Estatísticas da Wikipédia kuanyama
Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Articles per size range / Records per namespace / Most edited articles / Zeitgeist
 
Monthly counts & Quarterly rankings
 
DataWikipedistasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia		médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P____Q____R____S__
fev 20112   41 16,222825  6,2 kb89 250(1)  
jan 20112   41 16,222825  6,2 kb89 250(1)  
dez 20102   41 16,222825  6,2 kb89 250(1)  
nov 20102   41 16,222825  6,2 kb89 250(1)  
out 20102   41 16,222825  6,2 kb89 250(1)  
set 20102   41 16,222825  6,2 kb89 250(1)  
ago 20102   41 16,222825  6,2 kb89 250(1)  
jul 20102   41 16,222825  6,2 kb89 250(1)  
jun 20102   41 16,222825  6,2 kb89 250(1)  
mai 20102   41 16,222825  6,2 kb89 250(1)  
abr 20102   41 16,222825  6,2 kb89 250(1)  
mar 20102   41 16,222825  6,2 kb89 250(1)  
fev 20102   41 16,222825  6,2 kb89 250(1)  
jan 20102   41 16,222825  6,2 kb89 250(1)  
dez 20092   41 16,222825  6,2 kb89 250(1)  
nov 20092   41 16,222825  6,2 kb89 250(1)  
out 20092   41 16,222825  6,2 kb89 250(1)  
set 20092   41 16,222825  6,2 kb89 250(1)  
ago 20092   41 16,222825  6,2 kb89 250(1)  
jul 20092   41 16,222825  6,2 kb89 250(1)  
jun 20092   41 16,222825  6,2 kb89 250(1)  
mai 20092   41 16,222825  6,2 kb89 250(1)  
abr 20092   41 16,222825  6,2 kb89 250(1)  
mar 20092   41 16,222825  6,2 kb89 250(1)  
fev 20092   41 16,222825 16,2 kb89 250(1)  
jan 20092   51 12,821920 16,6 kb121 250(1)1 
dez 20082   51 12,620020  6,5 kb105 250(1)1 
nov 20082   51 12,620020  6,5 kb105 250(1)1 
out 20082   51 12,620020  6,5 kb105 250(1)1 
set 20082   51 12,620020  6,5 kb105 250(1)1 
ago 20082   51 12,620020  6,5 kb105 250(1)1 
jul 20082   51 12,620020  6,5 kb105 250(1)1 
jun 20082   51 12,620020  6,5 kb105 250(1)1 
mai 20082   51 12,620020  6,5 kb105 250(1)1 
abr 20082   51 12,620020  6,5 kb105 250(1)1 
mar 20082   51 12,620020  6,5 kb105 250(1)1 
fev 20082   51 12,620020  6,5 kb105 250(1)1 
jan 20082   51 12,620020  6,5 kb105 250(1)1 
dez 20072   51 12,620020  6,5 kb105 250(1)1 
nov 20072   51 12,620020  6,5 kb105 250(1)1 
out 20072   51 12,620020  6,5 kb105 250(1)1 
set 20072   51 12,620020  6,5 kb105 250(1)1 
ago 20072   51 12,620020  6,5 kb105 250(1)1 
jul 20072   51 12,620020 16,5 kb105 250(1)1 
jun 20072   52 12,46504020111 kb4204333(1)10 
mai 20072   52 12,26504020711 kb4204333(1)10 
abr 20072   52 10,86504020310 kb4204326(1)10 
mar 20072   52 10,26504020810 kb4204326(1)10 
fev 20072   52 8,6649402059,3 kb4184284(1)10 
jan 20072   52 7,6649402019,3 kb4184284(1)10 
dez 20062   53 7,47004020210,0 kb45316284(1)27 
nov 20062   53 7700402029,8 kb45316279(1)27 
out 20062   53 6,6700402019,7 kb45216275(1)27 
set 20062   53 6,4700402049,7 kb45216273(1)27 
ago 200621  52 5,6635402068,9 kb4064273(1)10 
jul 20061   41 5,5708252526,5 kb3833157( )10 
jun 20061   41 5708252516,5 kb3833157( )10 
mai 20061   41 4,8652252516,2 kb3463157( )10 
abr 20061   41 4,554225  5,7 kb3063185( )13 
mar 20061 1 41 4,554225 85,7 kb3063185( )13 
fev 20061   11 101783100 14,0 kb271 110( )13 
jan 20061   11 91658100 23,8 kb252 110( )10 
dez 20051   11 7382   1,8 kb69 106( )7 
nov 20051   11 7382   1,8 kb69 106( )7 
out 20051   11 7382   1,8 kb69 106( )7 
set 20051   11 7382   1,8 kb69 106( )7 
ago 20051   11 7382  11,8 kb69 106( )7 
jul 20051   11 6464   1,9 kb79 106( )9 
jun 20051   11 6464  11,9 kb79 106( )9 
mai 20051   11 5500  11,9 kb83 106( )9 
abr 20051   11 4464   1,9 kb79 106( )9 
mar 20051   11 4464   1,9 kb79 106( )9 
fev 20051   11 4464   1,9 kb79 106( )9 
jan 20051   11 4464   1,9 kb79 106( )9 
dez 20041   11 4464   1,9 kb79 106( )9 
nov 20041   11 4464  31,9 kb79 106( )9 
out 20041   11 1445   1,8 kb77 106( )9 
set 20041   11 1445   1,8 kb77 106( )9 
ago 200411  11 1445  11,8 kb77 106( )9 
 totalnovosediçõescontagemnovos
por dia		médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
 WikipedistasArtigosBase de dadosLigações

