Estatísticas da Wikipédia lezgian

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Articles per size range / Records per namespace / Most edited articles / Zeitgeist
 
  Dec 2017: WMF Analytics Team is happy to announce the first release of Wikistats 2
  

  Wikistats has been redesigned for architectural simplicity, faster data processing, and a more dynamic and interactive user experience. The data used in the reports will also be made available for external processing.  

  First goal is to match the numbers of the current system, and to provide the most important reports, as decided by the Wikistats community (see survey).  
  Over time, we will continue to migrate reports and add new ones that you find useful. We can also analyze the data in new and interesting ways, and look forward to hearing your feedback and suggestions.  

  You can go directly to Wikipedia lezgian

  

Most metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.

Some metrics have been collected from the full archive dump which runs on lower frequency than the usual monthly cycle.
These metrics are columns F,I,J,K,M,N,O,P,Q,R from the first table.


See also metrics definitions


 
Monthly counts & Quarterly rankings: março 2018
 
DataWikipedistasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
mar 20180%   0%      -60%      0%
fev 20180%   0%      -68%      0%
jan 20180%   +2%      +204%      0%
dez 2017+1%   0%      -43%      0%
nov 20170%   0%      -3%      0%
out 2017+1%   +1%      +12%      0%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P____Q____R____S__
mar 201870   4,0 k  11,6   21      1,3 k
fev 201870 3 4,0 k  11,6   52      1,3 k
jan 201870 414,0 k 211,6   161      1,2 k
dez 20177014 3,9 k  11,8   53      1,2 k
nov 201769 4 3,9 k  11,8   93      1,2 k
out 20176913 3,9 k 111,8   96      1,2 k
set 201768 2 3,9 k  11,9   86      1,2 k
ago 20176811 3,8 k  11,8   38      1,2 k
jul 201767 3 3,8 k 111,8   90      1,2 k
jun 201767 4 3,8 k  11,9   55      1,2 k
mai 201767 3 3,8 k  11,9   252      1,2 k
abr 201767 2 3,8 k  11,9   60      1,2 k
mar 2017671323,8 k 311,9   618      1,2 k
fev 201766 313,7 k 2012   2,2 k      1,2 k
jan 201766 313,1 k 213,4   500      767
dez 2016661513,1 k 513,6   730      737
nov 2016651312,9 k 214   340      680
out 201664 512,9 k 314,3   445      645
set 20166413 2,8 k  14,6   187      632
ago 201663 112,7 k  14,6   193      629
jul 201663 312,7 k  14,5   308      628
jun 201663 112,7 k  14,5   170      619
mai 201663 112,7 k  14,5   197      619
abr 201663 1 2,7 k  14,4   72      617
mar 201663 412,7 k  14,4   198      617
fev 201663 412,7 k  14,4   203      612
jan 20166316 2,7 k  14,4   241      612
dez 201562 2 2,7 k  14,3   43      611
nov 201562 3 2,7 k  14,3   112      610
out 2015621512,7 k  14,3   242      607
set 201561 212,7 k 214,3   284      605
ago 201561 412,6 k  14,5   245      602
jul 201561 412,6 k 214,5   594      599
jun 201561 412,5 k 314,7   431      586
mai 201561 312,4 k 815   1,3 k      578
abr 2015611422,2 k 216,1   554      575
mar 2015601612,1 k  16,3   550      561
fev 201559 4 2,1 k 116,1   141      552
jan 201559 3 2,1 k 116,2   90      546
dez 201459 3 2,1 k  16,2   46      544
nov 201459 2 2,1 k  16,2   65      542
out 20145913 2,1 k  16,3   110      541
set 20145813 2,1 k 116,3   70      538
ago 201457 412,0 k 216,4   287      536
jul 201457 212,0 k 116,7   177      529
jun 20145726 2,0 k 116,8   230      526
mai 2014551611,9 k 116,9   279      518
abr 201454 4 1,9 k  17   159      496
mar 201454 4 1,9 k  17   137      489
fev 201454 2 1,9 k1,7 k 17233180%39%858,5 Mb587 k36 k2402,3 k5,4 k483
jan 2014542611,9 k1,7 k 17233380%39%3548,5 Mb584 k36 k2402,2 k5,4 k480
dez 201352 3 1,9 k1,7 k 16,9233080%39%1448,5 Mb581 k35 k2402,2 k5,4 k477
nov 201352 4 1,9 k1,7 k116,9232880%39%1728,4 Mb578 k35 k2402,2 k5,4 k476
out 2013521311,9 k1,7 k316,9233280%39%5288,4 Mb574 k35 k2432,2 k5,3 k470
set 201351 311,8 k1,6 k217,5226579%36%5707,7 Mb533 k32 k3552,2 k4,9 k467
ago 201351 221,7 k1,6 k517,7218578%34%9027,3 Mb500 k31 k3552,2 k4,6 k462
jul 201351 2 1,6 k1,4 k118,8207076%30%1576,3 Mb433 k27 k5312,1 k3,9 k428
jun 201351 311,6 k1,4 k218,9205776%29%6346,1 Mb426 k26 k5342,1 k3,9 k426
mai 201351 211,5 k1,3 k219,5199275%27%4115,7 Mb395 k24 k4862,1 k3,5 k414
abr 201351 521,4 k1,2 k120194274%25%6605,3 Mb370 k23 k4892,1 k3,2 k413
mar 2013511511,4 k1,2 k 20,1187172%24%2,1 k4,9 Mb346 k22 k1,1 k2,1 k3,0 k398
fev 201350 321,4 k1,2 k318,8183473%23%1,3 k6,5 Mb337 k21 k67 k2,1 k2,9 k390
jan 201350 421,3 k1,1 k218,9182572%24%1,6 k6,2 Mb318 k21 k66 k2,1 k2,8 k383
dez 201250 511,2 k1,1 k218,6180973%22%1,2 k5,9 Mb301 k20 k64 k2,1 k2,6 k372
nov 2012501711,2 k1,0 k418,6174871%19%1,1 k5,5 Mb276 k18 k63 k2,1 k2,4 k361
out 2012492521,1 k946619,4175769%18%1,2 k5,1 Mb254 k17 k61 k1,9 k2,2 k353
set 201247 51854746122,6185162%21%1,3 k4,5 Mb220 k15 k58 k1,5 k1,9 k337
ago 201247162824711121,8178861%21%9594,3 Mb204 k15 k56 k1,5 k1,7 k332
jul 2012462123803689121,2167360%19%1,3 k3,9 Mb186 k13 k54 k1,2 k1,6 k313
jun 2012441133764637220,6145455%17%1,7 k3,4 Mb154 k11 k50 k1,1 k1,4 k290
mai 201243193706564219,9123751%15%2,2 k2,9 Mb121 k8,2 k47 k1,0 k1,1 k247
abr 2012423185654500318,198445%12%3,1 k2,4 Mb89 k6,2 k42 k790727184
mar 20123910215552393115,981140%9%2,4 k1,8 Mb61 k3,4 k34 k70834890
fev 201229 41524388 12,280041%9%6751,6 Mb59 k3,2 k28 k68830785
jan 201229121521386 1178041%8%2331,4 Mb57 k3,3 k23 k68730681
dez 201128 41517383110,677241%8%2771,4 Mb56 k3,2 k23 k68430481
nov 201128371497370110,578942%8%4281,3 Mb55 k3,1 k21 k66430374
out 201125 4 478348 1078441%8%3481,3 Mb52 k2,8 k21 k65029757
set 201125410247334539,478741%8%7371,1 Mb52 k2,8 k14 k64931355
ago 20112159237126951087644%10%1,1 k954 kb45 k2,4 k12 k53331138
jul 201116281218166111,973245%8%361537 kb23 k8298,7 k35918712
jun 201114 51177131212,780452%10%1,2 k487 kb21 k6528,0 k28016411
mai 2011143811105719,860327%12%436322 kb9,9 k2967,3 k106298
abr 20111125 774018,451126%12%157210 kb5,8 k1484,9 k8816
mar 2011923 593418,360231%15%140201 kb5,3 k1284,9 k7516
fev 20117   3931 8,983644%23%3169 kb4,9 k1223,7 k56 6
jan 20117   3831 9,183645%24%3167 kb4,9 k1223,7 k56 6
dez 2010712 3831 983645%24%72167 kb4,9 k1223,7 k56 6
nov 20106   3823 7,1131139%24% 130 kb7,8 k1219195922
out 2010612 3823 7,1131139%24%33130 kb7,8 k1219195922
set 2010511 362216,6145742%19%113128 kb7,6 k1219186322
ago 2010422 1818 6,9103167%28%5766 kb2,9 k12089457 1
jul 20102   55 13,685760%40%415 kb956151334 1
jun 20102   55 12,885760%40% 15 kb956151334 1
mai 20102   55 12,885760%40%315 kb956151334 1
abr 20102   55 12,285760%40% 15 kb956151334 1
mar 20102   55 12,285760%40% 15 kb956151334 1
fev 20102   55 12,285760%40% 15 kb956151334 1
jan 20102   55 12,285760%40%315 kb956151334 1
dez 20092   55 11,685760%40% 15 kb956151294 1
nov 20092   55 11,685760%40% 15 kb956151294 1
out 20092   55 11,685760%40% 15 kb956151294 1
set 20092   55 11,685760%40% 15 kb956151294 1
ago 20092   55 11,685760%40% 15 kb956151294 1
jul 20092   55 11,685760%40%115 kb956151294 1
jun 20092   55 11,485760%40% 14 kb95615184 1
mai 20092   55 11,485760%40% 14 kb95615184 1
abr 20092   55 11,485760%40% 14 kb95615184 1
mar 20092   55 11,485760%40% 14 kb95615184 1
fev 20092   55 11,485760%40% 14 kb95615184 1
jan 20092   55 11,485760%40% 14 kb95615184 1
dez 20082 1 55 11,485760%40%914 kb95615184 1
nov 20082   55 9,682660%40%112 kb9261183 1
out 20082   55 9,482560%40% 12 kb9231183 1
set 20082   55 9,482560%40% 12 kb9231183 1
ago 20082   55 9,482560%40% 12 kb9231183 1
jul 20082   55 9,482560%40% 12 kb9231183 1
jun 20082   55 9,482560%40% 12 kb9231183 1
mai 20082   55 9,482560%40%612 kb9231183 1
abr 20082   55 8,282560%40%412 kb9231183 1
mar 20082   55 7,481360%40%712 kb9071183 1
fev 20082   34 101615100%100% 19 kb1,3 k6921111
jan 20082 1 34 101615100%100%519 kb1,3 k6921111
dez 2007211 32 8,3145467%67%1718 kb7626629 1
nov 20071   11 82920100%100%65,9 kb3476328  
out 200711  1  242  2104 6     
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
The following table ranks this project in relation to projects in other languages with 1000+ articles
jan 2018180 150146183 121203   167      277
out 2017178145154 183 149201   175      277
jul 2017181 167 183 148200   171      277
abr 2017175 172 183  202   181      277
jan 2017173 147140195 124188   130      277
out 2016176 122136201 112183   126      277
jul 2016174 153138203  180   135      277
abr 2016171 199 202  184   176      277
jan 2016171149121 202  184   149      277
out 2015169138125143199  183   149      277
jul 2015169 137131196 113187   116      277
abr 2015166158141113201 125175   126      277
jan 2015169 154 199 156171   178      277
out 2014165144154 200  173   162      277
jul 2014166 170137200 149167   155      277
abr 2014170 141 201  164   164      277
jan 2014164117121142198183159167497027141147161159215140133277
out 2013163148157128198183104172476827109148159159222139133277
jul 2013163145171138207188151159607849158156175173192138139277
abr 2013162153128111209188155152707961140164179178202138144277
jan 2013159151137103209187120158728665155185183177206141143277
out 201215810912410521619285150789592175194188182208141151277
jul 2012159998894223204150217216215213168204195185210155160277
abr 2012164857676226210109215214213210110216217213220169187277
jan 2012189144170137229217152214213212209239232232231238179211277
out 2011197156142151229218164213212211208233230231236238178210277
jul 201123311499135247237161210209208205230250242247256201219277
abr 201124599130136269256150204203202199245264263267263245272277
jan 2011266156237141274261162202201200197274267265267266258272277
out 2010268146177135274263157194193192190267266256267272250271277
jul 2010276169236144276272160190189188186274272272272272271272277
abr 2010275156219142276271161187186185184275272272272272269272277
jan 2010274150215134275271156184184183182268273272272272268272277
out 2009274150219137275271161182182181180271273272272272267272277
jul 2009272197211137274269152175175174173266269269271271267269277
abr 2009271146212147271268147172172171170269270269271270267266277
jan 2009270137216135271267149167167166165273268268268269267267276
out 2008268143210137269262147161161160159268265265266267265266274
jul 2008264156215135265259150155155154152265262261263265261265273
abr 2008262152219133264257154150150148146263261257263265260263273
jan 2008257159203136262254155145145143142255257250245260244255269
out 2007260133212136265261151143143140140256264262262258254252267
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
 WikipedistasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikipedistas (usuários registrados)
A = Wikipedistas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikipedistas que editaram pelo menos dez vezes desde que chegaram
C = Wikipedistas que contribuíram cinco vezes ou mais este mês
D = Wikipedistas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Artigos que contêm pelo menos uma ligação interna e 200 caracteres de texto legível, não contando códigos wiki e html,
      ligações ocultas, etc.; títulos também não contam (outras colunas são baseadas no método oficial de contagem)
G = Novos artigos por dia no mês passado
H = Número médio de revisões por artigo
I = Tamanho médio dos artigos em bytes
J = Porcentagem de artigos com pelo menos 0,5 kb de texto legível (veja F)
K = Porcentagem de artigos com pelo menos 2 kb de texto legível (veja F)

