Estatísticas da Wikipédia hiri motu

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Articles per size range / Records per namespace / Most edited articles / Zeitgeist
 
Monthly counts & Quarterly rankings
 
DataWikipedistasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P____Q____R____S__
mar 20112   32 32,343333  4,0 kb1975127(2)  
fev 20112   32 32,343333  4,0 kb1975127(2)  
jan 20112   32 32,343333  4,0 kb1975127(2)  
dez 20102   32 32,343333  4,0 kb1975127(2)  
nov 20102   32 32,343333  4,0 kb1975127(2)  
out 20102   32 32,343333  4,0 kb1975127(2)  
set 20102   32 32,343333  4,0 kb1975127(2)  
ago 20102   32 32,343333  4,0 kb1975127(2)  
jul 20102   32 32,343333  4,0 kb1975127(2)  
jun 20102   32 32,343333  4,0 kb1975127(2)  
mai 20102   32 32,343333  4,0 kb1975127(2)  
abr 20102   32 32,343333  4,0 kb1975127(2)  
mar 20102   32 32,343333  4,0 kb1975127(2)  
fev 20102   32 32,343333  4,0 kb1975127(2)  
jan 20102   32 32,343333  4,0 kb1975127(2)  
dez 20092   32 32,343333  4,0 kb1975127(2)  
nov 20092   32 32,343333  4,0 kb1975127(2)  
out 20092   32 32,343333  4,0 kb1975127(2)  
set 20092   32 32,343333  4,0 kb1975127(2)  
ago 20092   32 32,343333  4,0 kb1975127(2)  
jul 20092   32 32,343333  4,0 kb1975127(2)  
jun 20092   32 32,343333  4,0 kb1975127(2)  
mai 20092   32 32,343333  4,0 kb1975127(2)  
abr 20092   32 32,343333  4,0 kb1975127(2)  
mar 20092   32 32,343333  4,0 kb1975127(2)  
fev 20092   32 32,343333 14,0 kb1975127(2)  
jan 20092   42 2434725  4,3 kb2135127(2)1 
dez 20082   42 2434725  4,3 kb2135127(2)1 
nov 20082   42 2434725  4,3 kb2135127(2)1 
out 20082   42 2434725  4,3 kb2135127(2)1 
set 20082   42 2434725  4,3 kb2135127(2)1 
ago 20082   42 2434725  4,3 kb2135127(2)1 
jul 20082   42 2434725  4,3 kb2135127(2)1 
jun 20082   42 2434725  4,3 kb2135127(2)1 
mai 20082   42 2434725  4,3 kb2135127(2)1 
abr 20082   42 2434725  4,3 kb2135127(2)1 
mar 20082   42 2434725  4,3 kb2135127(2)1 
fev 20082   42 2434725  4,3 kb2135127(2)1 
jan 20082   42 2434725  4,3 kb2135127(2)1 
dez 20072   42 2434725  4,3 kb2135127(2)1 
nov 20072   42 2434725  4,3 kb2135127(2)1 
out 20072   42 2434725  4,3 kb2135127(2)1 
set 20072   42 2434725  4,3 kb2135127(2)1 
ago 20072   42 2434725  4,3 kb2135127(2)1 
jul 20072 1 42 2434725 74,3 kb2135127(2)1 
jun 20072   32 29,771333 97,4 kb320 254(2)10 
mai 20072   22 4098850 36,8 kb295 254(1)10 
abr 20072   22 38,598850 16,6 kb295 239(1)10 
mar 20072   22 3898850 76,6 kb295 239(1)10 
fev 20072   22 34,598250 36,5 kb291 238(1)10 
jan 20072   21 3382050 36,1 kb255 238( )11 
dez 20062   21 31,582050 26,1 kb255 237( )11 
nov 20062   21 30,582050 16,0 kb255 232( )11 
out 20062   21 3082050 25,9 kb255 228( )11 
set 20062   21 2998650 36,2 kb309 227( )11 
ago 20062   21 27,583450 25,7 kb262 226( )10 
jul 2006211 1  5312  262,0 kb1 110( )1 
jun 20061   22 13,599650 14,0 kb298 111(1)9 
mai 20061   22 13109650 114,6 kb329 111(1)10 
abr 20061   11 151662100 23,8 kb256 110( )10 
mar 20061   11 131662100 23,8 kb256 110( )10 
fev 20061   11 111662100 33,8 kb256 110( )10 
jan 20061   11 81662100 23,8 kb256 110( )10 
dez 20051   11 6366   1,7 kb68 107( )6 
nov 20051   11 6366  11,7 kb68 107( )6 
out 20051   11 5386  11,7 kb72 107( )6 
set 20051   11 4366   1,7 kb68 107( )6 
ago 20051   11 4366  11,7 kb68 107( )6 
jul 20051   11 3464  11,9 kb82 107( )9 
jun 20051   11 2429  11,8 kb77 107( )7 
mai 20051   11 1445   1,8 kb79 106( )9 
abr 20051   11 1445   1,8 kb79 106( )9 
mar 20051   11 1445   1,8 kb79 106( )9 
fev 20051   11 1445   1,8 kb79 106( )9 
jan 20051   11 1445   1,8 kb79 106( )9 
dez 20041   11 1445   1,8 kb79 106( )9 
nov 20041   11 1445   1,8 kb79 106( )9 
out 20041   11 1445   1,8 kb79 106( )9 
set 20041   11 1445   1,8 kb79 106( )9 
ago 200411  11 1445  11,8 kb79 106( )9 
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
 WikipedistasArtigosBase de dadosLigações