Counts for image links are based on keyword(s) found in the message file for this language: (Image).
Note that image links based on default keyword 'Image' and/or 'File' have been missed. This will be repaired on the next run.

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

Wikipedistas (usuários registrados)
A = Wikipedistas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikipedistas que editaram pelo menos dez vezes desde que chegaram
C = Wikipedistas que contribuíram cinco vezes ou mais este mês
D = Wikipedistas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Artigos que contêm pelo menos uma ligação interna e 200 caracteres de texto legível, não contando códigos wiki e html,
      ligações ocultas, etc.; títulos também não contam (outras colunas são baseadas no método oficial de contagem)
G = Novos artigos por dia no mês passado
H = Número médio de revisões por artigo
I = Tamanho médio dos artigos em bytes
J = Porcentagem de artigos com pelo menos 0,5 kb de texto legível (veja F)
K = Porcentagem de artigos com pelo menos 2 kb de texto legível (veja F)

Base de dados
L = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
M = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
N = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
O = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
P = Total de ligações para outras wikipédias
Q = Total de imagens apresentadas
R = Total de ligações para outros sítios
S = Total de páginas de redirecionamento
 

Edit activity levels of registered users and bots per group of namespaces

Namespaces: Articles = 0   Talk = 1,3,5,7,9,..   Other = 2,4,6,8,..

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 5  5  5  10  5  5  5  10 
fev 2011        
jan 2011        
dez 2010        
nov 2010        
out 2010        
set 2010        
ago 2010        
jul 2010        
jun 2010        
mai 2010        
abr 2010        
mar 2010        
fev 2010        
jan 2010        
dez 2009        
nov 2009        
out 2009        
set 2009        
ago 2009        
jul 2009        
jun 2009        
mai 2009        
abr 2009        
mar 2009        
fev 2009        
jan 2009        
dez 2008        
nov 2008        
out 2008        
set 2008        
ago 2008        
jul 2008        
jun 2008        
mai 2008        
abr 2008        
mar 2008        
fev 2008        
jan 2008        
dez 2007        
nov 2007        
out 2007        
set 2007        
ago 2007        
jul 2007        
jun 2007        
mai 2007      1 
abr 2007     1  
mar 2007     111
fev 2007     1  
jan 2007        
dez 2006        
nov 2006        
out 2006        
set 2006        
ago 2006        
jul 2006        
jun 2006        
mai 2006        
abr 2006        
mar 20061 11    
fev 2006        
jan 2006        
dez 2005        
nov 2005        
out 2005        
set 2005        
ago 2005        
jul 2005        
jun 2005        
mai 2005        
abr 2005        
mar 2005        
fev 2005        
jan 2005        
dez 2004        
nov 2004        
out 2004        
set 2004        
ago 2004        

 

Distribuição de edições de artigos por wikipedistas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikipedistasEdições total
110100.0%24100.0%
3220.0%1666.7%
10110.0%1145.8%

 

10 wikipedistas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesPrimeira ediçãoúltima edição
 posiçãototaldatadias
atrás		datadias
atrás
Neko111mar 02, 20061823jan 31, 20071488
Johannes_Rohr25fev 12, 20071476mai 17, 20071382
?31ago 29, 20042373ago 29, 20042373
Angela41nov 13, 20042297nov 13, 20042297
Btw51jun 08, 20052090jun 08, 20052090
Thogo61fev 12, 20071476fev 12, 20071476
SallyJ71abr 10, 20071419abr 10, 20071419
Kate81jul 10, 20071328jul 10, 20071328
Spacebirdy91jan 08, 2009780jan 08, 2009780
Pathoschild101fev 22, 2009735fev 22, 2009735

  

5 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesPrimeira ediçãoúltima edição
 posiçãototaldatadias
atrás		datadias
atrás
Escarbot18ago 13, 20061659fev 06, 20071482
JAnDbot24mar 28, 20071432mar 28, 20071432
Thijs!bot34abr 03, 20071426mai 22, 20071377
Robbot42mar 04, 20071456jun 28, 20071340
TXiKiBoT51mar 20, 20071440mar 20, 20071440

