. કૌશામ્બી , 3 3 એસ. એમ. કૃષ્ણ , 4 3 મકડાલા (તા. લાખણી) , 5 3 જુલિયન અસાંજે , 6 3 ગોળવી (તા. દિયોદર) , 7 3 ખારાખોડા (તા. થરાદ) , 8 3 ઉમરેઠ , 9 3 દસ્ક્રોઇ , 10 3 હિંદુ ધર્મ , 11 3 સ્વામિનારાયણ , 12 3 ભારત , 13 3 સુરત , 14 2 અર્થીંગ , 15 2 વિદ્યુતજનીન , 16 2 ચુંબકીયક્ષેત્ર , 17 2 મડકરી નાયક , 18 2 કિરણ મઝુમદાર-શો , 19 2 ગિનિ પિગ , 20 2 યુનાઇટેડ સ્ટેટ્સ આર્મી , 21 2 સંજીવ કુમાર , 22 2 તમિલનાડુનો ઈતિહાસ , 23 2 સર્વમિત્ર સિકરી , 24 2 એમપીથ્રી , 25 2 ચિરોડા (રાજપરા)

fev 2011: 1 4 સાલ્ઝબર્ગ , 2 4 મેઘપુર , 3 4 નરેન્દ્ર મોદી , 4 3 પ્રણવ મુખર્જી , 5 3 મૃણાલ સેન , 6 3 સામાજિક સાહસિકતા , 7 3 મોહમ્મદ રફી , 8 3 યુનિક આઇડેન્ટિફિકેશન નંબર , 9 3 ૩જી , 10 3 સ્વયં-સહાયક જૂથ (નાણાં વ્યવસ્થા) , 11 3 નિરદ સી. ચૌધુરી , 12 3 બિરજુ મહારાજ , 13 3 અપર્ણા સેન , 14 3 ૨-જી સ્પેક્ટ્રમ કૌભાંડ , 15 3 મેજર ડિપ્રેસિવ ડિસઓર્ડર , 16 3 દ્વિસંગી તારો , 17 3 ઈન્ટરનેટ એક્ટીવિઝમ (ચળવળ) , 18 3 મુનસર તલાવ, વિરમગામ , 19 3 નોર્ધન આયર્લેન્ડ , 20 3 રજકો , 21 3 માઇક્રોસોફ્ટ ઓફિસ ૨૦૦૭ , 22 3 ઈન્સીડ , 23 3 મકડાલા (તા. લાખણી) , 24 3 કોદરામ (તા. વડગામ) , 25 3 લોહી

mar 2011: 1 4 ઍલન ટ્યુરિંગ , 2 3 યશવંત સિન્હા , 3 3 જાણદી (તા. થરાદ) , 4 3 ધારોલી (તા.ઝઘડીયા) , 5 3 કકવાડીદાંતી , 6 3 બાલાસિનોર , 7 3 પદમડુંગરી , 8 3 રાજકોટ , 9 2 એસ્સાર ગ્રુપ , 10 2 લૅરી પેજ , 11 2 ભારતીય ઇસ્પાત પ્રાધિકરણ લિમિટેડ , 12 2 બ્રાયન લારા , 13 2 ગૅરી કિર્સ્ટન , 14 2 જામા મસ્જિદ, દિલ્હી , 15 2 ભારતનું સર્વોચ્ચ ન્યાયાલય , 16 2 એન્ડ્રુ કાર્નેગી , 17 2 રૅનબૅક્સી લેબોરેટરીઝ લિમિટેડ , 18 2 આર. કે. નારાયણ , 19 2 હિન્દુસ્તાન પેટ્રોલિયમ , 20 2 ટેક મહિન્દ્રા , 21 2 લાલા લાજપતરાય , 22 2 ટાટા ટી , 23 2 વિરપુર (તા. જેતપુર) , 24 2 ભારતીય સંસદ , 25 2 બૌદ્ધ ગુફાઓ, ખંભાલીડા

abr 2011: 1 3 હિલેરી ક્લિન્ટન , 2 3 કાનજી સ્વામી , 3 3 તારંગા , 4 3 બાષ્પોત્સર્જન , 5 3 સાકરિયા (તા. મોડાસા) , 6 3 સાંકલી (તા. ગોધરા) , 7 3 રફાળા,તા.રાજકોટ , 8 3 ઇસરો , 9 3 ઈન્દ્રા નૂયી , 10 3 સુરેન્દ્રનગર જિલ્લો , 11 3 વડોદરા , 12 2 સેર્ગેઈ બ્રિન , 13 2 અળવી (વનસ્પતિ) , 14 2 રાઈતું , 15 2 પાલમપુર , 16 2 ઓનલાઈન વિજ્ઞાપન , 17 2 સેમસંગ , 18 2 એસ.ડી. બર્મન , 19 2 ખાંડવપ્રસ્થ , 20 2 બાલોતા (તા.હાંસોટ) , 21 2 અણ્ણા હઝારે , 22 2 મસૂરી , 23 2 તરબૂચ , 24 2 પ્રભાતદેવજી , 25 2 ખાખી જાળીયા (તા. ઉપલેટા)

mai 2011: 1 3 હર્ષદ , 2 3 ગાંધવી (તા. કલ્યાણપુર) , 3 3 ગોરાણા (તા. કલ્યાણપુર) , 4 3 આશિયાવદર (તા. કલ્યાણપુર) , 5 3 હોલો , 6 3 કતાર (અરબસ્તાન) , 7 3 શ્વેતા નંદા , 8 3 દાસી જીવણ , 9 3 નરસિંહ મહેતા , 10 2 જેપુર (તા. કલ્યાણપુર) , 11 2 પટેલકા (તા. કલ્યાણપુર) , 12 2 લાંબા (તા. કલ્યાણપુર) , 13 2 રાણ (તા. કલ્યાણપુર) , 14 2 રાણપરડા (તા. કલ્યાણપુર) , 15 2 નગડિયા (તા. કલ્યાણપુર) , 16 2 હનુમાનધાર , 17 2 બારિયાધાર (તા. કલ્યાણપુર) , 18 2 જામ રાવલ (તા. કલ્યાણપુર) , 19 2 સુર્યાવદર (તા. કલ્યાણપુર) , 20 2 ટંકારિયા (તા. કલ્યાણપુર) , 21 2 ભાટિયા (તા. કલ્યાણપુર) , 22 2 ડાંગરવડ (તા. કલ્યાણપુર) , 23 2 નાણાકીય વર્ષ , 24 2 ચાઇનીઝ ભાષા , 25 2 સ્વાઝીલેન્ડ

jun 2011: 1 3 પડાણા (તા. લાલપુર) , 2 3 ફિંગર ઇલેવન , 3 3 પ્રભાશંકર માસ્તર , 4 3 સ્પેન , 5 3 ઝવેરચંદ મેઘાણી , 6 2 નરગીસ , 7 2 ઇન્ટેલ કોર્પોરેશન , 8 2 નાઈટ્સ ટેમ્પ્લર , 9 2 હાથીના પગ તળે દેહાંતદંડ , 10 2 વિકેટ કીપર , 11 2 મહાશ્વેતા દેવી , 12 2 હલવો , 13 2 ભારતમાં પરીવહન , 14 2 રફેલ નડાલ , 15 2 એલર્જી , 16 2 દિગીશ મહેતા , 17 2 હીમોફીલિયા , 18 2 હૃદયસ્તંભતા , 19 2 હૃદયરોગનો હુમલો , 20 2 બાંયધરી (વોરંટી) , 21 2 પ્રિફર્ડ સ્ટોક , 22 2 હર્ષદ (તા. કલ્યાણપુર) , 23 2 ચાર્લ્સ લુસિઅન બોનાપાર્ટ , 24 2 ભારતીય ઓલિમ્પિક સંઘ , 25 2 ઝડપી ગોલંદાજી

jul 2011: 1 2 પલસદરી (જિ. રાયગઢ) , 2 2 પદ્મનાભસ્વામી મંદિર , 3 2 બલરાજ સહાની , 4 2 દેરડી (તા. ગોંડલ) , 5 2 લાભશંકર ઠાકર , 6 2 અડપોદરા , 7 2 સાયરા (તા. મોડાસા) , 8 2 કંબોયા (તા. ઇડર) , 9 2 થુવાવી , 10 2 બ્રાઝિલ , 11 2 ઉદય મર્ચંટ , 12 2 હળવદ , 13 2 કાલાવડ , 14 2 ભીસ્યા , 15 2 વડનગર , 16 2 નર્મદ , 17 2 ભાવનગર , 18 1 રામફળ

ago 2011: 1 4 જગદ્ગુરુ રામભદ્રાચાર્ય , 2 2 શરબત , 3 2 માથક (તા. હળવદ) , 4 2 ચુરાચાંદપુર , 5 2 આર્ય સમાજ , 6 2 અજાણી ઊડતી વસ્તુ , 7 2 ધર્મજ , 8 2 પ્રિયંકા ચોપરા , 9 2 ઇડર , 10 2 મુખપૃષ્ઠ , 11 1 મહેસૂલી તલાટી

set 2011: 1 3 હંગ્રી પેઢીના , 2 3 સુરજપુરા (તા. હિંમતનગર) , 3 2 સોરઠા (તા. કાલાવડ) , 4 2 નાની ભગેડી (તા. કાલાવડ) , 5 2 પેટન્ટ , 6 2 માતપુર (તા. પાટણ) , 7 2 કનોડા (તા. બહુચરાજી) , 8 2 ઉપાધ્યાય , 9 2 પાલેજ , 10 2 લોકગીત , 11 2 રાયપુર (છત્તીસગઢ) , 12 2 યુરેનસ (ગ્રહ) , 13 2 સુરત , 14 1 મોભીયાણા નવા (તા. રાજુલા)

out 2011: 1 3 ભુટકિયા , 2 3 લોથલ , 3 3 દત્તવાડા , 4 3 તાપી જિલ્લો , 5 2 આરઝી હકૂમત , 6 2 ઉર્વીશ કોઠારી , 7 2 ઈટ્રીયમ , 8 2 બ્રોમિન , 9 2 સેલિનીયમ , 10 2 વર્ણાતુ , 11 2 વેનેડિયમ , 12 2 ટાઇટેનિયમ , 13 2 એશિયાઇ ચિત્તો , 14 2 ગંધક , 15 2 મેગ્નેશિયમ , 16 2 નિકલ , 17 2 વૈશ્વિક આરોગ્ય , 18 2 ભાણ સાહેબ , 19 2 ખામતા (તા. પડધરી) , 20 2 નોલી (તા. સાયલા) , 21 2 પટોસણ (તા. પાલનપુર) , 22 2 કનોડા (તા. બહુચરાજી) , 23 2 રતુભાઇ અદાણી , 24 2 વ્યવસાય , 25 2 કામલી