Base de dados
L = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
M = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
N = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
O = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
P = Total de ligações para outras wikipédias
Q = Total de imagens apresentadas
R = Total de ligações para outros sítios
S = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  5  10  100  1000  1  3  5  10  25  100  5  10  1  3  5  10  25  100  250  5  10  100 
mar 201883                21111  11 
fev 201810432               43222  11 
jan 20181044111      3221    62222  11 
dez 20175442       211     64322  11 
nov 20179643   11  222     22211  1  
out 2017113321      2       72222     
set 2017143221      111     42221  11 
ago 20177411   1           43211  11 
jul 201783321              42111  11 
jun 20179541       1       53221  11 
mai 201794322  111 1       63332  11 
abr 2017114221  1   1       22111  11 
mar 201711433321 1   43311   533331111 
fev 201713632211122  211     73221  11 
jan 201710331111     6       422111 11 
dez 201611753211     6321    54221  11 
nov 2016733221  1   2221    622111 11 
out 201610555311     4322    1065111 11 
set 2016104332  11  32      51111     
ago 2016821111      31      421       
jul 2016733221      2       4211   11 
jun 20161321111      1       52     11 
mai 2016731111      2       411    11 
abr 201671111      5       9111   11 
mar 20161144211  1   1       411    11 
fev 2016964311      311     811    22 
jan 2016147643      411     72111  22 
jan 20181044111      3221    62222  11 
out 2017113321      2       72222     
jul 201783321              42111  11 
abr 2017114221  1   1       22111  11 
jan 201710331111     6       422111 11 
out 201610555311     4322    1065111 11 
jul 2016733221      2       4211   11 
abr 201671111      5       9111   11 
jan 2016147643      411     72111  22 
out 20151275311      1       9111   32 
jul 201510443311 1   211     54421  22 
abr 201511544321 11  5221  22533221 22 
jan 201584332      831     5211   22 
out 2014114322  1   2       82111  22 
jul 2014922211      1       43221  22 
abr 2014115433  1   221     72221  21 
jan 20141286431  11  321     5211   32 
out 20139432111 21  62      632211111 
jul 201342222      31      92221  33 
abr 201312555321 43  4443    1133322 541
jan 201315544221 1363 6322    933321 961
out 201211655321 862 74321   1254321 851
jul 2012181212853  872 1711842   2314131031 771
abr 201232211810754 971 341914953  552212774143 
jan 2012742221      1       1         
out 201185441  111         11111  11 
jul 201110885111     322     421111    
abr 201165551      1       1         
jan 2011                            
out 20103221               2111      
jul 2010                            
abr 2010                  2         
jan 2010                            
out 2009                            
jul 20091                           
abr 2009                            
jan 2009                  1         
out 2008                            
jul 2008                  2         
abr 200811                          
jan 2008111                          
out 20072                           