 

Artigos que contêm pelo menos uma ligação interna e .. caracteres de texto legível, não contando códigos wiki e html,
ligações ocultas, etc.; títulos também não contam  (excluindo páginas de redirecionamento)

DataArtigos
 < 32 ch< 64 ch< 128 ch< 256 ch< 512 ch< 1 k ch< 2 k ch< 4 k ch< 8 k ch< 16 k ch< 32 k ch< 64 k ch
fev 20110.0%0.0%50.0%75.0%75.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
jan 20110.0%0.0%50.0%75.0%75.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
dez 20100.0%0.0%50.0%75.0%75.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
nov 20100.0%0.0%50.0%75.0%75.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
out 20100.0%0.0%50.0%75.0%75.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
set 20100.0%0.0%50.0%75.0%75.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
ago 20100.0%0.0%50.0%75.0%75.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
jul 20100.0%0.0%50.0%75.0%75.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
jun 20100.0%0.0%50.0%75.0%75.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
mai 20100.0%0.0%50.0%75.0%75.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
abr 20100.0%0.0%50.0%75.0%75.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
mar 20100.0%0.0%50.0%75.0%75.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
fev 20100.0%0.0%50.0%75.0%75.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
jan 20100.0%0.0%50.0%75.0%75.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
dez 20090.0%0.0%50.0%75.0%75.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
nov 20090.0%0.0%50.0%75.0%75.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
out 20090.0%0.0%50.0%75.0%75.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
set 20090.0%0.0%50.0%75.0%75.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
ago 20090.0%0.0%50.0%75.0%75.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
jul 20090.0%0.0%50.0%75.0%75.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
jun 20090.0%0.0%50.0%75.0%75.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
mai 20090.0%0.0%50.0%75.0%75.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
abr 20090.0%0.0%50.0%75.0%75.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
mar 20090.0%0.0%50.0%75.0%75.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
fev 20090.0%0.0%50.0%75.0%75.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
jan 20090.0%0.0%40.0%80.0%80.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
dez 20080.0%0.0%60.0%80.0%80.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
nov 20080.0%0.0%60.0%80.0%80.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
out 20080.0%0.0%60.0%80.0%80.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
set 20080.0%0.0%60.0%80.0%80.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
ago 20080.0%0.0%60.0%80.0%80.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
jul 20080.0%0.0%60.0%80.0%80.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
jun 20080.0%0.0%60.0%80.0%80.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
mai 20080.0%0.0%60.0%80.0%80.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
abr 20080.0%0.0%60.0%80.0%80.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
mar 20080.0%0.0%60.0%80.0%80.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
fev 20080.0%0.0%60.0%80.0%80.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
jan 20080.0%0.0%60.0%80.0%80.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
dez 20070.0%0.0%60.0%80.0%80.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
nov 20070.0%0.0%60.0%80.0%80.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
out 20070.0%0.0%60.0%80.0%80.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
set 20070.0%0.0%60.0%80.0%80.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
ago 20070.0%0.0%60.0%80.0%80.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
jul 20070.0%0.0%60.0%80.0%80.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
jun 20070.0%0.0%40.0%60.0%60.0%80.0%80.0%100.0%100.0%100.0%100.0%100.0%
mai 20070.0%0.0%40.0%60.0%60.0%80.0%80.0%100.0%100.0%100.0%100.0%100.0%
abr 20070.0%0.0%40.0%60.0%60.0%80.0%80.0%100.0%100.0%100.0%100.0%100.0%
mar 20070.0%0.0%40.0%60.0%60.0%80.0%80.0%100.0%100.0%100.0%100.0%100.0%
fev 20070.0%0.0%40.0%60.0%60.0%80.0%80.0%100.0%100.0%100.0%100.0%100.0%
jan 20070.0%0.0%40.0%60.0%60.0%80.0%80.0%100.0%100.0%100.0%100.0%100.0%
dez 20060.0%0.0%40.0%40.0%60.0%80.0%80.0%100.0%100.0%100.0%100.0%100.0%
nov 20060.0%0.0%40.0%40.0%60.0%80.0%80.0%100.0%100.0%100.0%100.0%100.0%
out 20060.0%0.0%40.0%40.0%60.0%80.0%80.0%100.0%100.0%100.0%100.0%100.0%
set 20060.0%0.0%40.0%40.0%60.0%80.0%80.0%100.0%100.0%100.0%100.0%100.0%
ago 20060.0%0.0%40.0%60.0%60.0%80.0%80.0%100.0%100.0%100.0%100.0%100.0%
jul 20060.0%0.0%50.0%75.0%75.0%75.0%75.0%100.0%100.0%100.0%100.0%100.0%
jun 20060.0%0.0%50.0%75.0%75.0%75.0%75.0%100.0%100.0%100.0%100.0%100.0%
mai 20060.0%0.0%50.0%75.0%75.0%75.0%75.0%100.0%100.0%100.0%100.0%100.0%
abr 20060.0%0.0%50.0%75.0%75.0%75.0%100.0%100.0%100.0%100.0%100.0%100.0%
mar 20060.0%0.0%50.0%75.0%75.0%75.0%100.0%100.0%100.0%100.0%100.0%100.0%
fev 20060.0%0.0%0.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%
jan 20060.0%0.0%0.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%
dez 20050.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
nov 20050.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
out 20050.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
set 20050.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
ago 20050.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
jul 20050.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
jun 20050.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
mai 20050.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
abr 20050.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
mar 20050.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
fev 20050.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
jan 20050.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
dez 20040.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
nov 20040.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
out 20040.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
set 20040.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
ago 20040.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1		Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110
fev 20116482 11 1      25%
jan 20116482 11 1      25%
dez 20106482 11 1      25%
nov 20106482 11 1      25%
out 20106482 11 1      25%
set 20106482 11 1      25%
ago 20106482 11 1      25%
jul 20106482 11 1      25%
jun 20106482 11 1      25%
mai 20106482 11 1      25%
abr 20106482 11 1      25%
mar 20106482 11 1      25%
fev 20106482 11 1      25%
jan 20106482 11 1      25%
dez 20096472 11 1      25%
nov 20096472 11 1      25%
out 20096472 11 1      25%
set 20096472 11 1      25%
ago 20096472 11 1      25%
jul 20096462 11 1      25%
jun 20096462 11 1      25%
mai 20096462 11 1      25%
abr 20096462 11 1      25%
mar 20096462 11 1      25%
fev 20096462 11 1      25%
jan 20096452 11 1      20%
dez 20086452 11 1      20%
nov 20086452 11 1      20%
out 20086452 11 1      20%
set 20086452 11 1      20%
ago 20086452 11 1      20%
jul 20086452 11 1      20%
jun 20086452 11 1      20%
mai 20086452 11 1      20%
abr 20086452 11 1      20%
mar 20086452 11 1      20%
fev 20086452 11 1      20%
jan 20086452 11 1      20%
dez 20076452 11 1      20%
nov 20076452 11 1      20%
out 20076452 11 1      20%
set 20076452 11 1      20%
ago 20076452 11 1      20%
jul 20076452 11 1      20%
jun 20076432 11 1      20%
mai 20076422  1 1      20%
abr 20075412  1 1      20%
mar 20075371  1 1      20%
fev 20075271  1 1      20%
jan 2007523   1 1      20%
dez 2006521   1 1      20%
nov 2006518   1 1      20%
out 2006518   1 1      20%
set 2006517   1 1      20%
ago 2006516   1 1      20%
jul 2006416   1 1      0%
jun 2006416   1 1      0%
mai 2006416             
abr 2006416             
mar 2006414             
fev 2006113             
jan 2006113             
dez 2005111             
nov 2005110             
out 200517             
set 200516             
ago 200515             
jul 200514             
jun 200514             
mai 200513             
abr 200513             
mar 200511             
fev 200511             
jan 200511             
dez 200411             
nov 200411             
out 20041              
set 20041              
ago 20041              