nov 2011: 1 4 બ્લેક સબાથ , 2 3 સુબ્રમણ્યન ચંદ્રશેખર , 3 3 ફીજી હિન્દી , 4 3 પાનસડા (તા. બાબરા) , 5 3 ભુટકિયા , 6 3 ગુજરાતી સાહિત્ય પરિષદ , 7 3 ઘંટીયાળી (તા. થરાદ) , 8 3 જેનપુર (તા. પ્રાંતિજ) , 9 3 દત્તવાડા , 10 3 રાપર , 11 3 ધોળાવીરા , 12 3 ખગોળશાસ્ત્ર , 13 3 મુંબઈ , 14 2 ચારણ , 15 2 નારાયણ સરોવર અભયારણ્ય , 16 2 રીડગુજરાતી.કોમ , 17 2 ભીમડાદ (તા.ગઢડા) , 18 2 પેજ રેન્ક , 19 2 અર્બિયમ , 20 2 યોગસૂત્ર , 21 2 ગોરખનાથ , 22 2 નેશનલ સ્ટોક એક્સચેન્જ , 23 2 ખારી જળાશય (ભુટકિયા) , 24 2 ટેલુરિયમ , 25 2 ટીન

dez 2011: 1 4 માતપુર (તા. પાટણ) , 2 3 મહારાજા સયાજીરાવ ગાયકવાડ ત્રીજા , 3 3 ધોળીધજા ડેમ , 4 3 રેશમ , 5 3 સલામત મૈથુન , 6 3 કાર્તિકેય , 7 3 મૌલાના આઝાદ , 8 3 નેસડી (તા. સાવરકુંડલા) , 9 3 સુરખાબ , 10 3 ખોખલા (તા. ચાણસ્મા) , 11 3 વાંચ (તા. દસ્ક્રોઇ) , 12 3 કુરાન , 13 3 દેથલી , 14 3 એરથાણ , 15 3 યમનોત્રી , 16 3 સુત્રાપાડા , 17 3 જસદણ , 18 3 લીંબડી , 19 3 ખગોળશાસ્ત્ર , 20 3 ભાવનગર , 21 3 મહાભારત , 22 3 ગુજરાતી , 23 2 બકાસુર , 24 2 શ્રીહરિકોટા , 25 2 ઘાંચી

jan 2012: 1 4 મહેશ ભટ્ટ , 2 4 આંકડો (વનસ્પતિ) , 3 4 ગોઝારીયા , 4 4 અમદાવાદ , 5 3 જાંબુઘોડા અભયારણ્ય , 6 3 છૂંદો , 7 3 અમૂલ , 8 3 નેસડી (તા. સાવરકુંડલા) , 9 3 પાણીપૂરી , 10 3 જામા મસ્જિદ, અમદાવાદ , 11 3 ગીર રાષ્ટ્રીય ઉદ્યાન અને અભયારણ્ય , 12 3 ઉદવાડા , 13 3 નિશાના , 14 3 ડેબિયન , 15 3 પીરમબેટ , 16 3 પાલનપુર , 17 3 રાજ્ય સભા , 18 3 કાંકરિયા તળાવ , 19 2 પ્રભાશંકર પટ્ટણી , 20 2 કોઠી , 21 2 તલાટી-કમ-મંત્રી , 22 2 ચિત્રા (તા. ભાવનગર) , 23 2 દ્રાક્ષાસવ , 24 2 દીવાદાંડી , 25 2 જામા મસ્જિદ

fev 2012: 1 5 અમદાવાદ , 2 4 અલકા યાજ્ઞિક , 3 4 લેઉવા પટેલ , 4 3 શકરપુર (તા.ખંભાત) , 5 3 સોનૂ નિગમ , 6 3 સુનિધિ ચૌહાણ , 7 3 આહિર , 8 3 અક્ષરધામ (દિલ્હી) , 9 3 ગુરુત્વાકર્ષણ , 10 3 મહાત્મા ગાંધી , 11 2 વિદ્યુત ક્ષેત્ર , 12 2 આલિશા ચિનોઇ , 13 2 નિરમા યુનિવર્સિટી , 14 2 ડૉ.કમલા બેનિવાલ , 15 2 ભીમપુરા (તા. તલોદ) , 16 2 તેરા , 17 2 અંબાડી , 18 2 પપૈયાં , 19 2 અમૂલ , 20 2 મહેશ ભટ્ટ , 21 2 વાગડીયા (તા. જામનગર) , 22 2 પીપર (તા. કાલાવડ) , 23 2 કાળો કોશી , 24 2 ખીલ (રોગ) , 25 2 દૈયપ (તા. વાવ)

mar 2012: 1 4 ભીમાશંકર , 2 4 ગુજરાતની નદીઓની યાદી , 3 4 નરેન્દ્ર મોદી , 4 3 વિદ્યુત ક્ષેત્ર , 5 3 સાયના નેહવાલ , 6 3 ખડાણા (તા. પેટલાદ) , 7 3 ક્ષત્રિય , 8 2 તાલુકા વિકાસ અધિકારી , 9 2 ધુંઆધાર ધોધ , 10 2 આરસ ખડકો , 11 2 સ્ટ્રોબેરી , 12 2 પીએચપી , 13 2 ફ્લોપી ડિસ્ક , 14 2 ઇમેજ સ્કેનર , 15 2 મણિશંકર રત્નજી ભટ્ટ , 16 2 નૃસિંહપ્રસાદ ભટ્ટ , 17 2 નંદકુમાર પાઠક , 18 2 શેખ આદમ આબુવાલા , 19 2 હિંમતલાલ અંજારિયા , 20 2 હાજી અલારખિયા , 21 2 ભૂપેશ અધ્વર્યુ , 22 2 આયેશા ટાકિયા , 23 2 મુકેશ અમૃતલાલ આચાર્ય , 24 2 પપૈયાં , 25 2 રીડગુજરાતી.કોમ

abr 2012: 1 4 કુરુક્ષેત્ર , 2 4 વસ્ત્રાપુર તળાવ , 3 4 ઍફીલ ટાવર , 4 4 ક્ષેત્રફળ , 5 4 અમદાવાદ , 6 3 ગુજરાતના પુરસ્કારો , 7 3 ભૂરિશ્રવા , 8 3 લાલભાઈ દલપતભાઈ ઈજનેરી મહાવિદ્યાલય , 9 3 ધરણીધર , 10 3 છૂંદો , 11 3 જગદ્ગુરુ રામભદ્રાચાર્ય , 12 3 પંડોળી , 13 3 સત્યના પ્રયોગો અથવા આત્મકથા , 14 3 ઝવેરચંદ મેઘાણી , 15 3 રાજકોટ , 16 3 નરેન્દ્ર મોદી , 17 2 જીસ્વાન , 18 2 ધૃષ્ટકેતુ , 19 2 વૃષકેતુ , 20 2 એકમ , 21 2 ગબ્બર , 22 2 સ્વચ્છ ગામ સ્વસ્થ ગામ યોજના , 23 2 દિકરી યોજના , 24 2 મહાત્મા ગાંધી રાષ્ટ્રીય ગ્રામીણ રોજગાર બાહેધરી યોજના , 25 2 રાષ્ટ્રીય ગ્રામીણ રોજગાર બાહેધરી યોજના

mai 2012: 1 5 દીક્ષાભૂમિ , 2 5 તરખંડા , 3 5 અમલનેર , 4 5 ડૉ. ભીમરાવ રામજી આંબેડકર , 5 4 અજમો , 6 4 મહાત્મા જ્યોતિરાવ ફુલે , 7 4 ડૉ.બાબાસાહેબ આંબેડકર , 8 4 અંતરા , 9 4 અમદાવાદ સીટી તાલુકો , 10 4 નાનાભાઈ ભટ્ટ , 11 3 વિશ્વનાથ ભટ્ટ , 12 3 ડો. બાબાસાહેબ આંબેડકર , 13 3 Portal:સબસ્ટબ કાર્યકારિણી , 14 3 પાળેલાં પશુઓ પર થતી શસ્ત્રક્રિયાની યાદી , 15 3 ખડિયા , 16 3 ભીમાશંકર , 17 3 માધુરી દીક્ષિત , 18 3 પટ્ટદકલ , 19 3 સિદસર (તા. ભાવનગર) , 20 3 રબારી , 21 3 ભૂસ્તરશાસ્ત્રી , 22 3 સપ્તપર્ણી , 23 3 આહિર , 24 3 ખાંટિયાવાંટ , 25 3 ઢીંકવા

jun 2012: 1 6 નરેન્દ્ર મોદી , 2 5 સુહાસી ધામી , 3 4 અમૃતા રાવ , 4 4 મહાભારત , 5 4 ગુજરાત , 6 3 રૂપશંકર ઓઝા , 7 3 શશિન્ ઓઝા , 8 3 કૃષ્ણકાન્ત કડકિયા , 9 3 રામજીભાઈ કડિયા , 10 3 યશવંત કડીકર , 11 3 ધનવંત ઓઝા , 12 3 દિગન્ત ઓઝા , 13 3 તનસુખરાય ઓઝા , 14 3 મીનું એડનવાળા , 15 3 ઉષા ઉપાધ્યાય , 16 3 ઉમર ઉઘરાતદાર , 17 3 વઝીરુદ્દીન અલવી , 18 3 રમણિક અરાલવાળા , 19 3 સ્વામી સચ્ચિદાનંદ , 20 3 રમણ સોની , 21 3 હિમાંશી શેલત , 22 3 ગુલામમોહમ્મદ શેખ , 23 3 ધનંજય શાહ , 24 3 સતીશ વ્યાસ , 25 3 યોગેન્દ્ર વ્યાસ

jul 2012: 1 4 અનુષ્કા શેટ્ટી , 2 4 ધાનેરા તાલુકો , 3 4 ગણદેવી , 4 3 વૈદ્યનાથ જ્યોતિર્લિંગ , 5 3 રોઝાવાડા (તા. કપડવંજ) , 6 3 છોટાઉદેપુર , 7 3 વડગામ , 8 3 ત્રિકમ સાહેબ , 9 3 સોનગઢ , 10 3 વ્યારા , 11 3 કડી , 12 3 ચંદ્રકાંત બક્ષી , 13 3 માંડવી , 14 2 ગરબી , 15 2 તલીયારા , 16 2 બાલુચરી સાડી , 17 2 ખોપાળા (તા.ગઢડા) , 18 2 કાકરાપાર અણુશક્તિ મથક , 19 2 ગઢડા તાલુકો , 20 2 ધણફુલીયા (તા. વંથલી) , 21 2 ચકરી , 22 2 લીંબુનું અથાણું , 23 2 બાપા સીતારામ , 24 2 તાજ ફાર્માસ્યૂટિકલ્સ ગ્રુપ , 25 2 આમરા (તા. જામનગર)

ago 2012: 1 3 એકવાર પિયુને મળવા આવજે , 2 3 વડગામ (તા. દસાડા) , 3 3 સાયના નેહવાલ , 4 3 મહાત્મા ગાંધી , 5 2 જાળીયાળા (તા. લીંબડી) , 6 2 અબડાસા તાલુકો , 7 2 કલ્પના ચાવલા , 8 2 મીથુન ચક્રવર્તી , 9 2 પાયથાગોરસ , 10 2 સઈ , 11 2 મગ , 12 2 જસત , 13 2 ઝારેરા નેસ (તા. રાણાવાવ) , 14 2 હડમતીયા (તા. જામનગર) , 15 2 ધોળી (તા. લીંબડી) , 16 2 નીરજી , 17 2 ક્ષારાતુ , 18 2 હજારી પ્રસાદ દ્વિવેદી , 19 2 અરજણસર (તા. રાધનપુર) , 20 2 કોલીવાડા (તા. સાંતલપુર) , 21 2 મિસળ , 22 2 ભારતનાં રાજ્યોના મુખ્ય મંત્રીઓ , 23 2 ભોળાદ (તા. ધોળકા) , 24 2 ડિસેમ્બર ૨૨ , 25 2 આહિર