 

Distribuição de edições de artigos por wikipedistas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikipedistasEdições total
1379100.0%34,293100.0%
312031.7%33,94499.0%
106918.2%33,64298.1%
32369.5%33,04296.4%
100195.0%32,22994.0%
316133.4%31,33591.4%
100061.6%27,63580.6%
316220.5%20,58560.0%
1000010.3%15,21444.4%

 

7 wikipedistas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdições 
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
 agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
Aslan XasiyevUC1 015,21433,163-mar 27, 201221942,447---
Soul TrainUC2 05,37126,8731mar 28, 20122193190---
MugerganetsUC6 01,2073129-out 13, 201219941283--
Rachmat04UC96+861--jun 08, 2017295----
MukhayUC377...11--mar 15, 201815----
DostojewskijUC378...11--mar 19, 201811----
MagnusFitUC379...11--mar 23, 20187----

 

20 wikipedistas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
  Primeira ediçãoúltima edição
 posiçãototaldatadias
atrás
datadias
atrás
Namik555UC32,741mar 07, 20112580abr 21, 20122169
MigraghviUC41,633ago 31, 20112403fev 16, 201842
LezgistxaUC51,469set 20, 20112383jun 01, 20122128
User from DagUC7819ago 17, 20102782dez 29, 201791
SPQRobinUC8617mar 27, 20122194mar 27, 20122194
Tamara UstinovaUC9572nov 14, 20112328dez 04, 20131577
KmoksyUC10510ago 11, 20112423fev 12, 20151142
imported>Aslan4ikUC11412jan 21, 20122260mar 27, 20122194
MBHUC12386mar 11, 20151115mar 11, 20151115
Saint JohannUC13384mar 28, 20122193out 15, 20121992
FrhdkazanUC14213jan 26, 2016794ago 31, 2017211
Cekli829UC15188mar 10, 20112577abr 24, 2016705
MaqiviUC16154out 07, 20112366out 07, 2017174
U.SteeleUC17122ago 02, 20112432mar 31, 20122190
LezgiUC18114abr 27, 20112529jun 02, 20122127
HydrizUC19103jan 30, 20141520jan 30, 20141520
NessajaUC2090abr 25, 20122165out 05, 20141272
МаликумUC2189fev 07, 20122243jun 30, 2016638
ZagirskiUC2277set 16, 2016560out 30, 2016516
91i79UC2355mar 27, 20122194out 12, 20141265

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 1.852 edições foram feitas por usuários anônimos, de um total de 46.100 edições ( 4e %)
  


43 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições 
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
 datadias
atrás
datadias
atrás
MerlIwBotUC12,572mai 27, 20112499ago 09, 2013169416-
EmausBotUC21,624abr 16, 20122174nov 09, 20131602148-
AddbotUC31,444mar 07, 20131849ago 16, 20131687--
XqbotUC41,088abr 16, 20122174fev 09, 201849--
JackieBotUC5904abr 26, 20122164dez 01, 20141215--
AvocatoBotUC6442mar 29, 20122192jul 07, 20122092--
GerakibotUC7324mai 24, 20122136mar 06, 20131850--
MBHbotUC8186mar 11, 20151115mai 08, 2017326--
RedBotUC9168abr 22, 20122168ago 21, 20122047--
CommonsDelinkerUC10154abr 26, 20112530mar 31, 2018---
Makecat-botUC11147nov 01, 20121975mar 03, 20131853--
LegobotUC12105mar 11, 20131845abr 02, 20131823--
Idioma-botUC1393mar 27, 20122194mar 04, 20131852--
Justincheng12345-botUC1489jun 25, 20122104jan 10, 20131905--
EscarbotUC1563abr 03, 20122187set 07, 2016569--
YFdyh-botUC1662jul 01, 20122098fev 18, 20131866--
LaaknorBotUC1759mai 22, 20122138mar 05, 20131851--
JhsBotUC1855mar 28, 20122193jul 08, 201220911-
VolkovBotUC1947abr 28, 20122162fev 27, 20131857--
KamikazeBotUC2044mar 29, 20122192jan 24, 20131891--
JAnDbotUC2140mar 29, 20122192jul 02, 20131732--
AvicBotUC2240jun 01, 20122128dez 09, 20121937--
CarsracBotUC2335mar 31, 20122190fev 12, 20131872--
HiW-BotUC2429abr 07, 20122183out 18, 20121989--
VagobotUC2522mar 29, 20122192abr 30, 20122160--
SynthebotUC2621set 20, 20122017jan 25, 20131890--
SantoshBotUC2721out 21, 20121986jan 31, 20131884--
タチコマ robotUC2813dez 05, 20112307out 21, 20121986--
PixelBotUC2913jul 20, 20122079mar 06, 20131850--
JotterbotUC3012jan 15, 20131900jan 18, 20131897--
Crochet.david.botUC316mai 07, 20083614mai 07, 20083614--
RobbotUC326mai 07, 20122153jan 02, 20131913--
CocuBotUC335ago 26, 20122042dez 15, 20121931--
OctraBotUC345mai 12, 20141418jan 30, 20151155--
NjardarBotUC354ago 28, 20122040ago 31, 20122037--
YiFeiBotUC363ago 05, 2015968ago 05, 2015968--
SassoBotUC372mai 29, 20122131jan 07, 20131908--
ObersachsebotUC382nov 24, 20121952jan 08, 20131907--
DragonBotUC392jan 13, 20131902jan 14, 20131901--
MalarzBOTUC401ago 18, 20122050ago 18, 20122050--
GhalyBotUC411jan 18, 20131897jan 18, 20131897--
SAMI.BotUC421fev 05, 20131879fev 05, 20131879--
MastiBotUC431mar 01, 20131855mar 01, 20131855--

 

Artigos que contêm pelo menos uma ligação interna e .. caracteres de texto legível, não contando códigos wiki e html,
ligações ocultas, etc.; títulos também não contam  (excluindo páginas de redirecionamento)

DataArtigos
 < 32 ch< 64 ch< 128 ch< 256 ch< 512 ch< 1 k ch< 2 k ch< 4 k ch< 8 k ch< 16 k ch< 32 k ch< 64 k ch