 

1 most edited articles (> 25 edits)
 

EdiçõesUnique usersArtigosArchived
TotalReg.Reg.Unreg.
3247%913Main Page< 1 Mb  

 

ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

ago 2004: 1 1 Main Page

nov 2004: 1 1 Main Page

jun 2005: 1 1 Main Page

mar 2006: 1 1 Omafiku oko shivike

jul 2006: 1 1 Main Page

ago 2006: 1 1 Ombibeli

jan 2007: 1 1 Omwedi

fev 2007: 1 2 Main Page

mar 2007: 1 1 Main Page

abr 2007: 1 2 Omafimbo odula

mai 2007: 1 1 Main Page

jul 2007: 1 1 Main Page

jan 2009: 1 1 Main Page

fev 2009: 1 1 Main Page

Wikipedias are initially ordered by number of speakers of the language

Speakers: Number of speakers of a language is the estimated total of primary and secondary speakers, is in many cases a very rough estimation (based on the page on the English Wikipedia about that language)
Regions are parts of the world where the language is spoken in substantial amounts (compared to total number of speakers). Regions where a language gained presence only by a recent diaspora are generally not included.
Region codes: AF:Africa, AS:Asia, EU:Europe, NA:North America, OC:Oceania, SA:South America, W:World Wide, CL:Constructed Language

Estatísticas geradas em Segunda-feira, 4 de abril 2011 a partir de cópias do banco de dados SQL de Quinta-feira, 31 de março 2011
Versão do script:2.6
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.