set 2012: 1 4 શ્રી હરિલીલામૃત , 2 4 ઇ-મેઇલ , 3 4 અબ્દુલ કલામ , 4 4 સ્વામિનારાયણ , 5 4 ગુજરાતી દૈનિકપત્રોની યાદી , 6 3 દેતાલ ‍(દરબારી) (તા. લાખણી) , 7 3 શીખ , 8 3 ભૂમિતિ , 9 2 TV9 ગુજરાત , 10 2 શ્રી હરિ દિગ્વિજય , 11 2 શ્રી હરિલીલાકલ્પતરુ , 12 2 આકાશવાણી , 13 2 મુઝફ્ફર વંશ , 14 2 વિશ્વ સાક્ષરતા દિન , 15 2 દિવાન બલ્લુભાઇ શાળા , 16 2 ભૌતિક અનુસંધાન પ્રયોગશાળા , 17 2 નાનીધારી , 18 2 ફરેણી , 19 2 અક્ષરધામ (ગાંધીનગર) , 20 2 નિરુપા રોય , 21 2 વીર્ય દાન , 22 2 રાવલા મંડી , 23 2 શિક્ષાપત્રી , 24 2 દીના પાઠક , 25 2 બાલુચરી સાડી

out 2012: 1 3 તારક મેહતા કા ઉલ્ટા ચશ્મા , 2 3 પ્રેમાનંદ , 3 3 નાઈટ્સ ટેમ્પ્લર , 4 3 ભારતીય રૂપિયો , 5 3 અમીયાપુ૨ (તા. બાયડ) , 6 3 ગણોલ (તા. ધોળકા) , 7 3 આનંદપુરા (તા. ધોળકા) , 8 3 બીજું વિશ્વ યુદ્ધ , 9 3 રાજેન્દ્ર શુક્લ , 10 3 બકુલ ત્રિપાઠી , 11 3 મીરાંબાઈ , 12 2 ગુજરાત વિધાનસભા , 13 2 ભારતીય થલસેના , 14 2 ધુમા , 15 2 ગૌરીશંકર ગોવર્ધનરામ જોષી , 16 2 પ્રભાશંકર પટ્ટણી , 17 2 મધુસૂદન પારેખ , 18 2 ગજડી , 19 2 ફુલઝર (તા. વીંછીયા) , 20 2 પ્રણવ મિસ્ત્રી , 21 2 ગુણવંત શાહ , 22 2 તાજપુર કેમ્પ (તા. તલોદ) , 23 2 કૃષ્ણનગર (સાબલી) (તા. ઇડર) , 24 2 રાજાસોરસ , 25 2 ભારતીય ભૂમિસેના

nov 2012: 1 5 ભાઈ બીજ , 2 4 કમ્પ્યુટર નેટવર્ક , 3 4 PHP (પ્રોગ્રામિંગ ભાષા) , 4 4 જાવા (પ્રોગ્રામિંગ ભાષા) , 5 4 અણ્ણા હઝારે , 6 3 કલ્પના (કંપની) , 7 3 પોન્ટી ચઢ્ઢા , 8 3 પાયથોન(પ્રોગ્રામિંગ ભાષા) , 9 3 ગો (પ્રોગ્રામિંગ ભાષા) , 10 3 કોમ્પ્યુટર નેટવર્ક , 11 3 C++(પ્રોગ્રામિંગ ભાષા) , 12 3 તારક મેહતા કા ઉલ્ટા ચશ્મા , 13 3 લાલભાઈ દલપતભાઈ ઈજનેરી મહાવિદ્યાલય , 14 3 પીએચપી , 15 3 પાનેસડા (તા. વાવ) , 16 3 રીબડી (તા. માંડલ) , 17 3 કારતક સુદ ૨ , 18 3 સુખદેવ , 19 3 મોરબી , 20 3 નથુરામ ગોડસે , 21 3 જુનાગઢ , 22 3 અમદાવાદ , 23 2 આઇ.આઇ.એમ. અમદાવાદ , 24 2 તલાશ (ચલચિત્ર) , 25 2 ઇસ પ્યાર કો ક્યા નામ દું?

dez 2012: 1 8 ૨૦૧૨ દિલ્હી બળાત્કાર ઘટના , 2 5 ડેન્ગ્યુ , 3 5 લાલભાઈ દલપતભાઈ ઈજનેરી મહાવિદ્યાલય , 4 5 નરેન્દ્ર મોદી , 5 4 ગુજરાતના પાવનકારી શક્તિપીઠો , 6 4 અમદાવાદની ગુફા , 7 4 અશ્વિની ભટ્ટ , 8 4 આલિશા ચિનોઇ , 9 4 મોરારજી દેસાઈ , 10 4 પાટણ , 11 4 વર્ષા અડાલજા , 12 3 કાજલ ઓઝા-વૈદ્ય , 13 3 સિવિલ હોસ્પિટલ, અમદાવાદ , 14 3 કેશુભાઈ પટેલ , 15 3 સલીમ સુલેમાન , 16 3 વર્ચ્યુઅલાઈઝેશન , 17 3 સેપ્ટ યુનિવર્સીટી , 18 3 કમ્પ્યુટર નેટવર્ક , 19 3 માધુરી દીક્ષિત , 20 3 અણ્ણા હઝારે , 21 3 ગુણવંત શાહ , 22 3 પાણશીણા (તા. લીંબડી) , 23 3 સંડેર (તા. પાટણ) , 24 3 ગુજરાત યુનિવર્સિટી , 25 3 સાણોદા (તા. દહેગામ)

jan 2013: 1 6 વલ્લભભાઈ પટેલ , 2 5 સાબરમતી મેરેથોન , 3 4 કોરોકોરો ટાપુ , 4 4 એરન સ્વાર્ટઝ , 5 4 સરદાર પટેલ રાષ્ટ્રીય મ્યુઝીયમ , 6 4 બારડોલી સત્યાગ્રહ , 7 3 OSI મોડેલ , 8 3 કમલેશ્વર બંધ , 9 3 ભારતીય રાષ્ટ્રીય કોંગ્રેસ , 10 3 કોચરબ આશ્રમ , 11 3 બારડોલી સ્વરાજ આશ્રમ , 12 3 ઈન્ટરનેટ પ્રોટોકોલ સ્યુટ , 13 3 ઓએસઆઈ મોડેલ , 14 3 ગોપાલ કૃષ્ણ ગોખલે , 15 3 મકડાલા (તા. લાખણી) , 16 3 શેત્રુંજી નદી , 17 3 મચ્છુ નદી , 18 3 ગુજરાત , 19 2 જાપાનનો ઇતિહાસ , 20 2 કેદારેશ્વર મંદિર બારડોલી , 21 2 મહેન્દ્ર સિંઘ ધોની , 22 2 ભારતમાં આરોગ્યસંભાળ , 23 2 ચિત્તાગોંગ , 24 2 ઈન્ટરનેટ પ્રોટોકોલ , 25 2 ભારતીય માનક સમય

fev 2013: 1 5 ગુજરાત વિધાનસભા , 2 4 થાણાપીપળી (તા. વંથલી) , 3 4 અમદાવાદ બીઆરટીએસ , 4 3 નેહા શર્મા , 5 3 ચણા , 6 3 ફાઇલ ટ્રાન્સ્ફર પ્રોટોકોલ , 7 3 યાહૂ! , 8 3 નારિયેળ , 9 3 માતાનો મઢ , 10 3 પિસ્તા , 11 3 જાપાનનો ઇતિહાસ , 12 3 વેળવા , 13 3 મગ , 14 3 શેડુભાર (તા. અમરેલી) , 15 3 કડછ (તા. પોરબંદર) , 16 3 દુધીયા (તા. કલ્યાણપુર) , 17 3 ઠાકોર , 18 3 સિન્ડ્રેલા , 19 3 વડગામ , 20 3 મોરબી , 21 2 ચોઘડિયાં , 22 2 કુંવારપાઠું , 23 2 મહેબૂબ દેસાઈ , 24 2 મઠ , 25 2 ટ્યુનિશિયા

mar 2013: 1 5 દોડગામ (તા. થરાદ) , 2 4 વાધગઢ (તા. ધ્રાંગધ્રા) , 3 3 રતાળુ , 4 3 રવીન્દ્ર પ્રભાત , 5 3 મગ , 6 3 રાત્રિ સ્ખલન , 7 3 ટાટા ઈન્ડિગો , 8 3 થરાદ , 9 3 ગુજરાત વિદ્યાપીઠ , 10 2 ૨૦૦૨ ગુજરાત હિંસા , 11 2 રૂબિન ડેવિડ , 12 2 મધર ઇન્ડિયા , 13 2 લુશાળા (તા. વંથલી) , 14 2 ભાટીયા (તા. વંથલી) , 15 2 વાડલા (તા. વંથલી) , 16 2 સ્નેહ દેસાઇ , 17 2 મસુર , 18 2 વડાલ (તા.જુનાગઢ) , 19 2 ગુજરાત વિધાનસભા , 20 2 અડદ , 21 2 ચમારડી (તા. બાબરા) , 22 2 મોણપુર (તા. અમરેલી) , 23 2 સૂરણ , 24 2 અમેરિકન એરલાઇન્સ , 25 2 અંબારડી (તા. જસદણ)

abr 2013: 1 3 મેરી કોમ , 2 3 રવીન્દ્ર પ્રભાત , 3 3 શ્રવણબેલગોડા , 4 3 રામ પ્રસાદ બિસ્મિલ , 5 3 હાંડવો , 6 3 ગીર રાષ્ટ્રીય ઉદ્યાન અને અભયારણ્ય , 7 3 ગુજરાતનો નાથ , 8 2 ફિબોનાકિ , 9 2 ફેસબુક , 10 2 રાયણ , 11 2 નગડીયા (તા. વંથલી) , 12 2 માખીયાળા (તા.જુનાગઢ) , 13 2 મોટા (તા. પાલનપુર) , 14 2 હાડફોડી (તા. ઉપલેટા) , 15 2 વાંગધ્રા (તા. વીંછીયા) , 16 2 બાબા રામદેવ , 17 2 કરોલ (તા. પ્રાંતિજ) , 18 2 રવિન્દ્ર જાડેજા , 19 2 શેરડી , 20 2 ઋત્વિક રોશન , 21 2 કેવડીયા (તા. કપડવંજ) , 22 2 ત્રાજ (તા. માતર) , 23 2 ગોલીડા ‍(તા. રાજકોટ) , 24 2 પ્લેટો , 25 2 દેવાયત પંડિત