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110JpgPngSvg
mar 20185,2 k383124111232,0 k 1,5 k       731
fev 20185,2 k383124111231,9 k 1,5 k       731
jan 20185,2 k381124111231,9 k 1,5 k       731
dez 20175,1 k381123111231,8 k 1,5 k       731
nov 20175,1 k379123111231,8 k 1,5 k       731
out 20175,1 k379123111231,8 k 1,5 k       731
set 20175,1 k379123111231,7 k 1,5 k       731
ago 20175,1 k378123111231,7 k 1,5 k       731
jul 20175,1 k378123111231,6 k 1,5 k       731
jun 20175,0 k375123111231,6 k 1,5 k       731
mai 20175,0 k375123111231,6 k 1,5 k       731
abr 20175,0 k375123111231,5 k 1,5 k       731
mar 20175,0 k375123111211,5 k 1,5 k       731
fev 20174,8 k37512191191,4 k 1,3 k       711
jan 20173,9 k37312191191,4 k 1,2 k       711
dez 20163,8 k37312191191,4 k 1,2 k       711
nov 20163,6 k37212091191,4 k 1,1 k       711
out 20163,5 k37110391161,4 k 1,1 k       711
set 20163,4 k3651019851,4 k 1,1 k       711
ago 20163,3 k364999801,4 k 1,1 k       711
jul 20163,3 k363999801,4 k 1,1 k       711
jun 20163,3 k362988801,4 k 1,1 k       7 1
mai 20163,3 k362988791,4 k 1,1 k       7 1
abr 20163,3 k361987791,4 k 1,1 k       7  
mar 20163,3 k355987791,4 k 1,1 k       7  
fev 20163,3 k355987791,4 k 1,1 k       7  
jan 20163,3 k354987791,4 k 1,1 k       7  
dez 20153,2 k353967791,4 k 1,1 k       7  
nov 20153,2 k349957791,4 k 1,1 k       7  
out 20153,2 k348937791,4 k 1,1 k       7  
set 20153,2 k347937791,3 k 1,1 k       7  
ago 20153,1 k345927791,3 k 1,1 k       7  
jul 20153,1 k345917761,3 k 1,1 k       7  
jun 20153,0 k344917761,3 k 1,1 k       7  
mai 20152,9 k342917761,3 k 1,1 k       7  
abr 20152,7 k340897761,3 k 1,0 k       7  
mar 20152,6 k340867761,2 k 999       7  
fev 20152,6 k337837751,2 k 998       7  
jan 20152,6 k333837751,2 k 996       7  
dez 20142,5 k326817751,2 k 994       7  
nov 20142,5 k323807751,2 k 993       7  
out 20142,5 k320797751,2 k 991       7  
set 20142,5 k318777751,2 k 980       7  
ago 20142,5 k314767721,2 k 980       7  
jul 20142,4 k311757721,2 k 975       7  
jun 20142,4 k310747721,1 k 973       7  
mai 20142,4 k310737711,1 k 966       7  
abr 20142,4 k306707691,1 k 959       7  
mar 20142,3 k304687691,1 k 958       7  
fev 20142,3 k301677691,1 k 956      537  
jan 20142,3 k296667691,1 k 953      2107  
dez 20132,2 k292647691,1 k 944      1137  
nov 20132,2 k292637691,1 k 933      1387  
out 20132,2 k285617681,1 k 927      4447  
set 20132,1 k280606681,1 k 909      5516  
ago 20132,0 k266576681,1 k 889      8756  
jul 20131,8 k262526641,0 k 831      1356  
jun 20131,8 k26051662997 812      6016  
mai 20131,7 k25549258960 750      3772  
abr 20131,7 k25048258950 735      5852  
mar 20131,6 k24147258914 707      4342  
fev 20131,6 k22544258901 690      3882  
jan 20131,5 k21441252871 646      9192  
dez 20121,4 k21039252833 598      5762  
nov 20121,3 k19837252803 561      5052  
out 20121,2 k18735 51763 545      644   
set 201299818233 49724 496      407   
ago 201296217332 44670 428      450   
jul 201292016426 38610 375      644   
jun 201284015521 35545 339      1073   
mai 201272913514 33456 268      1584   
abr 20126111229 19235 131      2524   
mar 2012486572  115 79      1898   
fev 201297    5 3      208   
jan 201294    5 3      222   
dez 201185    5 3      252   
nov 201185    5 3      422   
out 201182    5 3      144   
set 201181    5 3      724   
ago 201176    5 3      1077   
jul 201171    4 3      351   
jun 201171    3 3      1133   
mai 201164    3 3      360   
abr 201152    2 3      120   
mar 201143    1            
fev 201132    1            
jan 201132    1            
dez 201031    1            
nov 201031    1            
out 201031    1            
set 201029    1            
ago 20106    1            
jul 20106    1            
jun 20106    1            
mai 20106    1            
abr 20105    1            
mar 20105    1            
fev 20105    1            
jan 20105    1            
dez 20093    1            
nov 20093    1            
out 20093    1            
set 20093    1            
ago 20093    1            
jul 20093    1            
jun 20093    1            
mai 20093    1            
abr 20093    1            
mar 20093    1            
fev 20093    1            
jan 20093    1            
dez 20083    1            
nov 20083    1            
out 20083    1            
set 20083    1            
ago 20083    1            
jul 20083    1            
jun 20083    1            
mai 20083    1            
abr 20083    1            
mar 20083    1            
fev 20081    1            
jan 20081    1            
dez 20071    1            
nov 20071    1            
out 2007     1            

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

out 2007: 1 2 Кьилин ччин

nov 2007: 1 2 Кьилин ччин

dez 2007: 1 2 Кьилин ччин

jan 2008: 1 1 Кьилин ччин

mar 2008: 1 2 Википедия , 2 1 Кьилин ччин

abr 2008: 1 1 Кьилин ччин

nov 2008: 1 1 Кьилин ччин

dez 2008: 1 1 Кьилин ччин

jul 2009: 1 1 Кьилин ччин

ago 2010: 1 3 Урусат , 2 3 Кьвевар , 3 3 Дагъустан , 4 2 Кьилин ччин , 5 2 Футбол

set 2010: 1 2 Кьилин ччин , 2 2 Лезги кхьинар , 3 2 Андорра

out 2010: 1 2 Шри-Ланка , 2 2 Африка

dez 2010: 1 3 Баку , 2 2 Шри-Ланка , 3 2 ЦӀийи Зеландия , 4 2 Футбол , 5 2 СтIал Сулейман , 6 2 Урусат , 7 2 Пакистан , 8 2 Лезгистан , 9 2 Лезги , 10 2 Къазакъстан

fev 2011: 1 1 Кьилин ччин

mar 2011: 1 3 Эрменистан , 2 3 Азербайжан , 3 2 Чувудар , 4 2 Париж , 5 2 Нил , 6 2 Гьайванар , 7 2 Лезгияр , 8 2 Гибралтар , 9 1 НуькI

abr 2011: 1 4 Кьилин ччин , 2 4 КцӀар , 3 3 Къазакъстан , 4 3 Ирландия , 5 2 Шри-Ланка , 6 2 Лезгистан , 7 2 Лезги чIал , 8 2 Лам

mai 2011: 1 5 ЧIехибритания , 2 5 Азия , 3 4 Лезгистан , 4 3 Советрин Социализмдин Республикайрин ГалкӀ , 5 2 Эрменистан , 6 2 Шри-Ланка , 7 2 Чувуд чӀал , 8 2 Китай чIал , 9 2 Туьрк чIал , 10 2 ТӀаратӀ , 11 2 Кьиблепатан Америка , 12 2 Къавкъаз , 13 1 Кьилин ччин

jun 2011: 1 4 Океания , 2 3 Эрменистан , 3 3 Крокодилар , 4 2 Кьилин ччин , 5 2 Юпитер , 6 2 Китайдин Халкьдин Республика , 7 2 Уганда , 8 2 Цифраяр , 9 2 Немец чIал , 10 2 Макао , 11 2 Лезгияр , 12 2 Лезгистан , 13 2 Къарагъанда , 14 2 Канада , 15 2 Кьиблепатан Америка , 16 1 НуькI

jul 2011: 1 4 Германия , 2 3 Европадин гьукуматар , 3 3 Греция , 4 2 Гьил , 5 2 Саха чӀал , 6 2 Саха Республика , 7 2 Мегьарамдхуьр , 8 2 Лезгистан , 9 2 Къазакъстан , 10 1 Кьилин ччин