Counts for image links are based on keyword(s) found in the message file for this language: (Image).
Note that image links based on default keyword 'Image' and/or 'File' have been missed. This will be repaired on the next run.

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

Wikipedistas (usuários registrados)
A = Wikipedistas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikipedistas que editaram pelo menos dez vezes desde que chegaram
C = Wikipedistas que contribuíram cinco vezes ou mais este mês
D = Wikipedistas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Artigos que contêm pelo menos uma ligação interna e 200 caracteres de texto legível, não contando códigos wiki e html,
      ligações ocultas, etc.; títulos também não contam (outras colunas são baseadas no método oficial de contagem)
G = Novos artigos por dia no mês passado
H = Número médio de revisões por artigo
I = Tamanho médio dos artigos em bytes
J = Porcentagem de artigos com pelo menos 0,5 kb de texto legível (veja F)
K = Porcentagem de artigos com pelo menos 2 kb de texto legível (veja F)

Base de dados
L = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
M = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
N = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
O = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
P = Total de ligações para outras wikipédias
Q = Total de imagens apresentadas
R = Total de ligações para outros sítios
S = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Namespaces: Articles = 0   Talk = 1,3,5,7,9,..   Other = 2,4,6,8,..

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 5  10  5  5  5  5  10  5  10 
mar 2011         
fev 2011         
jan 2011         
dez 2010         
nov 2010         
out 2010         
set 2010         
ago 2010         
jul 2010         
jun 2010         
mai 2010         
abr 2010         
mar 2010         
fev 2010         
jan 2010         
dez 2009         
nov 2009         
out 2009         
set 2009         
ago 2009         
jul 2009         
jun 2009         
mai 2009         
abr 2009         
mar 2009         
fev 2009         
jan 2009         
dez 2008         
nov 2008         
out 2008         
set 2008         
ago 2008         
jul 2008         
jun 2008         
mai 2008         
abr 2008         
mar 2008         
fev 2008         
jan 2008         
dez 2007         
nov 2007         
out 2007         
set 2007         
ago 2007         
jul 20071        
jun 2007         
mai 2007       1 
abr 2007     11  
mar 2007     1 11
fev 2007         
jan 2007         
dez 2006         
nov 2006         
out 2006         
set 2006         
ago 2006         
jul 200611   1   
jun 2006         
mai 2006         
abr 2006         
mar 2006         
fev 2006         
jan 2006         
dez 2005         
nov 2005         
out 2005         
set 2005         
ago 2005         
jul 2005         
jun 2005         
mai 2005         
abr 2005         
mar 2005         
fev 2005         
jan 2005         
dez 2004         
nov 2004         
out 2004         
set 2004         
ago 2004         

 