mai 2013: 1 4 પૂજ્ય શ્રી મોટા , 2 3 નેપોલિયન હિલ , 3 3 મૂળદાસ , 4 3 નસ્લી વાડિયા , 5 3 નામસ્મરણ , 6 3 ટ્રાન્સપોર્ટ ફોર લંડન , 7 3 દ્રાક્ષ , 8 3 અમૂલ , 9 3 મેડી (તા. અમરેલી) , 10 3 બાબાપુર (તા. અમરેલી) , 11 3 માવજીંજવા (તા. બગસરા) , 12 3 હેબતપુર (તા. દસાડા) , 13 3 મહમદ અલી ઝીણા , 14 3 મકતુપુર (તા. ઉંઝા) , 15 3 ખંભાત , 16 3 દિનકર જોષી , 17 3 મોહરમ , 18 3 વડનગર , 19 3 લંડન , 20 3 હિંદી ભાષા , 21 2 કરીના કપૂર , 22 2 જબ તક હૈ જાન , 23 2 શાહ અબ્દુલ લતીફ ભીતાઈ , 24 2 પ્રિયામણિ , 25 2 મરિઉપોલ

jun 2013: 1 3 હડકવા , 2 3 ઢોલિવુડ , 3 3 મરકી , 4 3 યુનિટ ૭૩૧ , 5 3 દેરાળા (તા.ગઢડા) , 6 3 ગુજરાત વિધાનસભા ચૂંટણી, ૨૦૧૨ , 7 3 મહમદ અલી ઝીણા , 8 3 અડાલજની વાવ , 9 3 સુરેન્દ્રનગર જિલ્લો , 10 3 જામનગર , 11 3 નરેન્દ્ર મોદી , 12 3 નરસિંહ મહેતા , 13 2 ભડલા , 14 2 લખાણકા (તા.ગઢડા) , 15 2 લીંબડીયા (તા.ગઢડા) , 16 2 લીંબાળા (તા.ગઢડા) , 17 2 લીંબાળી (તા.ગઢડા) , 18 2 હામાપર (તા.ગઢડા) , 19 2 હરીપર (તા.ગઢડા) , 20 2 હોળાયા (તા.ગઢડા) , 21 2 ઇંગોરાળા (તા.ગઢડા) , 22 2 ઇંગોરાળા (ખાલસા) (તા.ગઢડા) , 23 2 ઇશ્વરીયા (તા.ગઢડા) , 24 2 ઇતરીયા (તા.ગઢડા) , 25 2 જલાલપુર (તા.ગઢડા)

jul 2013: 1 4 ગુજરાતી દૈનિકપત્રોની યાદી , 2 3 થાના ગલોલ (તા. જેતપુર) , 3 3 જસરા (તા. લાખણી) , 4 3 સુરેન્દ્રનગર જિલ્લો , 5 2 સામાન્ય જ્ઞાન , 6 2 પંચામૃત , 7 2 રાયડો , 8 2 અશેળિયો , 9 2 જગતસિંઘજી મહારાજ , 10 2 ભાગ મિલ્ખા ભાગ , 11 2 હીરાકુડ બંધ , 12 2 કળથી , 13 2 મહાવીર જયંતી , 14 2 ખેરખટ્ટો , 15 2 હંસાબેન મહેતા , 16 2 કરીના કપૂર , 17 2 બોર , 18 2 દૈયડ , 19 2 દોડવીર મિલખા સિંઘ , 20 2 સોમાસર (તા. મુળી) , 21 2 અમૃતા રાવ , 22 2 રજકો , 23 2 કૅટરિના કૈફ , 24 2 આગથળા (તા. લાખણી) , 25 2 બાજરી

ago 2013: 1 4 જુનાગઢ , 2 3 કોદરા , 3 3 પન્ના ધાઈ , 4 3 કોડીનાર , 5 3 નરેન્દ્ર મોદી , 6 2 ચોળાફળી , 7 2 બ્રેમ્પ્ટન, ઓન્ટારીયો , 8 2 ફાફડા , 9 2 લાકડશી , 10 2 તારા માછલી , 11 2 સામો , 12 2 રેડિયો સ્ટુડિયો 54 નેટવર્કના , 13 2 ખીરભવાની મંદિર , 14 2 થાણાપીપળી (તા. વંથલી) , 15 2 ઋગ્વેદ , 16 2 સુર્યપરા (તા. જામનગર) , 17 2 ધ્રોલીયા (તા. ટંકારા) , 18 2 જીવાપર (તા. જસદણ) , 19 2 કારાકાસ , 20 2 એર બસ , 21 2 જેતલવાસણા (તા. વિસનગર) , 22 2 પેંડા , 23 2 જનાલી (તા. ભિલોડા) , 24 2 સંદેશ (અખબાર) , 25 2 શરીર વજન અનુક્રમ

set 2013: 1 6 અમદાવાદ , 2 5 ભાવનગર , 3 4 બખરલા (તા. પોરબંદર) , 4 3 રાયણ , 5 3 શિક્ષક દિન , 6 3 ખીજડો , 7 3 ખાટી આમલી , 8 3 વડ , 9 3 દ્રોણ , 10 3 ડીસા , 11 3 સ્વામી વિવેકાનંદ , 12 3 લીંબુ , 13 3 જામનગર , 14 2 ઇલાયચી , 15 2 ગુજરાતની હસ્તકળાઓ , 16 2 મોટા હરીપુરા (તા. વિરમગામ) , 17 2 બાજ (પક્ષી) , 18 2 આંધળીચાકળ (સર્પ) , 19 2 કપોત કુળ , 20 2 લવિંગ , 21 2 સિંધવ , 22 2 શમીમ દેવ આઝાદ , 23 2 જૂનાગઢ સિંચાઇ વિભાગના જળબંધો , 24 2 જીમ કોર્બેટ , 25 2 અટલ બિહારી વાજપેયી

out 2013: 1 7 અમદાવાદ , 2 4 દરિયાઈ રાષ્ટ્રીય ઉદ્યાન અને અભયારણ્ય , 3 4 આસારામ બાપુ , 4 4 ઝૂલેલાલ , 5 3 પાલક (ભાજી) , 6 3 પાલખ (ભાજી) , 7 3 ચિત્રા (તા. ભાવનગર) , 8 3 ઉંચા કોટડા , 9 3 નારાયણ સરોવર અભયારણ્ય , 10 3 ઢાંક (તા. ઉપલેટા) , 11 3 પાનેસડા (તા. વાવ) , 12 3 ઉતેળીયા (તા. ધોળકા) , 13 3 હેબતપુર (તા. બરવાળા) , 14 3 સાંગાસર (તા. બરવાળા) , 15 3 વેળાવદર કાળિયાર રાષ્ટ્રીય ઉદ્યાન , 16 3 ઇસનપુર મોટા (તા. ગાંધીનગર) , 17 3 મદીના , 18 3 દાહોદ , 19 3 રોજીદ , 20 3 ચેટીચંડ , 21 3 ભાવનગર , 22 2 વસતી ગણતરી ૨૦૧૧ (અમદાવાદ) , 23 2 કુલધારા, રાજસ્થાન , 24 2 જીંજાવદર (તા.ગઢડા) , 25 2 ઉગામેડી (તા.ગઢડા)

nov 2013: 1 4 ઠાકોર , 2 3 સાંપડ (તા. પ્રાંતિજ) , 3 3 કુદરતી આફતો , 4 3 મહુવા , 5 3 શ્રીમદ્ ભગવદ્ ગીતા , 6 3 પાલીતાણા , 7 2 ગુજરાતના ધોરીમાર્ગોની યાદી , 8 2 બુદ્ધ અને તેમનો ધમ્મ , 9 2 પાલક (ભાજી) , 10 2 સતાણા નેસ (તા. પાલીતાણા) , 11 2 વિજાણા નેસ (તા. પાલીતાણા) , 12 2 બોદાણા નેસ (તા. પાલીતાણા) , 13 2 અગિયાળી (તા. સિહોર) , 14 2 વાઘનગર (તા.મહુવા) , 15 2 સમઢીયાળા (પાનબાઇ) (તા. ઉમરાળા) , 16 2 ઇંગોરાળા (તા. ઉમરાળા) , 17 2 બોચડવા (તા. ઉમરાળા) , 18 2 આંબલા (તા. સિહોર) , 19 2 ઘેલડા (તા. જામજોધપુર) , 20 2 દુકાળ , 21 2 ગરીયા (તા. વાંકાનેર) , 22 2 કોલંબો , 23 2 ફલુ (તા. વિજાપુર) , 24 2 વાવ (તા. ઘોઘંબા) , 25 2 સિમાલીયા (તા. ઘોઘંબા)

dez 2013: 1 3 હલદરવા નેસ (તા. વિસાવદર) , 2 3 બારવાનીયા નેસ (તા. વિસાવદર) , 3 3 સામાપોર , 4 3 દાંડી (જલાલપોર) , 5 3 વાછાવડ , 6 2 જાંબુડી નેશ (તા. મેંદરડા) , 7 2 કિલોરીયા નેશ (તા. મેંદરડા) , 8 2 કંથાળા નેશ (તા. મેંદરડા) , 9 2 વિસણવેલ(તા. માળીયા હાટીના) , 10 2 લાંગોદ્રા(તા. માળીયા હાટીના) , 11 2 ઘુમલી(તા. માળીયા હાટીના) , 12 2 દંડેરી(તા. માળીયા હાટીના) , 13 2 ઝડકા(તા. માળીયા હાટીના) , 14 2 આછીદ્રા(તા. માળીયા હાટીના) , 15 2 ઝરીયાવાડા (તા.માંગરોળ) , 16 2 વિરપુર (તા.માંગરોળ) , 17 2 વિરોલ (તા.માંગરોળ) , 18 2 વાડલા (તા.માંગરોળ) , 19 2 થલી (તા.માંગરોળ) , 20 2 તલોદ્રા (તા.માંગરોળ) , 21 2 સુલ્તાનપુર (તા.માંગરોળ) , 22 2 શીલ (તા.માંગરોળ) , 23 2 શેરિયાખાણ (તા.માંગરોળ) , 24 2 શેરિયાજ (તા.માંગરોળ) , 25 2 શેપા (તા.માંગરોળ)

jan 2014: 1 3 ચાણસ્મા , 2 2 લચિત બોરફૂકન , 3 2 પ્રાણલાલ પટેલ , 4 2 લોપકચિહ્ન , 5 2 અવતરણ ચિહ્ન , 6 2 મહારેખા , 7 2 વિગ્રહરેખા , 8 2 મહાવિરામ , 9 2 અર્ધ વિરામ , 10 2 ચોરવાડ(તા. માળીયા હાટીના) , 11 2 જાપાનનો ઇતિહાસ , 12 2 ગારીયાધાર , 13 2 પાણીયા ડુંગરી (તા. ધારી) , 14 2 માણાવાવ (તા. ધારી) , 15 2 કરમદડી (તા. ધારી) , 16 2 ખંભાળીયા (તા. ધારી) , 17 2 ખીસરી (તા. ધારી) , 18 2 જળજીવડી (તા. ધારી) , 19 2 કરેણ (તા. ધારી) , 20 2 દલખાણીયા (તા. ધારી) , 21 2 દિતલા (તા. ધારી) , 22 2 ધારગણી (તા. ધારી) , 23 2 રાજસ્થળી (તા. ધારી) , 24 2 સુખપુર (તા. ધારી) , 25 2 દેવળા (તા. ધારી)