ago 2011: 1 3 НуькI , 2 3 Кьилин ччин , 3 3 Чурчул , 4 3 Хуьшрекандиз ухшар маймун , 5 3 Супик чӀал , 6 3 Саваннадин фил , 7 3 Наукандин юпик чӀал , 8 3 Мирикина , 9 3 Латин чIал , 10 3 Кьвевар , 11 3 Ибериядин сувайрин чурчул , 12 3 ГъвечӀи панда , 13 3 Гну , 14 3 Арабрин Садхьанвай Эмиратар , 15 3 Атна чӀал , 16 3 Аляскадин юпик чӀал , 17 3 Алеут чӀал , 18 2 Яру бубал , 19 2 Юпик чӀалар , 20 2 Эяк чӀал , 21 2 Эскимос-алеут чӀалар , 22 2 Экуь вили антилопа , 23 2 Чувуд чӀал , 24 2 Чевакдин чупик чӀал , 25 2 Чапла Канададин инуит чӀал

set 2011: 1 4 Турциядин лезги хуьрер , 2 3 Кьилин ччин , 3 3 Шергир , 4 3 Чинеруг , 5 3 Химия , 6 3 Туьтуьнуькl , 7 3 Ортажа , 8 3 Лезги кхьинар , 9 3 Къванцин цуцӀул , 10 3 Йайлакёй , 11 3 ЦуцӀул-балугъчи , 12 3 Дагъустан , 13 3 Гьатем ага ЧӀакарви , 14 3 Гиенадал ухшар кицӀ , 15 3 География , 16 3 Ахцегь , 17 2 НуькI , 18 2 Яру жанавур , 19 2 Юсуф ал-Лезги , 20 2 МичIи куьрен кард , 21 2 Шахин , 22 2 Шангъар , 23 2 Чалагъан , 24 2 ЧIехибритания , 25 2 ЦӀехуьл Мелки

out 2011: 1 3 Кьилин ччин , 2 3 Топонимика , 3 3 Сатурн , 4 2 Чил (планета) , 5 2 Гьил , 6 2 Хашпара дин , 7 2 Футбол , 8 2 Теннис , 9 2 Урусат , 10 2 Мегьарамдхуьруьн район

nov 2011: 1 4 Рутул район , 2 4 Лезгистан , 3 3 Кьилин ччин , 4 3 Яру жанавур , 5 3 Финн чӀал , 6 3 Гъуьгъвезар , 7 3 Ахцегь , 8 3 Антилопа , 9 2 Цуругъ , 10 2 Гьил , 11 2 Хуьшрекандиз ухшар маймун , 12 2 Хуьшрекан хьтин маймун , 13 2 Усугъ вацI , 14 2 Урус чIал , 15 2 Урбис , 16 2 Туьрк чIал , 17 2 Топонимика , 18 2 Смугъулар (Ахцегь район) , 19 2 Ситатунга , 20 2 СикӀер , 21 2 Планета , 22 2 Пирал , 23 2 Осло , 24 2 Орхидея , 25 2 Муьгъверган

dez 2011: 1 3 Франция , 2 3 Къуйсун , 3 3 Имарат Къавкъаз , 4 2 Кьилин ччин , 5 2 Туьркменистан , 6 2 Суварин цӀиргъ , 7 2 Кеферпатан МуркIарин океан , 8 2 Монако , 9 2 Марсельеза , 10 2 Люксембург , 11 2 Индиядин океан , 12 1 НуькI

jan 2012: 1 4 Тай чӀал , 2 3 Мукьтадир , 3 2 Кьилин ччин , 4 2 Усугъчай , 5 2 Советрин Социализмдин Республикайрин ГалкӀ

fev 2012: 1 4 Кьилин ччин , 2 2 Мукьтадир , 3 2 Луткун , 4 2 Википедия

mar 2012: 1 13 Кьилин ччин , 2 10 Лезгияр , 3 8 Азербайжан , 4 7 Лезгистан , 5 7 Къуба , 6 7 Ингъушар , 7 7 Баку , 8 6 Урусат , 9 6 Къазакъстан , 10 6 Ахцегь район , 11 6 Ахцегь , 12 5 Эрменистан , 13 5 Европадин гьукуматар , 14 5 Советрин Социализмдин Республикайрин ГалкӀ , 15 5 ТӀаратӀ , 16 5 Лезгийрин тарих , 17 5 Кьиблепатан Америка , 18 5 Инглис чӀал , 19 5 Аминова Заира Фазилан руш , 20 5 Дагъустан , 21 5 Билиж (посёлок) , 22 5 Антарктида , 23 5 Али Султан , 24 4 Табасаранар , 25 4 Урусар

abr 2012: 1 6 Кьилин ччин , 2 6 Лезгияр , 3 5 Христофор Колумб , 4 5 Дуьньядин кьведлагьай дяве , 5 5 Польша , 6 5 Агъул район , 7 5 Рейн , 8 5 Литва , 9 5 Сауди Арабистан , 10 5 Пакистан , 11 5 Лезги чIал , 12 5 Азербайжан , 13 4 Исламабад , 14 4 Философия , 15 4 Боливия , 16 4 Пакистандин пайдах , 17 4 Гьажиев Мегьамед Мегьамедан хва , 18 4 Италия , 19 4 Лезги Википедия , 20 4 Сара Бернар , 21 4 ЦӀийи гафарин сиягь , 22 4 Грекрин алфавит , 23 4 Тегьран , 24 4 Урусар , 25 4 Кореядин Халкьдинни-Демократиядин Республика

mai 2012: 1 5 Португалия , 2 5 Мисри , 3 5 Ахцегь , 4 4 Каир , 5 4 Puzzling World , 6 4 Владимир Владимирович Путин , 7 4 Falco vespertinus , 8 4 I Наполеон Бонапарт , 9 4 Кьилин ччин , 10 4 Италия , 11 4 Дунай , 12 4 Гъед (гьайванар) , 13 3 Абдул Мажид , 14 3 Португал чIал , 15 3 Колибри , 16 3 Дуэро , 17 3 Португалиядин шегьерар , 18 3 Альберт Эйнштейн , 19 3 Кьибле-Африкадин Республика , 20 3 Улуб , 21 3 Мастурбация , 22 3 Яру улуб , 23 3 Астероид , 24 3 Динозавраяр , 25 3 Сув

jun 2012: 1 7 Мугьаммад , 2 6 Византий империя , 3 5 Исаак Ньютон , 4 5 Аллагьдин 99 тӀвар , 5 5 Алюминий , 6 5 Урусат , 7 4 Аврил Лавин , 8 4 Гелхен , 9 4 Химиядин элементрин девирдин система , 10 4 Шахматар , 11 4 Византиядин императоррин сиягь , 12 4 Республика Корея , 13 4 The Macallan , 14 4 Суван Къарабагъ , 15 4 Китайдин Халкьдин Республика , 16 4 Финн чӀал , 17 4 Ахцегь , 18 4 Айдагьо , 19 3 Брест , 20 3 Вольфганг Амадеус Моцарт , 21 3 Математика , 22 3 Бубуяр , 23 3 Сятдин чIул , 24 3 Гьукуматдин идара авунин тегьер , 25 3 Манидин конкурс Евровидение 2012