Distribuição de edições de artigos por wikipedistas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikipedistasEdições total
111100.0%38100.0%
3218.2%2771.1%
1019.1%2052.6%

 

11 wikipedistas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesPrimeira ediçãoúltima edição
 posiçãototaldatadias
atrás
datadias
atrás
A120jul 04, 20061730jul 04, 20061730
Kanon691727jun 14, 20071385jul 07, 20071362
Tangotango32jun 13, 20071386jun 13, 20071386
Kate42jul 10, 20071359jul 10, 20071359
?51ago 29, 20042404ago 29, 20042404
Angela61jun 09, 20052120jun 09, 20052120
Korg71nov 05, 20051971nov 05, 20051971
Thogo81mar 14, 20071477mar 14, 20071477
Pill91mai 11, 20071419mai 11, 20071419
Wankipedia101jun 13, 20071386jun 13, 20071386
Pathoschild111fev 22, 2009766fev 22, 2009766

  

5 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesPrimeira ediçãoúltima edição
 posiçãototaldatadias
atrás
datadias
atrás
Escarbot111jul 09, 20061725fev 06, 20071513
Robbot22mar 04, 20071487jun 28, 20071371
TXiKiBoT31mar 20, 20071471mar 20, 20071471
JAnDbot41mar 28, 20071463mar 28, 20071463
Thijs!bot51abr 03, 20071457abr 03, 20071457

 

Artigos que contêm pelo menos uma ligação interna e .. caracteres de texto legível, não contando códigos wiki e html,
ligações ocultas, etc.; títulos também não contam  (excluindo páginas de redirecionamento)