fev 2014: 1 3 કલાલી , 2 2 ધરતી , 3 2 લોકનૃત્ય , 4 2 અબુડી (તા. ઉના) , 5 2 સાબરમતી મેરેથોન , 6 2 વેલી ઓફ ફ્લાવર્સ રાષ્ટ્રીય ઉદ્યાન , 7 2 સ્વામિનારાયણ સંપ્રદાય , 8 2 વચનામૃત , 9 2 વણછરા , 10 2 મુળી , 11 2 ડૉ. ભીમરાવ રામજી આંબેડકર , 12 2 તિથલ , 13 1 ધનપુર (તા. લીમખેડા)

mar 2014: 1 6 સરસવણી (તા. મહેમદાવાદ) , 2 4 રવિશંકર મહારાજ , 3 4 ચિખલી, મહારાષ્ટ્ર , 4 4 રવિશંકર વ્યાસ , 5 3 જેસલ જાડેજા , 6 3 છાંયા (તા. પોરબંદર) , 7 2 વિવેકાનંદ , 8 2 હિબ્રુ યુનિવર્સિટી ઑફ જેરુસલેમ , 9 2 શંકર મહાદેવન , 10 2 સુરેશ વાડકર , 11 2 કુંવારપાઠું , 12 2 ઇશ્વરનગર (તા. હળવદ) , 13 2 બૌદ્ધ ગુફાઓ, ખંભાલીડા , 14 2 ગોમતા (તા. ગોંડલ) , 15 2 કરણાસર (તા. થરાદ) , 16 2 રામ પ્રસાદ બિસ્મિલ , 17 2 મોરા (તા. મોડાસા) , 18 2 ગુરુના ચંદ્રો , 19 2 પટવાણ (તા. લીમખેડા) , 20 2 જુલાઇ ૧ , 21 2 ખોખડદળ , 22 2 દાહોદ , 23 2 પોપટ , 24 2 સંત કબીર , 25 1 પૂજ્ય રવિશંકર મહારાજ

abr 2014: 1 4 ભારતીય સામાન્ય ચૂંટણી, ૨૦૧૪ , 2 4 ઉના , 3 3 અવાક , 4 3 ઇજનેરી મહાવિદ્યાલય, પુણે , 5 3 વિનોદ ભટ્ટ , 6 3 રૂવા (તા. ભાવનગર) , 7 3 બહુચર માતા , 8 3 મોરારજી દેસાઈ , 9 3 સરસવણી (તા. મહેમદાવાદ) , 10 3 રાપર , 11 3 આહવા , 12 2 નવી મુંબઈ , 13 2 સુલોચના (રામાયણ) , 14 2 વિલાયતી પટ્ટાઇ , 15 2 પટ્ટી પટ્ટાઇ , 16 2 પાન પટ્ટાઇ , 17 2 કાચબરંગી , 18 2 અબલખ , 19 2 કરકરો , 20 2 ચલ , 21 2 વન લલેડુ , 22 2 દસાડી , 23 2 ભારતીય ઉપખંડના પક્ષીઓની યાદી , 24 2 સ્તેનેશ્વર મહાદેવ, તેના , 25 2 શબરી

mai 2014: 1 7 નરેન્દ્ર મોદી , 2 4 માતૃભાષા અભિયાન , 3 3 મનમોહન સિંહ , 4 3 ઉપલેટા , 5 3 રાજકોટ , 6 2 ગૂજરાત વિદ્યાપીઠ , 7 2 સાર્ક , 8 2 હિંદ મહાસાગર , 9 2 સન્ધિ (વ્યાકરણ) , 10 2 વિવેકાનંદ રોક મેમોરિયલ , 11 2 ઈગ્નસ તિર્કિ , 12 2 મમતા સોઢા , 13 2 ડૉ. શરદ ઠાકર , 14 2 ગમડાઉ (તા. ભચાઉ ) , 15 2 કબરાઉ (તા. ભચાઉ) , 16 2 ભારતીય સામાન્ય ચૂંટણી, ૨૦૧૪ , 17 2 પ્રાણલાલ પટેલ , 18 2 કણખોઇ (તા. ભચાઉ ) , 19 2 અળવી , 20 2 પાટણા (તા.ગઢડા) , 21 2 લુવારવાવ (તા. પાલીતાણા) , 22 2 ગોરડકા (તા.ગઢડા) , 23 2 ઑડિશાના મુખ્યમંત્રીઓ , 24 2 રામવાવ , 25 2 ઑડિશાના જિલ્લા અને શહેરો

jun 2014: 1 3 દર્શન જરીવાલા , 2 3 અભિષેક જૈન , 3 3 હેબતપુર (તા. દસાડા) , 4 3 ઉમરેઠ , 5 3 નર્મદા નદી , 6 2 માખણ , 7 2 સોપારી , 8 2 કાકડી , 9 2 રેકી , 10 2 સાબલવાડ કંપા (જનકપુર) (તા. ઇડર) , 11 2 જાપાનનો ઇતિહાસ , 12 2 ગુજરાત યુનિવર્સિટી , 13 2 ચોરીવાડ (તા. વડાલી) , 14 2 બેસિલિકા ઑફ બોમ જીસસ

jul 2014: 1 2 મહી નદી , 2 2 હોટલ તાજ મહેલ પેલેસ , 3 2 ઇન્દ્રાયણી એક્સપ્રેસ , 4 2 આઈ ટી સી ગ્રાંડ ચોલા હોટલ , 5 2 એર ઇન્ડિયા એક્સપ્રેસ , 6 2 વોલ્ટર બેન્ડેર , 7 2 પુસ્તક પરબ , 8 2 એર એશિયા ઇન્ડિયા , 9 2 માખણ , 10 2 માતૃભાષા અભિયાન , 11 2 શોભાવડ (તા. તળાજા) , 12 2 કાજલ ઓઝા-વૈદ્ય , 13 2 ખીચા (તા. ધારી) , 14 2 ક્રોપ સર્કલ , 15 1 ચોલા સામ્રાજ્ય

ago 2014: 1 4 બે યાર , 2 4 આનંદીબેન પટેલ , 3 4 તબલા , 4 3 સચિન-જીગર , 5 3 ભૂસ્ખલન , 6 3 અભિષેક જૈન , 7 3 ગુજરાત , 8 2 ધ પારડી હોટેલ્સ ચેન્નઈ , 9 2 ધ પાર્ક ચેન્નાઇ , 10 2 ઓબેરોય ટ્રાયડેંટ , 11 2 દિલીપ કુમાર , 12 2 જિનવિજયજી , 13 2 સોડવદરા , 14 2 નવા નદિસર , 15 2 હોવાર્ડ ગોબિઓફ , 16 2 મધરબોર્ડ , 17 2 કાન , 18 2 સરતાનપર (તા. તળાજા) , 19 2 વીર્ય સ્ખલન , 20 2 પંચાશીયા (તા. વાંકાનેર) , 21 2 મહેન્દ્રગઢ (તા.માળિયા-મિયાણા) , 22 2 ટાઇગર વુડ્સ , 23 2 ક્રોપ સર્કલ , 24 2 મલેરિયા , 25 2 મંદ્રોપુર

set 2014: 1 3 રત્નમણીરાવ જોટે , 2 3 વિશ્વ ગુજરાત , 3 3 જેટ એરવેઝ , 4 3 ઔરંગાબાદ જન શતાબ્દી એક્સપ્રેસ , 5 3 લુવારવાવ (તા. પાલીતાણા) , 6 3 વલ્લભ વિદ્યાનગર , 7 3 હિમાચલ પ્રદેશ , 8 3 ગણિત , 9 2 કાબરો કલકલીયો , 10 2 મેઇડન્સ હોટલ દિલ્હી , 11 2 ધોલેરા , 12 2 દ્રષ્ટિ ધામી , 13 2 મહીસાગર જિલ્લો , 14 2 ધરો આઠમ , 15 2 સૂર્ય (દેવ) , 16 2 ભોપાલ - બિલાસપુર એક્સપ્રેસ , 17 2 એમપી-થ્રી (MP3) , 18 2 દીપચંદભાઇ ગાર્ડી , 19 2 સરદારગઢ , 20 2 ચીપકો આંદોલન , 21 2 આઇ.આઇ.એમ. અમદાવાદ , 22 2 પ્રાચી (તા. સુત્રાપાડા) , 23 2 કલ્પના ચાવલા , 24 2 ફાચરિયા (તા. જાફરાબાદ) , 25 2 હિંમતલાલ દવે

out 2014: 1 3 ભાયાતી જાંબુડીયા (તા. વાંકાનેર) , 2 3 લીચેસ્ટેઈન , 3 3 કંડલા બંદર , 4 2 સમ્બિત પાત્રા , 5 2 ઇન્દોર દુરંતો એક્સપ્રેસ , 6 2 ધ ઈમ્પીરીયલ, નવી દિલ્હી , 7 2 ઈન્ડીગો , 8 2 હુદહુદ (ચક્રવાત) , 9 2 ઘંટી-ટાંકણો , 10 2 રાજીવ દિક્ષીત , 11 2 કોસંબા (તા. વલસાડ) , 12 2 દિશા વાકાણી , 13 2 રણછોડજી દીવાન , 14 2 કુંભારા (તા. બોટાદ) , 15 2 માલશ્રમ (તા.કોડીનાર) , 16 2 ટીંબડી (તા. સુત્રાપાડા) , 17 2 વર્ણાતુ , 18 2 કાગદડી (તા. બગસરા) , 19 2 ગુજરાતની ભૂગોળ , 20 2 વરનોડા (તા. લાખણી) , 21 2 રાષ્ટ્રીય યુવા દિન , 22 2 ભારતનાં રાજ્યોના મુખ્ય મંત્રીઓ , 23 2 પક્ષી , 24 2 ઇંદરગોટા , 25 2 ઉદવાડા

nov 2014: 1 4 મુંબઈ મેટ્રોના સ્ટેશનોની યાદી , 2 4 રામાયણ , 3 3 મુંબઈ મેટ્રો , 4 3 માનવ શરીર , 5 3 મિશ્રધાતુ , 6 3 બોજાદરા , 7 3 વડગામ , 8 3 અંજાર , 9 2 બ્રિટાનિયા સ્ટેડિયમ , 10 2 સ્ટોક સિટી ફૂટબોલ ક્લબ , 11 2 રમેશચંદ્ર મજુમદાર , 12 2 સાઉધમ્પ્ટન ફૂટબોલ ક્લબ , 13 2 માળનાથ (ડુંગરમાળા) , 14 2 માલેશ્રી (નદી) , 15 2 રામલીલા , 16 2 ઉત્ક્રાંતિ , 17 2 લેસ્ટર સિટી ફૂટબૉલ ક્લબ , 18 2 ગિલોટિન (સંસદ) , 19 2 ટોટનમ હોટ્સ્પર ફૂટબોલ ક્લબ , 20 2 ગૂડિસન પાર્ક , 21 2 ભણગોળ(તા. ભાણવડ) , 22 2 સ્નેહા ઠક્કર , 23 2 સ્ટેમ્ફોર્ડ બ્રિજ (સ્ટેડિયમ) , 24 2 ચેલ્સી ફૂટબોલ ક્લબ , 25 2 વિલા પાર્ક