jul 2012: 1 4 Санкт-Петербург , 2 4 ЧӀехи Француз инкъилаб , 3 4 Рим империя , 4 4 Куба , 5 3 Дуьньядин чими хьун , 6 3 Эсперанто , 7 3 Волга , 8 3 Эрнесто Че Гевара , 9 3 Яд , 10 3 Автомобилдин код , 11 3 Математика , 12 3 Чил (планета) , 13 3 Сев , 14 2 Лелевар , 15 2 Постессив аватвал , 16 2 Археяр , 17 2 Биология , 18 2 Дезоксирибонуклеин цуруцӀ , 19 2 Велс , 20 2 Садхьанвай миллетрин тешкилат , 21 2 Че Гевара , 22 2 Расим Загьирбег хва Тагирбеков , 23 2 Рахазвайбурун кьадардиз килигна чӀаларин сиягь , 24 2 Автомобил код , 25 2 Почтунин индекс

ago 2012: 1 7 Лезгистан , 2 5 Олимпиядин къугъунар , 3 4 Рим , 4 3 Сочи , 5 3 Биология , 6 3 Грекрин алфавит , 7 2 Экваториал Гвинея , 8 2 Чарльз Дарвин , 9 2 Искандер Македонжув , 10 2 The Beatles , 11 2 Иосиф Виссарионович Сталин , 12 2 Сингапур , 13 2 Гуржи чIал , 14 2 Хунзах район , 15 2 2012 Гатун Олимпия къугъунар , 16 2 Велс , 17 2 Эсперанто , 18 2 Куба , 19 2 Португалия , 20 2 Тегьран , 21 2 Урус чIал , 22 2 Тувалу , 23 1 Никlи

set 2012: 1 3 Юлий Цезарь , 2 3 Иерусалим , 3 3 Таиланд , 4 3 Жозе Мария Эса ди Кейруш , 5 3 Ботлих , 6 3 Акуша , 7 3 Алпан , 8 3 Хошимин , 9 3 Кьулан вацI , 10 3 Париж , 11 2 Физика , 12 2 Дегь Мисри , 13 2 ПIатIар , 14 2 Сарфунъял , 15 2 Экология , 16 2 Вунгтау , 17 2 Нячанг , 18 2 Америка , 19 2 Кертагъ Давдакь , 20 2 С , 21 2 Слово (газет, Португалия) , 22 2 Эйсебио , 23 1 Исламабад

out 2012: 1 4 Мадрид , 2 4 Вена , 3 3 Хуьруьн майишат , 4 3 Кефердинни рагъакIидай Англия , 5 3 Ливерпульдин агломерация , 6 3 Неаполь , 7 3 Турин , 8 3 ЦIуру Худат (КцIар район) , 9 3 Хурай (КцIар район) , 10 3 Немец чIал , 11 2 Мирземугьаммадхъишлах , 12 2 Эрдэнэт , 13 2 Монгол чӀал , 14 2 Улан-Батор , 15 2 Чархы , 16 2 Жанахир , 17 2 ЧIал , 18 2 Карл Маркс , 19 2 Салвадор Дали , 20 2 Акбар ЧӀехи , 21 2 Гаф , 22 2 Slayer , 23 2 Пекин , 24 2 Къусарчай (Хъачмаз) , 25 2 Гуьнешли

nov 2012: 1 4 Компьютер , 2 4 Садвал , 3 3 Чепер , 4 3 Уран (планета) , 5 3 Каракорум (шегьер) , 6 3 Куритиба , 7 3 Гилияр , 8 3 Водород , 9 3 Грар , 10 3 Магьачкъала , 11 3 Дербент район , 12 2 Людвиг ван Бетховен , 13 2 Ӄ , 14 2 Дагъустандин ЦIаяр , 15 2 Дагъустан Республикадин шегьерар , 16 2 Ыгыл , 17 2 1930 йис , 18 2 Мичегь , 19 2 Калук , 20 2 Приморск (Дагъустан) , 21 2 Венесуэла , 22 2 КьепIир Къазмаяр , 23 2 Хуьлуьхъ , 24 2 ПIатIар , 25 2 Рим

dez 2012: 1 3 Кьулан СтIал , 2 3 Къайи дяве , 3 3 Вепс чӀал , 4 3 Пудлагьай рейх , 5 3 Велс , 6 3 Астероид , 7 3 Ле Корбюзье , 8 2 Камарван , 9 2 Пиперхуьр , 10 2 КIахцугъ , 11 2 Герейханован совхоздин 2-лагьай отделение , 12 2 Зари , 13 2 Алкьвадар , 14 2 Усур , 15 2 Хашпересрин финар , 16 2 Вьетнамдин дяве , 17 2 1930 йис , 18 2 Сарфунъял , 19 2 Усугъчай , 20 2 Туьрквер-месхетияр , 21 2 ТӀиб , 22 2 Марс , 23 2 Кьасумхуьр , 24 1 Пак тир Рим империя

jan 2013: 1 3 Индуизм , 2 3 Лезгияр , 3 2 Вашингтон (кьилин шегьер) , 4 2 Ахвах район , 5 2 Акуша район , 6 2 1812 йис , 7 2 1866 йис , 8 2 1878 йис , 9 2 1969 йис , 10 2 Вини СтIал , 11 2 , 12 2 Пак тир Рим империя , 13 2 Компьютер , 14 2 Велиханов Къудрат Кибечханан хва , 15 2 Волга , 16 2 Мугьаммад , 17 2 ЧӀулав тӀеквен , 18 2 Промышленность , 19 2 2012 йис , 20 2 Рейн , 21 2 Пси (гьарф) , 22 2 Фи , 23 2 Ипсилон , 24 2 Тау , 25 2 Хи

fev 2013: 1 2 Фридрих Ницше , 2 2 Бум , 3 2 Къарасу , 4 2 Къарадейн , 5 2 Кичик ПIирали , 6 2 Курд (Кьвепеле) , 7 2 Кветуьклуь , 8 2 Имамлы , 9 2 Зергерли , 10 2 Зараган , 11 2 Залам , 12 2 Жигъателли , 13 2 Жорлу , 14 2 Енгиже

mar 2013: 1 3 1949 йис , 2 3 1969 йис , 3 3 Турция , 4 3 Айдагьо , 5 3 Абхазия , 6 2 Дегь Греция , 7 2 Валенсия (мана) , 8 2 Илим , 9 2 АСШ-дин граждан дяве , 10 2 Гарринча , 11 2 ЧӀулав хъалхъам , 12 2 Элвис Пресли , 13 2 Байуба , 14 2 Дунчэн (Пекин) , 15 2 Садхьанвай миллетрин тешкилат , 16 2 Каир , 17 2 ЧӀулав тӀеквен , 18 2 Лекь (анатомия) , 19 2 Яру жанавур , 20 2 Февраль , 21 2 Китайдин Халкьдин Республика , 22 2 Июль , 23 2 Лас океан , 24 2 Август , 25 2 Некхъвадайбур

abr 2013: 1 5 Амстердам , 2 3 Гонконг , 3 3 Октавиан Август , 4 3 Плазма , 5 3 Ракь , 6 3 Рио-де-Жанейро , 7 3 Метр , 8 3 Буэнос-Айрес , 9 3 Иерусалим , 10 3 Дагъустан , 11 2 Умар Хайям , 12 2 Сувар (ансамбль) , 13 2 Керимова Седакъет Къайинбеган руш , 14 2 Метаболизм , 15 2 Кизилюрт , 16 2 Михаил Васильевич Лезгинцев , 17 2 Атом , 18 2 Гьуьсейнов Абдусалам Абдулкериман хва , 19 2 Барселона (мана) , 20 2 Агъдам район , 21 2 Нежефхуьр , 22 2 Ахцегьрин гьамамар , 23 2 Грар , 24 2 Юсуф ал-Лезги , 25 2 Эфиопидин чъакъал

mai 2013: 1 3 Франция , 2 2 Москва вилаят , 3 2 Альгеро , 4 2 Алпан (манаяр) , 5 2 Алпан (астрономия)