DataArtigos
 < 32 ch< 64 ch< 128 ch< 256 ch< 512 ch< 1 k ch< 2 k ch< 4 k ch< 8 k ch< 16 k ch< 32 k ch< 64 k ch
mar 20110.0%33.3%33.3%33.3%66.6%99.9%99.9%99.9%99.9%99.9%99.9%99.9%
fev 20110.0%33.3%33.3%33.3%66.6%99.9%99.9%99.9%99.9%99.9%99.9%99.9%
jan 20110.0%33.3%33.3%33.3%66.6%99.9%99.9%99.9%99.9%99.9%99.9%99.9%
dez 20100.0%33.3%33.3%33.3%66.6%99.9%99.9%99.9%99.9%99.9%99.9%99.9%
nov 20100.0%33.3%33.3%33.3%66.6%99.9%99.9%99.9%99.9%99.9%99.9%99.9%
out 20100.0%33.3%33.3%33.3%66.6%99.9%99.9%99.9%99.9%99.9%99.9%99.9%
set 20100.0%33.3%33.3%33.3%66.6%99.9%99.9%99.9%99.9%99.9%99.9%99.9%
ago 20100.0%33.3%33.3%33.3%66.6%99.9%99.9%99.9%99.9%99.9%99.9%99.9%
jul 20100.0%33.3%33.3%33.3%66.6%99.9%99.9%99.9%99.9%99.9%99.9%99.9%
jun 20100.0%33.3%33.3%33.3%66.6%99.9%99.9%99.9%99.9%99.9%99.9%99.9%
mai 20100.0%33.3%33.3%33.3%66.6%99.9%99.9%99.9%99.9%99.9%99.9%99.9%
abr 20100.0%33.3%33.3%33.3%66.6%99.9%99.9%99.9%99.9%99.9%99.9%99.9%
mar 20100.0%33.3%33.3%33.3%66.6%99.9%99.9%99.9%99.9%99.9%99.9%99.9%
fev 20100.0%33.3%33.3%33.3%66.6%99.9%99.9%99.9%99.9%99.9%99.9%99.9%
jan 20100.0%33.3%33.3%33.3%66.6%99.9%99.9%99.9%99.9%99.9%99.9%99.9%
dez 20090.0%33.3%33.3%33.3%66.6%99.9%99.9%99.9%99.9%99.9%99.9%99.9%
nov 20090.0%33.3%33.3%33.3%66.6%99.9%99.9%99.9%99.9%99.9%99.9%99.9%
out 20090.0%33.3%33.3%33.3%66.6%99.9%99.9%99.9%99.9%99.9%99.9%99.9%
set 20090.0%33.3%33.3%33.3%66.6%99.9%99.9%99.9%99.9%99.9%99.9%99.9%
ago 20090.0%33.3%33.3%33.3%66.6%99.9%99.9%99.9%99.9%99.9%99.9%99.9%
jul 20090.0%33.3%33.3%33.3%66.6%99.9%99.9%99.9%99.9%99.9%99.9%99.9%
jun 20090.0%33.3%33.3%33.3%66.6%99.9%99.9%99.9%99.9%99.9%99.9%99.9%
mai 20090.0%33.3%33.3%33.3%66.6%99.9%99.9%99.9%99.9%99.9%99.9%99.9%
abr 20090.0%33.3%33.3%33.3%66.6%99.9%99.9%99.9%99.9%99.9%99.9%99.9%
mar 20090.0%33.3%33.3%33.3%66.6%99.9%99.9%99.9%99.9%99.9%99.9%99.9%
fev 20090.0%33.3%33.3%33.3%66.6%99.9%99.9%99.9%99.9%99.9%99.9%99.9%
jan 20090.0%25.0%50.0%50.0%75.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
dez 20080.0%25.0%50.0%50.0%75.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
nov 20080.0%25.0%50.0%50.0%75.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
out 20080.0%25.0%50.0%50.0%75.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
set 20080.0%25.0%50.0%50.0%75.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
ago 20080.0%25.0%50.0%50.0%75.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
jul 20080.0%25.0%50.0%50.0%75.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
jun 20080.0%25.0%50.0%50.0%75.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
mai 20080.0%25.0%50.0%50.0%75.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
abr 20080.0%25.0%50.0%50.0%75.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
mar 20080.0%25.0%50.0%50.0%75.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
fev 20080.0%25.0%50.0%50.0%75.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
jan 20080.0%25.0%50.0%50.0%75.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
dez 20070.0%25.0%50.0%50.0%75.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
nov 20070.0%25.0%50.0%50.0%75.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
out 20070.0%25.0%50.0%50.0%75.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
set 20070.0%25.0%50.0%50.0%75.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
ago 20070.0%25.0%50.0%50.0%75.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
jul 20070.0%25.0%50.0%50.0%75.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
jun 20070.0%33.3%33.3%33.3%66.6%66.6%99.9%99.9%99.9%99.9%99.9%99.9%
mai 20070.0%0.0%0.0%0.0%50.0%50.0%100.0%100.0%100.0%100.0%100.0%100.0%
abr 20070.0%0.0%0.0%0.0%50.0%50.0%100.0%100.0%100.0%100.0%100.0%100.0%
mar 20070.0%0.0%0.0%0.0%50.0%50.0%100.0%100.0%100.0%100.0%100.0%100.0%
fev 20070.0%0.0%0.0%0.0%50.0%50.0%100.0%100.0%100.0%100.0%100.0%100.0%
jan 200750.0%50.0%50.0%50.0%50.0%50.0%100.0%100.0%100.0%100.0%100.0%100.0%
dez 200650.0%50.0%50.0%50.0%50.0%50.0%100.0%100.0%100.0%100.0%100.0%100.0%
nov 200650.0%50.0%50.0%50.0%50.0%50.0%100.0%100.0%100.0%100.0%100.0%100.0%
out 200650.0%50.0%50.0%50.0%50.0%50.0%100.0%100.0%100.0%100.0%100.0%100.0%
set 200650.0%50.0%50.0%50.0%50.0%50.0%100.0%100.0%100.0%100.0%100.0%100.0%
ago 200650.0%50.0%50.0%50.0%50.0%50.0%100.0%100.0%100.0%100.0%100.0%100.0%
jul 2006100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
jun 20060.0%0.0%0.0%0.0%50.0%50.0%100.0%100.0%100.0%100.0%100.0%100.0%
mai 20060.0%0.0%0.0%0.0%50.0%50.0%100.0%100.0%100.0%100.0%100.0%100.0%
abr 20060.0%0.0%0.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%
mar 20060.0%0.0%0.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%
fev 20060.0%0.0%0.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%
jan 20060.0%0.0%0.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%
dez 20050.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
nov 20050.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
out 20050.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
set 20050.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
ago 20050.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
jul 20050.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
jun 20050.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
mai 20050.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
abr 20050.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
mar 20050.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
fev 20050.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
jan 20050.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
dez 20040.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
nov 20040.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
out 20040.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
set 20040.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
ago 20040.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110
mar 20114542 14 2      33%
fev 20114542 14 2      33%
jan 20114542 14 2      33%
dez 20104542 14 2      33%
nov 20104542 14 2      33%
out 20104542 14 2      33%
set 20104542 14 2      33%
ago 20104542 14 2      33%
jul 20104542 14 2      33%
jun 20104542 14 2      33%
mai 20104542 14 2      33%
abr 20104542 14 2      33%
mar 20104542 14 2      33%
fev 20104542 14 2      33%
jan 20104542 14 2      33%
dez 20094532 14 2      33%
nov 20094532 14 2      33%
out 20094532 14 2      33%
set 20094532 14 2      33%
ago 20094532 14 2      33%
jul 20094522 14 2      33%
jun 20094522 14 2      33%
mai 20094522 14 2      33%
abr 20094522 14 2      33%
mar 20094522 14 2      33%
fev 20094522 14 2      33%
jan 20094512 14 2      25%
dez 20084512 14 2      25%
nov 20084512 14 2      25%
out 20084512 14 2      25%
set 20084512 14 2      25%
ago 20084512 14 2      25%
jul 20084512 14 2      25%
jun 20084512 14 2      25%
mai 20084512 14 2      25%
abr 20084512 14 2      25%
mar 20084512 14 2      25%
fev 20084512 14 2      25%
jan 20084512 14 2      25%
dez 20074512 14 2      25%
nov 20074512 14 2      25%
out 20074512 14 2      25%
set 20074512 14 2      25%
ago 20074512 14 2      25%
jul 20074512 14 2      25%
jun 20073492 14 2      33%
mai 20072472  3 2      50%
abr 20072462  3 2      50%
mar 20072401  3 2      50%
fev 2007228   3 2      50%
jan 2007225   3 2      0%
dez 2006222   3 2      0%
nov 2006221   3 2      0%
out 2006219   3 1      0%
set 2006219   3 1      0%
ago 2006219   3 1      0%
jul 2006219   3 1      0%
jun 2006217   1 1      50%
mai 2006217     1      50%
abr 2006116             
mar 2006114             
fev 2006113             
jan 2006113             
dez 2005111             
nov 2005111             
out 200517             
set 200516             
ago 200515             
jul 200514             
jun 200514             
mai 200513             
abr 200513             
mar 200511             
fev 200511             
jan 200511             
dez 200411             
nov 200411             
out 20041              
set 20041              
ago 20041              