dez 2014: 1 2 રત્નમણીરાવ જોટે , 2 2 સી.એન.આર.રાવ , 3 2 ટ્રાજન , 4 2 ડી. ડબલ્યુ. સ્ટેડિયમ , 5 2 ઇવૂડ્ પાર્ક , 6 2 બ્લેકબર્ન રોવર્સ ફૂટબૉલ ક્લબ , 7 2 શેફિલ્ડ વેડન્ઝડે ફૂટબૉલ ક્લબ , 8 2 વોલ્વરહેમ્પ્ટન વેન્ડરર્સ ફૂટબૉલ ક્લબ , 9 2 કાર્ડિફ સિટી ફૂટબૉલ ક્લબ , 10 2 વેલ્સ , 11 2 સ્વાનસી સિટી એસોસિયેશન ફૂટબોલ ક્લબ , 12 2 હલ સિટી એસોસિયેશન ફૂટબોલ ક્લબ , 13 2 સ્ટોક સિટી ફૂટબોલ ક્લબ , 14 2 સાઉધમ્પ્ટન ફૂટબોલ ક્લબ , 15 2 સન્ડરલેન્ડ એસોસિયેશન ફૂટબોલ ક્લબ , 16 2 મુંબઈ મેટ્રો , 17 2 મુંબઈ મેટ્રોના સ્ટેશનોની યાદી , 18 2 વ્હાઈટ હાર્ટ લેન , 19 2 સ્નેહા ઠક્કર , 20 2 અમીરાત સ્ટેડિયમ , 21 2 ચુડાસમા , 22 2 અંધવિશ્વાસ , 23 2 લીડ્ઝ

jan 2015: 1 4 રજનીબાળા , 2 4 કણકોટ (તા. વાંકાનેર) , 3 4 ધર્મેન્દ્ર , 4 3 યેઘીશે ચારેન્ત્સ , 5 3 મહેન્દ્ર સિંઘ ધોની , 6 3 ઉપેન્દ્ર ત્રિવેદી , 7 3 ધ અંડરટેકર , 8 3 ખાંભડા (તા. બરવાળા) , 9 3 ભાવનગર , 10 2 ઈક્વેડોરનો રાષ્ટ્રધ્વજ , 11 2 જેસર (તા. જેસર) , 12 2 કોંગોનું લોકતંત્રીય ગણતંત્રનો રાષ્ટ્રધ્વજ , 13 2 અઝેરબીજાનનો રાષ્ટ્રધ્વજ , 14 2 અફઘાનિસ્તાનનો રાષ્ટ્રધ્વજ , 15 2 સાર્વભૌમ દેશોના રાષ્ટ્રધ્વજોની ચિત્રગેલેરી , 16 2 ઘનશ્યામ નાયક , 17 2 પર્યાવરણ સંરક્ષણ સ્થિતિ , 18 2 પાટણા (તા.ગઢડા) , 19 2 વેજોદરી (તા. તળાજા) , 20 2 અટલ બિહારી વાજપેયી , 21 2 થૉમસ ઍડિસન , 22 2 સ્નેહલતા , 23 2 પંજાબ (પાકિસ્તાન) , 24 1 બ્રિટનની ફૂટબોલ ક્લબો અને સ્ટેડિયમોની યાદી

fev 2015: 1 5 સ્વરચક્ર , 2 2 ભાલચંદ્ર નેમાડે , 3 2 સરિતા જોશી , 4 2 ડોળાસા (તા.કોડીનાર) , 5 2 જ્ઞાનપીઠ એવોર્ડ , 6 2 ફાચરીયા (તા. જામનગર) , 7 2 મનોજ ખંડેરિયા , 8 2 બેટલીયા (તા. થરાદ) , 9 2 દક્ષિણ એશિયા , 10 2 ભાગળ , 11 2 ખંભાત , 12 2 પાવી જેતપુર , 13 2 રેવાડી જિલ્લો , 14 2 ગુડગાંવ જિલ્લો , 15 2 કુરુક્ષેત્ર જિલ્લો , 16 2 પન્નાલાલ પટેલ , 17 2 તારક મહેતા , 18 2 સાપુતારા , 19 2 બનાસકાંઠા જિલ્લો , 20 1 રેવારી જિલ્લો

mar 2015: 1 4 મમુઆરા (તા. ભુજ) , 2 3 હૃદયકુંજ , 3 3 ઈન્દ્રપ્રસ્થ માહિતી ટેકનોલોજી સંસ્થા - દિલ્હી , 4 3 એસ્કેરિયાસિસ , 5 3 મામોરા (તા. ભુજ) , 6 3 ગાંધીનગર , 7 2 મિયાણી બીચ , 8 2 વીરડી (તા.ગઢડા) , 9 2 ભારતીય ચૂંટણી પંચ , 10 2 ચમારડી (તા. બાબરા) , 11 2 દાતરડી (તા. રાજુલા) , 12 2 મિયાણી (તા. પોરબંદર) , 13 2 સુદર્શન ચક્ર , 14 2 ભારતીય રિઝર્વ બેંક , 15 2 વાંસડા (તા. સતલાસણા) , 16 2 મહારાણા પ્રતાપ , 17 2 તજ , 18 2 સેવ ખમણી , 19 2 વેળાવદર કાળિયાર રાષ્ટ્રીય ઉદ્યાન , 20 2 ખડીયારાપુરા , 21 2 મહેલાણ , 22 2 ધારાપુર (તા. શહેરા) , 23 1 લોનાર ઉલ્કા તળાવ

abr 2015: 1 3 પરેશ રાવલ , 2 3 ગાંઠિયા , 3 3 ભારતના રાષ્ટ્રપતિ , 4 2 રામાસ્વામી પરમેશ્વરન , 5 2 રાજેશ ખન્ના , 6 2 આંધ્રપ્રદેશ એક્સપ્રેસ , 7 2 એર અરેબિયા , 8 2 અમરાવતી એક્સપ્રેસ , 9 2 મોહમ્મદ માંકડ , 10 2 અફઘાની ભાષા , 11 2 સંજય કુમાર , 12 2 ગૃહમંત્રી , 13 2 યોગેન્દ્ર સિંહ યાદવ , 14 2 પ્રભાતસિંહ પ્રતાપસિંહ ચૌહાણ , 15 2 પરાશર સરોવર (હિમાચલ પ્રદેશ) , 16 2 અમિત જેઠવા , 17 2 અરવલ્લી જિલ્લો , 18 2 સરપંચ , 19 2 આદિપુર (કચ્છ) , 20 2 ભારતીય ક્રિકેટ મેદાનોની યાદી , 21 2 પાંગોંગ સરોવર , 22 2 વારલી ચિત્રકળા , 23 2 ભરુચ જંકશન રેલ્વે સ્ટેશન , 24 2 કાંદિવલી , 25 2 ચક્રવાક

mai 2015: 1 4 પ્રભાતસિંહ પ્રતાપસિંહ ચૌહાણ , 2 4 મુસલમાન , 3 4 તોરણિયો ડુંગર , 4 4 હિંદુ , 5 3 ફાલુદા , 6 3 તકમરિયાં , 7 3 ચીયા , 8 3 ઘુટું (તા. મોરબી) , 9 3 મલ્ટિમીટર , 10 3 અમીયાપુ૨ (તા. બાયડ) , 11 3 ખંભાત , 12 3 ગાંઠિયા , 13 3 રમેશ પારેખ , 14 3 અમદાવાદ , 15 2 વિલે પાર્લે , 16 2 પૂજા , 17 2 એસ્સેલવર્લ્ડ , 18 2 સોહિલ , 19 2 લેગો , 20 2 જન શતાબ્દી એક્સપ્રેસ , 21 2 ગુજરાત ક્વીન , 22 2 કાજલ , 23 2 દેશી બોયઝ , 24 2 ગીતકાર , 25 2 પાર્શ્વગાયક

jun 2015: 1 4 જહાજ વૈતરણા (વીજળી) , 2 4 વચનામૃત , 3 3 દાળવડા , 4 3 સોયાબીન , 5 3 ધનાળા (તા. હળવદ) , 6 3 જુનાગઢ , 7 3 ગાંધીધામ , 8 3 ભરૂચ , 9 2 માઈલ , 10 2 ગોરાઇ , 11 2 ભાવનગર મ્યુનિસિપલ કોર્પોરેશન , 12 2 મોરડ , 13 2 પોળોનું જંગલ , 14 2 ગોટી , 15 2 રસોઈ શો , 16 2 અવકુડા , 17 2 અક્સા બીચ , 18 2 શ્યામ પાઠક , 19 2 જોગેશ્વરી ગુફાઓ , 20 2 જોગનો ધોધ , 21 2 ફુરસા , 22 2 મહાદેવપુરા (તા.બહુચરાજી) , 23 2 અનારકલી પોશાકો , 24 2 વન્ડરલા , 25 2 આરે મિલ્ક કોલોની

jul 2015: 1 5 અબ્દુલ કલામ , 2 4 મોહમ્મદ મહાબતખાન બાબી , 3 4 જૂનાગઢ રજવાડું , 4 3 ધોકો (પંચાંગ) , 5 3 કુડોલ (તા. મોડાસા) , 6 3 તણછા (તા.આમોદ) , 7 3 ગીર રાષ્ટ્રીય ઉદ્યાન અને અભયારણ્ય , 8 3 પશુપાલન , 9 3 સોક્રેટિસ , 10 3 પ્લૂટો , 11 2 બુરુલી અલ્સર , 12 2 ધ હિંદુ , 13 2 લીના જુમાની , 14 2 રાબિયા બસરી , 15 2 કેરમ , 16 2 માયામિ , 17 2 નંદિતા દાસ , 18 2 ફાતિમા મીર , 19 2 ફાતિમા ઝીણા , 20 2 દરીયાઈ કાચબો , 21 2 ઠાડિયા , 22 2 અલ્લાહ , 23 2 શિવ નિવાસ પેલેસ , 24 2 ધીરુભાઇ અંબાણી ઇન્સ્ટિટ્યુટ ઓફ ઇન્ફોર્મેશન એન્ડ કમ્યુનિકેશન ટેક્નોલોજી , 25 2 લૉ ગાર્ડન