jun 2013: 1 3 Марко Поло , 2 3 Демократия , 3 3 Фу , 4 2 Мидгьед Ширинбегов , 5 2 Иисусан гьакъикъи клиса , 6 2 Александр Ильич Рыбников , 7 2 Кьавал , 8 2 Агъул чIал , 9 2 Хвереж (Кьурагь район) , 10 2 Усугъ , 11 2 Вулкан (геология) , 12 2 Абилов Магьмуд Абдулрзадин хва , 13 2 Митаги хуьруьнсовет , 14 2 Хазар хуьруьнсовет , 15 1 Кьилерин хуьруьнсовет

jul 2013: 1 2 Хъачмаз район , 2 1 Зигмунд Фрейд

ago 2013: 1 3 Католицизм , 2 3 Чингисхан , 3 3 Винстон Черчилль , 4 2 Урусатдин тӀаратӀ , 5 2 Табасаран чIал , 6 2 Дагъустандин тIаратI , 7 2 Гоа (Дагъустан) , 8 2 Мыгра (Дагъустан) , 9 2 Кина (Дагъустан) , 10 2 Британиядин империя , 11 2 Вини Катрух , 12 2 Автомобиль , 13 2 Марко Поло , 14 2 Агъул чIал , 15 2 ЧIал , 16 2 Вини ЦIийихуьр , 17 2 Христофор Колумб , 18 2 ТӀаратӀ , 19 2 Лезги чIал , 20 2 Кьвевар , 21 1 Будугъ чIал

set 2013: 1 3 Авраам Линкольн , 2 3 КъирицI чIал , 3 2 Чилин зурзунар , 4 2 Хинелугъ чIал , 5 2 Нидерландар , 6 2 Китайдин Халкьдин Республика , 7 2 Саха Республика , 8 1 ЦIуру Киркар

out 2013: 1 3 Лезгияр , 2 2 Холокост , 3 2 Хамаматюрт , 4 2 Адиль-Янгиюрт , 5 2 Бабаюрт , 6 2 Чилин зурзунар , 7 2 Табасаранар , 8 1 ЧӀутрацуьк

nov 2013: 1 3 Аристотель , 2 3 Бактерияр , 3 2 Ингушетия , 4 2 UTC+4 , 5 2 Терек вацI , 6 2 Хуьр , 7 2 Шегьер , 8 2 АхцегьвацӀ , 9 2 Мустафа Камал Ататуьрк , 10 1 Муниципал район

dez 2013: 1 3 КуртӀухъан , 2 3 Атлантик океан , 3 3 Харахуба , 4 2 Пепеяр , 5 2 ЦIай (азар) , 6 1 Тарих

jan 2014: 1 3 Мирослава Вавринец , 2 3 Роджер Федерер , 3 3 Валентина Васильевна Толкунова , 4 3 Кьвепеле , 5 2 Затор , 6 2 Бойнице , 7 2 Куколивка

fev 2014: 1 3 Шахматар , 2 2 Сан-Паулу , 3 2 Гуржистан , 4 2 Абхазия , 5 1 Славян чIалар

mar 2014: 1 3 Поляк чIал , 2 3 Словак чIал , 3 3 Чех чIал , 4 2 Кашуб чIал , 5 1 НАТО

abr 2014: 1 3 Алискерово (посёлок) , 2 2 Тито Виланова , 3 2 Баламирзоев Абдул Гьажибаладин хва , 4 2 Поречье хуьруьнсовет (Тула вилаят) , 5 2 Дубна (Тула вилаят) , 6 2 Фотосинтез , 7 1 Синусоида

mai 2014: 1 3 Грек чӀал , 2 3 Сидней , 3 3 Вичи-вич кьин , 4 3 Сеул , 5 3 Салигьов Эсед Бабастанан хва , 6 3 Верем , 7 2 Metallica , 8 2 Пурни , 9 2 Мумбаи , 10 2 ТӀач , 11 2 Бебелук , 12 2 2014 ХъуьтӀуьн Олимпия къугъунар , 13 2 ЧӀулавкьал , 14 2 ЦӀегьрекарч , 15 2 Словак чIал , 16 1 Лезги литература

jun 2014: 1 2 Фернан Магеллан , 2 2 Цур , 3 2 Геология , 4 2 Етим Эмин , 5 2 Храхуба , 6 2 Гуржи чIал , 7 2 Далдам , 8 1 Инд океан

jul 2014: 1 2 Джяравица , 2 2 Европадин таж , 3 2 Квеста , 4 2 Париж бассейн , 5 1 Ботсвана

ago 2014: 1 3 Робин Вилиамс , 2 2 Джульярд мектеб , 3 2 ЦIуьлуьк , 4 2 Хъутур-Куьредин наибвал , 5 1 Аль-Муайдар

set 2014: 1 3 Ио , 2 2 Вилиам Хьайд Волластон , 3 2 Владимир Владимирович Путин , 4 2 Юрий Алексеевич Гагарин , 5 1 Черногориядин шегьерар

out 2014: 1 2 Чай , 2 2 Балтик гьуьлуьн пешекарвилин галкIрин чил , 3 2 Латвия , 4 2 Эстония , 5 2 Братислава , 6 2 Прагьа , 7 1 Кения

nov 2014: 1 2 Анархизм , 2 2 Аргентина , 3 2 Нью-Йорк , 4 1 Амадора

dez 2014: 1 2 Дакка , 2 2 Палестина , 3 1 Къеди

jan 2015: 1 2 Сокольническая цӀар , 2 2 ТупӀалдин цӀар (Москва) , 3 1 Эседуллагь Эмирагъайрин

fev 2015: 1 2 Абдусамад Гьамидов , 2 2 Гьарйяна , 3 2 Никола Тесла , 4 2 Халилов Юсиф Мевлуьдан хва , 5 2 Экономика , 6 2 Чингисхан , 7 1 Кьилин мефтӀ

mar 2015: 1 3 Пудлагьай рейх , 2 2 Украинадин вилаятар: абурун ибарат , 3 2 Украинадин административ паюн , 4 2 I Фарнаваз , 5 2 Асалийрин Асали Мугьаммадалидин хва , 6 2 Братислава , 7 2 ЧIулав гьуьл , 8 2 Украина , 9 2 Уругвай , 10 2 Пакистан , 11 2 Немец чIал , 12 1 Фарнаваз I

abr 2015: 1 3 Грац , 2 3 Лас океан , 3 2 Линц , 4 2 Альфредо Ди Стефано , 5 2 Орёл вилаят , 6 2 Орёл (шегьер) , 7 2 Республика Крым , 8 2 Амстердам , 9 2 Мадрид , 10 2 Лионель Месси , 11 2 Испания , 12 2 Урусат , 13 2 Каспи гьуьл

mai 2015: 1 3 Ингилис Премьер-лига , 2 2 Бути (Чечня) , 3 2 Сократес , 4 2 Церхимахи , 5 2 Линц , 6 2 Кочубей (Дагъустан) , 7 2 Танк , 8 2 Нилтон Сантос , 9 2 Испания , 10 2 Науру , 11 2 Кьасумхуьр , 12 2 Истамбул , 13 2 Инглис чӀал , 14 2 Америкадин Садхьанвай Штатар , 15 1 Македония Республикадин шегьерар

jun 2015: 1 2 Инсбрук , 2 2 Ямал-Ненец АО-дин шегьерар , 3 2 Валерий Яковлевич Леонтьев , 4 2 Ханты-Манси АО-дин шегьерар , 5 2 Карелия Республикадин шегьерар , 6 2 Урусатдин шегьеррин сиягь , 7 2 Икрам Сабиран хва Алискеррин , 8 1 СССГ-дин илимрин академия

jul 2015: 1 3 Инсбрук , 2 3 Германиядин империя , 3 2 Александр Сергеевич Пушкин , 4 2 Стивен Джеррард , 5 2 Гьаштархан вилаятдин шегьерар , 6 2 Исаев Радик Велединан хва , 7 2 Камчатка крайдин шегьерар , 8 2 Грац , 9 2 Воскресенское (Дубна район) , 10 1 Абдул Мукьтедир Айдинбекан хва