 

2 most edited articles (> 25 edits)
 

EdiçõesUnique usersArtigosArchived
TotalReg.Reg.Unreg.
6542%933Main Page< 1 Mb  
2681%93Baibel< 1 Mb  

 

ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

ago 2004: 1 1 Main Page

jun 2005: 1 1 Main Page

nov 2005: 1 1 Main Page

jul 2006: 1 1 Baibel

mar 2007: 1 1 Main Page

mai 2007: 1 1 Main Page

jun 2007: 1 3 Baibel , 2 1 Aposetolo Ioane

jul 2007: 1 1 Sivarai Namona Ioane Ia Torea

fev 2009: 1 1 Main Page

Wikipedias are initially ordered by number of speakers of the language

Speakers: Number of speakers of a language is the estimated total of primary and secondary speakers, is in many cases a very rough estimation (based on the page on the English Wikipedia about that language)
Regions are parts of the world where the language is spoken in substantial amounts (compared to total number of speakers). Regions where a language gained presence only by a recent diaspora are generally not included.
Region codes: AF:Africa, AS:Asia, EU:Europe, NA:North America, OC:Oceania, SA:South America, W:World Wide, CL:Constructed Language

Estatísticas geradas em Segunda-feira, 4 de abril 2011 a partir de cópias do banco de dados SQL de Quinta-feira, 31 de março 2011
Versão do script:2.6
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.