ago 2015: 1 3 સરખેજ રોઝા , 2 3 વિરપુર (મહીસાગર જિલ્લો) , 3 2 ગગનમાં થાળ , 4 2 પાટીદાર અનામત આંદોલન , 5 2 કુંડી , 6 2 કાંતિ ભટ્ટ , 7 2 અથાણું , 8 2 ગુજરાતી મુસલમાન , 9 2 ફ્રેડી મર્ક્યુરી , 10 2 ચાગસ રોગ , 11 2 પ્રતિક ગાંધી , 12 2 અંબિકા નિકેતન મંદિર , 13 2 બિસ્મિલ્લાહ ખાન , 14 2 એલેકઝાન્ડર ફાર્બસ , 15 2 અમીના દેસાઈ , 16 2 ઈલા ગાંધી , 17 2 ઝાકિર નાઇક , 18 2 અલી ઝફર , 19 2 યુસુફ દાદૂ , 20 2 ઇરફાન હબીબ , 21 2 વિલ્સન હીલ, ધરમપુર , 22 2 નારાયણ સરોવર (તા. લખપત) , 23 2 કાજલ ઓઝા-વૈદ્ય , 24 2 ખ્રિસ્તી ધર્મ , 25 2 એકવાર પિયુને મળવા આવજે

set 2015: 1 4 મુહમ્મદ ઝકરિયા કાંધલવી , 2 4 બેરન આઇલેન્ડ (આંદામાન ટાપુઓ) , 3 4 સરદાર વલ્લભભાઈ પટેલ આંતરરાષ્ટ્રીય હવાઈ મથક , 4 4 કૃષ્ણકાન્ત કડકિયા , 5 3 હરકિશન મહેતા , 6 3 સિતાંષુ યશશ્ચન્દ્ર , 7 3 કાફિર , 8 3 વજીહુદ્દીન અલવી , 9 3 અલાઉદ્દીન અલી અહમદ સાબિર કલ્યરી , 10 3 ઓટો એક્સપો , 11 3 બોપલ-ઘુમા નગરપાલિકા , 12 3 નેવેલી લિગ્નાઇટ કોર્પોરેશન , 13 3 વિવેકાનંદ ઉચ્ચતર ઉત્તર બુનિયાદી વિદ્યાલય, વનકુવા , 14 3 ઉજ્જડ ટાપુ (આંદામાન ટાપુઓ) , 15 3 બકરી ઈદ , 16 3 આદસંગ (તા. સાવરકુંડલા) , 17 3 સાવરકુંડલા , 18 3 ત્રિભુવનભાઇ કીશીભાઇ પટેલ , 19 3 બકરી , 20 3 પાજોદ , 21 3 ઝવેરચંદ મેઘાણી , 22 3 સુરત , 23 2 સિતાંશુ યશચંદ્ર , 24 2 ધ્રુવ ભટ્ટ , 25 2 હરિપ્રસાદ વ્યાસ

out 2015: 1 6 પરિયોજના: વિકિપીડિયા એશિયન મહિનો ૨૦૧૫/Participants , 2 4 ઝાડા , 3 3 નવાઘરાં (તા. માલપુર) , 4 3 લેપ્ટોસ્પાઇરોસિસ , 5 3 પરિયોજના: વિકિપીડિયા એશિયન મહિનો ૨૦૧૫ , 6 3 જખૌ (તા. અબડાસા) , 7 3 ભદ્રેસર (તા. મુન્દ્રા) , 8 3 કુંડેલ (તા. દાંતા) , 9 3 ઢોકળાં , 10 3 ડભોડા (તા. ગાંધીનગર) , 11 3 બાબરા , 12 3 ઘોઘા , 13 3 વિજયનગર, સાબરકાંઠા જિલ્લો , 14 3 માલપુર , 15 3 કલોલ , 16 3 પીપાવાવ બંદર , 17 3 રોટલી , 18 2 ગોકુળપુરા (તા. પાલનપુર) , 19 2 મીઠાપર , 20 2 ઇસ્માઇલ વાલેરા , 21 2 રવિન્દ્ર જૈન , 22 2 ડોસવાડા જળાશય યોજના , 23 2 બ્રાહ્મણવાડા , 24 2 વીરપુર (રાજકોટ) , 25 2 ખાંટ રાજપૂત

nov 2015: 1 3 પરિયોજના: વિકિપીડિયા એશિયન મહિનો ૨૦૧૫/આકારણી , 2 3 બાલારામ અંબાજી વન્યજીવ અભ્યારણ્ય , 3 3 લખપત , 4 3 ચોટીલા , 5 2 સિદ્ધાર્થ રાંદેરીયા , 6 2 અમેઠી , 7 2 અમલાપુરમ , 8 2 અંબાલા , 9 2 પશુ , 10 2 તખ્તેબહી , 11 2 અવુકાના બૌદ્ધ પ્રતિમા , 12 2 બોરોબુદુર મંદિર સંકુલ , 13 2 સિયોત શૈલ ગુફાઓ , 14 2 હિરોશિમા શાંતિ સ્મારક , 15 2 પરિયોજના: વિકિપીડિયા એશિયન મહિનો ૨૦૧૫/Participants , 16 2 ખેતીયાણ (ખતીયા) (તા. લખપત) , 17 2 દયાપર (તા. લખપત) , 18 2 બાડા (તા. માંડવી) , 19 2 ચોળાફળી , 20 2 કેનેડા , 21 2 પ્રશ્નાવડા (તા. સુત્રાપાડા) , 22 2 ગારીયાધાર , 23 2 દાસ વાઘો , 24 2 અમરાપર ટોળ (તા. ટંકારા) , 25 2 જીવાપર (આણંદપર)

dez 2015: 1 3 સોનલ , 2 3 વસંતનગર ટાઉનશીપ , 3 3 સરખેજ રોઝા , 4 3 ચાંપાથળ (તા. અમરેલી) , 5 3 માર્ક ઝકરબર્ગ , 6 3 પાટણ જિલ્લો , 7 2 સાધના શિવદાસાની (અભિનેત્રી) , 8 2 વઢિયાર , 9 2 અમૃતવર્ષીની વાવ , 10 2 સોલંકી વંશ , 11 2 ચાવડા વંશ , 12 2 ગૂગોલ , 13 2 રાણીનો હજીરો , 14 2 બાલારામ નદી , 15 2 એલિસ બ્રિજ (વિસ્તાર) , 16 2 સંગીતકાર , 17 2 સંગીતજ્ઞ , 18 2 નિષાદ , 19 2 ધૈવત , 20 2 પંચમ , 21 2 મધ્યમ , 22 2 ગંધાર , 23 2 ૠષભ , 24 2 ષડ્જ , 25 2 કર્ણાટક સંગીત

jan 2016: 1 4 પે સેન્ટર ગ્રૂપ શાળા, બદલપુર , 2 4 અમલાની મુવાડી (તા.પ્રાંતિજ) , 3 4 છેલ્લો દિવસ , 4 3 ગાંધી સમાધી, ગુજરાત , 5 3 જાન્હવી છેડા , 6 3 ગૌતમેશ્વર મહાદેવ મંદિર (સિહોર) , 7 3 આઇટીસી હોટેલ્સ , 8 3 ભાલીયા ઘઉં , 9 3 પૂડલા , 10 3 સેવકરામ રાજારામ દેસાઈ , 11 3 ૧૮૦૨ની સંધિ , 12 3 મોરીટેનીયાનો રાષ્ટ્રધ્વજ , 13 3 એકલવ્ય અવોર્ડ , 14 3 ચિત્રકલા , 15 3 શિલ્પકલા , 16 3 ગટુભાઈ ગોપીલાલ ધ્રુ , 17 3 મેટ્રોલિંક એક્સપ્રેસ ગાંધીનગર અને અમદાવાદ , 18 3 ગૌરીશંકર ઉદયશંકર ઓઝા , 19 3 અમૃત નાયક , 20 3 ભાલ વિસ્તાર , 21 3 અરાલ સમુદ્ર , 22 3 આદમ ટંકારવી , 23 3 બહુચર માતા , 24 3 નરસિંહ મહેતા એવોર્ડ , 25 3 ગઢકા,તા.રાજકોટ

fev 2016: 1 4 ગલગોટા , 2 4 રાજસ્થાન , 3 3 કર્નાલા પક્ષી અભયારણ્ય , 4 3 અકબરના નવરત્નો , 5 3 રણછોડજી દીવાન , 6 3 પ્રભાશંકર પટ્ટણી , 7 3 દિવાન બલ્લુભાઇ શાળા , 8 3 ઑડિશા , 9 3 થોળ પક્ષી અભયારણ્ય , 10 3 અડાલજની વાવ , 11 3 તુલસીશ્યામ , 12 3 ગુજરાત , 13 2 ધરો , 14 2 વોટર પાઇપ રેલ્વે સ્ટેશન , 15 2 મુલુંડ , 16 2 માર્કંડ ભટ્ટ , 17 2 આઇન-એ-અકબરી , 18 2 સુખી બંધ , 19 2 વૈતરણા બંધ , 20 2 ભારત કા વીર પુત્ર - મહારાણા પ્રતાપ , 21 2 કેલિકો ડોમ , 22 2 જાંબુઘોડા વન્યજીવન અભયારણ્ય , 23 2 ૧૯૭૯ મચ્છુ બંધ હોનારત , 24 2 જોગનો ધોધ , 25 2 એનફિલ્ડ

mar 2016: 1 3 રા' ખેંગાર દ્વિતીય , 2 3 ચોબારી (તા. ભચાઉ ) , 3 2 રા' ખેંગાર દ્વિતિય , 4 2 કામિની કૌશલ , 5 2 ઇબન બતૂતા , 6 2 કસોલ , 7 2 કામારપુકુર , 8 2 આરામબાગ , 9 2 ચન્દનનગર , 10 2 રા' ગ્રહરિપુ , 11 2 શ્રીરામપૂર , 12 2 ગંગાધરપૂર , 13 2 સપનોં સે ભરે નૈના , 14 2 રચના પારુલકર , 15 2 સરવૈયા , 16 2 ઉધમસિંહ , 17 2 ગોરઠીયા મહાદેવ મંદિર , 18 2 શબરી ધામ , 19 2 ઘેલુભાઇ નાયક , 20 2 હની છાયા , 21 2 ભારત કા વીર પુત્ર - મહારાણા પ્રતાપ , 22 2 દાદા હરિર વાવ , 23 2 સોલંકી વંશ , 24 2 સિદ્ધાર્થ રાંદેરીયા , 25 2 સિતાંષુ યશશ્ચન્દ્ર

abr 2016: 1 3 KolibriOs ઓપરેટિંગ સિસ્ટમ , 2 3 પીપાવાવ શીપયાર્ડ , 3 2 દ્રુહ્યુ , 4 2 ઇન્ફર્મેશન ટેક્નૉલોજિ , 5 2 વિગાન એથલેટિક ફૂટબૉલ ક્લબ , 6 2 મિયાં ફૂસકી , 7 2 ભારત સ્થિત સંસ્કૃત વિશ્વવિદ્યાલયોની યાદી , 8 2 ત્રાટક , 9 2 મહુવા તાલુકો , 10 2 બી. કે. ગઢવી , 11 2 પરમ વિશિષ્ટ સેવા ચંદ્રક , 12 2 જોગિન્દર જસવંત સિંઘ , 13 2 ગાંધીધામ તાલુકો , 14 2 ગેમ ઑફ થ્રોન્સ , 15 2 રાષ્ટ્રપિતા , 16 2 રા' દિયાસ , 17 2 રા' કંવાટ , 18 2 રા' ગ્રહરિપુ , 19 2 નંદશંકર મહેતા , 20 2 ભગવાન , 21 2 Tcfc2349 , 22 2 રમકડું , 23 2 ઔદ્યોગિક ક્રાંતિ , 24 2 ઘર ઉંદર , 25 2 શંકરસિંહ વાઘેલા

mai 2016: 1 4 બોટાદ , 2 3 વિશ્વ અદાલત , 3 3 મુંદરા ( તા.મુન્દ્રા) , 4 3 બીટા વલાડીયા ( આથમણું ) (તા. અંજાર) , 5 3 બીટા વલાડીયા(ઉગમણુ) (તા. અંજાર) , 6 3 ટપ્પર (તા. અંજાર) , 7 3 રવા (તા. અબડાસા) , 8 3 પૈયા (તા. અબડાસા) , 9 3 ભેદી (પઈ) (તા. અબડાસા) , 10 3 બાબીયા (તા. મુન્દ્રા) , 11 3 ભંડારીયા (તા. ભાવનગર) , 12 3 થાનગઢ, સુરેન્દ્રનગર , 13 3 ઇન્દુલાલ યાજ્ઞિક , 14 3 ભાણવડ , 15 3 રઘુવીર ચૌધરી , 16 2 અતિકાયા , 17 2 મોફલૉંગ , 18 2 ગોપનાથ મહાદેવ (આમોદરા) , 19 2 લદ્દાખ સ્કાઉટ્સ , 20 2 આમોદરા (તા. બાયડ) , 21 2 યોગ​વાસિષ્ઠ , 22 2 કુંકાવાવ તાલુકો , 23 2 જાફરાબાદ તાલુકો , 24 2 બેડી બંદર , 25 2 ગીચડા ( તા. નખત્રાણા )

jun 2016: 1 4 જખ બોંતેરા , 2 4 સાતતાલ , 3 4 ભીમતાલ , 4 4 દૂધસાગર ધોધ , 5 4 પાળિયા , 6 4 થઇ જશે! (ચલચિત્ર) , 7 3 ટીપણી નૃત્ય , 8 3 કરણ ઘેલો , 9 3 ભારતના રજવાડાઓની યાદી , 10 3 નાકો સરોવર (હિમાચલ પ્રદેશ) , 11 3 ભોરોલ (તા. થરાદ) , 12 3 ઉંચામાળા , 13 2 શિવ મંદિર, કેરા , 14 2 ઝુબેદા , 15 2 દાદા મેકરણ , 16 2 નારોલ , 17 2 ૧ ગુરખા રાઇફલ્સ , 18 2 પ્રણવ , 19 2 મદ્રાસ રેજિમેન્ટ , 20 2 હાતગઢ , 21 2 બૈલોંગ એલિવેટર , 22 2 ચીમનલાલ ગીરધરલાલ માર્ગ , 23 2 હિથ લેજર , 24 2 કુમાઉં રેજિમેન્ટ , 25 2 કેવી રીતે જઈશ? (ચલચિત્ર‌‌)

jul 2016: 1 4 પ્રાગપર (તા. મુન્દ્રા) , 2 3 ચાવડા રખાલ , 3 3 છારી-ઢંઢ જળપ્લાવીત ભૂમી સંવર્ધન ક્ષેત્ર , 4 3 પ્રતાપપર ૧ (તા. મુન્દ્રા) , 5 3 હિંગલાજ ભવાની શક્તિપીઠ , 6 3 હલદરવાસ (તા. મહેમદાવાદ) , 7 3 પોરબંદર , 8 2 હાજીપીર , 9 2 ચીર બત્તી , 10 2 અલાદી રામક્રિષ્નન , 11 2 સુરકોટડા , 12 2 વાતાવરણ , 13 2 કાનમેર (તા.રાપર) , 14 2 કચ્છનો ઇતિહાસ , 15 2 બાબરકોટ (તા. જાફરાબાદ) , 16 2 પાબુમઠ , 17 2 વાયુ પ્રદૂષણ , 18 2 લંબચોરસ , 19 2 કચ્છનું રણ , 20 2 ધીણોધર ટેકરીઓ , 21 2 ઇન્ટરનેટ મૂવી ડેટાબેઝ , 22 2 એલેકઝાન્ડર ફાર્બસ , 23 2 જૂના ભવનાથ મંદિર, મ‌ઉ , 24 2 સમાત્રા (તા. ભુજ) , 25 2 મોટી ભુજપર (તા. મુન્દ્રા)

ago 2016: 1 4 પી. વી. સિંધુ , 2 3 રક્તપિત , 3 3 લૈશમેનિયાસિસ , 4 3 તેલંગાણા , 5 3 આસામ , 6 2 દિલ્હી સલ્તનત , 7 2 રઝીયા સુલ્તાન , 8 2 મુઘલ વાસ્તુકલા , 9 2 પરાવર્તિત ટેલીસ્કોપ , 10 2 બાલાશંકર કંથારીયા , 11 2 ઉત્પાદન ઇજનેરી , 12 2 અરોર , 13 2 ૨ (બે) , 14 2 ઝાર રાંદેરી , 15 2 મધુસૂદન ઢાંકી , 16 2 વિજય રૂપાણી , 17 2 પૈડું , 18 2 દીપિકા કુમારી , 19 2 કચ્છનો ઇતિહાસ , 20 2 વડગામ તાલુકો , 21 2 વિક્રમ ઠાકોર , 22 2 ચિખલી, મહારાષ્ટ્ર , 23 2 મોટી તુંબડી (તા. મુન્દ્રા) , 24 2 લીફરા (તા. મુન્દ્રા) , 25 2 મોહેં-જો-દડો

set 2016: 1 5 રોંગ સાઈડ રાજુ , 2 3 મુંગેલી જિલ્લો , 3 3 કારડીયા , 4 3 વનસ્પતિ ઉદ્યાન, વઘઇ , 5 3 ભુચર મોરીનું યુદ્ધ , 6 3 અવિભાજ્ય સંખ્યા , 7 3 વિજય રૂપાણી , 8 3 ગીર સોમનાથ જિલ્લો , 9 3 પ્રશ્નાવડા (તા. સુત્રાપાડા) , 10 3 નાટાપુર (તા. મોરવા) , 11 3 લોકમાન્ય ટિળક , 12 3 માકડું , 13 3 સાણંદ , 14 3 દલપતરામ , 15 3 સુરેન્દ્રનગર જિલ્લો , 16 3 રસાયણ શાસ્ત્ર , 17 3 સુરત , 18 3 ગુજરાત , 19 2 કોલાબા કિલ્લો , 20 2 હિંગોલ નદી , 21 2 જોટાણા તાલુકો , 22 2 મક્કા ઓવારો , 23 2 ખત્રી , 24 2 શિવનેરી કિલ્લો , 25 2 બાવનગજા તીર્થ

out 2016: 1 4 આચાર્ય હરિભદ્ર , 2 3 ભાવનગર જૂના બંદર , 3 3 કારડીયા , 4 3 દ્રુહ્યુ , 5 2 મંદિર સંસ્થા , 6 2 શ્યામજી કૃષ્ણ વર્મા , 7 2 કોડિઆક રીંછ , 8 2 સ્પર્ધાત્મક પ્રોગ્રામિંગ , 9 2 અવિભાજ્ય સંખ્યા , 10 2 પાળિયા , 11 2 એચ એન ગોલીબાર , 12 2 વિક્રમ ઠાકોર , 13 2 સિયોત (તા. લખપત) , 14 2 સનખડા (તા. ઉના) , 15 2 સિદ્ધિદાત્રી , 16 2 મહાગૌરી , 17 2 કાલરાત્રિ , 18 2 કાત્યાયની , 19 2 સ્કન્દમાતા , 20 2 કૂષ્માંડા , 21 2 ચન્દ્રઘંટા , 22 2 લવિંગ , 23 2 કરીના કપૂર , 24 2 યાહૂ! , 25 2 જલારામ બાપા

nov 2016: 1 4 જૂનાગઢ રજવાડું , 2 3 અવિભાજ્ય સંખ્યા , 3 3 અક્ષય કુમાર , 4 2 બોરીઆ , 5 2 પાકિસ્તાનમાં એલજીબીટી અધિકારો , 6 2 વરઘોડો , 7 2 ડિમેન્શિયા , 8 2 વિન્ડોઝ , 9 2 વિક્રમ ઠાકોર , 10 2 ખાંડેક (તા.રાપર) , 11 2 કરીના કપૂર , 12 2 કોયલાણા , 13 2 યોગેન્દ્ર વ્યાસ , 14 2 મગ , 15 2 આરઝી હકૂમત , 16 2 ઠાકોર , 17 2 પાંડુરંગ શાસ્ત્રી આઠવલે , 18 2 ગીર રાષ્ટ્રીય ઉદ્યાન અને અભયારણ્ય , 19 2 ભુતપોર , 20 2 અભિમન્યુ , 21 2 ભોપાલ , 22 2 વાંસદા , 23 2 જુનાગઢ , 24 1 ઇઝરાયેલ નેશનલ લાયબ્રેરી

dez 2016: 1 6 ગઝલ , 2 3 અભિષેક જૈન , 3 3 ખાંડેક (તા.રાપર) , 4 3 દ્રાક્ષ , 5 3 માધવ રામાનુજ , 6 3 મનહર મોદી , 7 3 સોનાક્ષી સિંહા , 8 3 ધીણોજ (તા. ચાણસ્મા) , 9 3 શૈલપુત્રી , 10 3 મહારાષ્ટ્ર , 11 3 ગુજરાત , 12 2 સાબરમતી કે સંત , 13 2 જેસલ જોગરાણા , 14 2 ડેવિડ સિટી , 15 2 ઇઝરાયેલ મ્યુઝિયમ , 16 2 જીવવિજ્ઞાન , 17 2 રાજગઢી ટીંબો , 18 2 બોરીઆ , 19 2 વિરપુર તાલુકો , 20 2 માંગરોળ (જૂનાગઢ) તાલુકો , 21 2 તિલકવાડા તાલુકો , 22 2 લીમખેડા તાલુકો , 23 2 ગરબાડા તાલુકો , 24 2 ફતેપુરા તાલુકો , 25 2 ધાનપુર તાલુકો

Wikipedias are initially ordered by number of speakers of the language

Speakers: Number of speakers of a language is the estimated total of primary and secondary speakers, is in many cases a very rough estimation (based on the page on the English Wikipedia about that language)
Regions are parts of the world where the language is spoken in substantial amounts (compared to total number of speakers). Regions where a language gained presence only by a recent diaspora are generally not included.
Region codes: AF:Africa, AS:Asia, EU:Europe, NA:North America, OC:Oceania, SA:South America, W:World Wide, CL:Constructed Language

Estatísticas geradas em Sexta-feira, 13 de janeiro 2017 04:51

Dump file guwiki-20170101-stub-meta-history.xml.gz (edits only), size 28 Mb as gz -> 219 Mb
Dump processed till Dec 31, 2016, on server stat1002, ready at Sun-01/01/2017-10:02 after 2 min, 53 sec.

Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.