ago 2015: 1 3 Дубна (Тула вилаят) , 2 2 Къарачай-Черкесия Республикадин шегьерар , 3 2 Лезгияр , 4 2 Ислам , 5 2 Амазун , 6 1 СпекI

set 2015: 1 3 Хъачмаз район , 2 3 Лезгияр , 3 2 Таджикистан , 4 2 Молдова , 5 2 Нигерия , 6 2 Мисри , 7 2 Уганда , 8 2 Багьрейн , 9 1 Ассаб

out 2015: 1 4 Азербайжан , 2 2 Иан Раш , 3 2 Азербайжандин гимн , 4 2 Азербайжандин тIаратI , 5 2 Гимры , 6 2 Сербия , 7 2 Гьажи Дауд , 8 1 Грем Сунесс

nov 2015: 1 2 Deep Purple , 2 2 Кьил чIулав питунар , 3 2 Мугьаммад ЧIехибубадин хва Куругълийрин , 4 2 Кулур , 5 2 Дакка , 6 2 Мучугъ , 7 2 Суварин цӀиргъ

dez 2015: 1 2 Гьамидуллагьрин Роман Играмеддинан хва

jan 2016: 1 3 Бильгади , 2 2 Кариб гьуьл , 3 2 Мекка , 4 2 Урусатдин шегьерар , 5 2 Вишйисан дяве , 6 1 Якут чIал

fev 2016: 1 3 Байкал , 2 2 Гьольштайн , 3 2 Кефердинни-рагъакIидай патан федерал округ , 4 1 Лев Николаевич Толстой

mar 2016: 1 4 Йугьан Круифф , 2 2 Астрахань , 3 2 Магадан , 4 1 Сирхияр

abr 2016: 1 2 Яргун , 2 2 Табасаранар , 3 1 Мугьажир

mai 2016: 1 2 Гьамзатов Расул Гьамзатан хва , 2 2 Адиль-Янгиюрт , 3 2 Ашар , 4 1 Ергуьжар

jun 2016: 1 3 Ниж , 2 2 Хучни , 3 2 Имам Шамил , 4 2 Яргъал-РагъэкъечӀдай патан федерал округ , 5 2 Урусатдин шегьеррин сиягь , 6 1 Вачи

jul 2016: 1 2 Эмирали ТIигьиржалви , 2 2 Эквадор , 3 2 Сунияр , 4 2 Убыхар , 5 2 Александр Сергеевич Пушкин , 6 2 Къайтагъ район , 7 1 Мирза Али

ago 2016: 1 2 Хинелугъ чIал , 2 1 Эликар

set 2016: 1 3 Азербайжанар , 2 3 Хъачмаз , 3 3 Эрменистан , 4 2 Лезги кьуьл , 5 2 Галисий чӀал , 6 2 Республика Коми , 7 2 Агата Кристи , 8 2 Новосибирск , 9 2 Шекердин диабет , 10 2 Словакиядин шегьерар

out 2016: 1 4 Кишинёв , 2 4 Ингилисар , 3 4 Октябрдин революция , 4 4 Уфа , 5 3 Африкаанс чӀал , 6 3 Кипрдин туьрквер , 7 3 Банска-Бистрица край , 8 3 Бардеёв , 9 3 Фёдор Михайлович Достоевский , 10 3 Агьмедрин Фарид Загьидинан хва , 11 2 II-й Мануэл , 12 2 1941 йис , 13 2 Керимрин Керим Абдулхаликьан хва , 14 2 Усманрин Империя , 15 2 Гьарф , 16 1 Мануэл II

nov 2016: 1 3 Калмыкия , 2 3 16 ноябрь , 3 2 Ставропольдин край , 4 2 19 ноябрь , 5 2 Кеферпатан Къавкъаздин федерал округ , 6 2 17 ноябрь , 7 2 Екатеринбург , 8 2 Эмиррин Валентин Аллагьяран хва , 9 1 ЧIехи Къавкъаз

dez 2016: 1 2 Дербентдин эмират , 2 2 Гьакимов Къурбан Халикан хва , 3 2 Къардашев Арбен Мегьединан хва , 4 2 Къафланов Зульфикъар Шихнесиран хва , 5 2 Эфендиева Муъминат , 6 2 Гьажимурадов Жамидин Гьажимурадан хва , 7 2 Абдурагьман Абдурагьманов , 8 2 Этанол , 9 2 Экуьнин зарбвал , 10 2 Ал-Хорезми , 11 2 Рухун Али , 12 2 Къуруш , 13 2 Фейзудин Нагъиев , 14 2 Миграгъ Мардали , 15 2 Миграгъ Къемер , 16 1 Намибия

jan 2017: 1 2 Сердар Амин , 2 2 Авар ханвал , 3 2 Анжи , 4 2 Аваран , 5 2 Дагъустан , 6 1 Эрменияр

fev 2017: 1 2 Роберто Баджо , 2 2 Румыния , 3 2 Вести Агула , 4 2 Ватандин чIехи дяве , 5 2 Полякар , 6 2 Украинар , 7 2 Магнитдин чуьл , 8 2 Украинадин вилаятар: абурун ибарат , 9 2 Керимов Сулейман Абусаидан хва , 10 2 Норвегия , 11 2 Миграгъ Къемер , 12 1 Фикрет Хидиров

mar 2017: 1 3 Валентина Владимировна Терешкова , 2 3 Дмитрий Иванович Менделеев , 3 2 Гьайратар , 4 2 Антон Павлович Чехов , 5 2 Ровно , 6 2 Агъа-Къартас Амираслан , 7 2 Муьгьуьддин Садикьан хва , 8 2 Мегьамед-Гъалиб эфенди , 9 2 Штулви Гьажи Мегьамед-эфенди , 10 2 Шейх Гьажи Рамазан , 11 2 Эрзихан , 12 2 Абдул Гьамид-эфенди , 13 2 Алкьвадар Абдуллагь эфенди , 14 2 Мирзе Жабраил , 15 2 ТIигьиржал Гьажи Амирали , 16 2 Ашукь Уьзден , 17 2 Шейх Жамалуддин , 18 2 Атлухан эфенди , 19 2 Шагьпазов Сейфудин Тегьмезбеган хва , 20 2 Рагьимова Асия , 21 2 Ибрагьимов Саид , 22 2 6 март , 23 2 Татар , 24 2 Лезги Агьмед , 25 2 Етим Эмин

abr 2017: 1 2 Шипраге , 2 2 Видади Севзиханов , 3 2 Футболдай Германиядин чемпионатдин квайни-квайни бомбардиррин сиягь , 4 2 КцIар (газет)

mai 2017: 1 3 I Павел , 2 2 Дания , 3 2 Сенжефил , 4 2 Иферар , 5 2 Андуз (набатат) , 6 2 Алуча , 7 1 Смугъулар

jun 2017: 1 2 Янцзы , 2 2 Навальный Алексей Анатольевич

jul 2017: 1 2 Башкирар , 2 2 Рамзан Ахматович Кадыров , 3 1 1650 йис

ago 2017: 1 2 Грем Сунесс , 2 1 Агата Кристи

set 2017: 1 2 Мюнхен , 2 2 Папуа — ЦӀийи Гвинеядин шегьерар , 3 2 Сан-Марино , 4 2 Дания , 5 1 ЕврогалкІ

out 2017: 1 2 Фиджидин инсанар яшамиш жезвай чкаяр , 2 2 Монгол империя , 3 2 Пруссия , 4 1 Уругвайдин административ паюн

nov 2017: 1 2 Дубай (шегьер) , 2 2 Намибиядин административ ччара авунар , 3 2 Урусатдинни-Азербайжандин сергьят , 4 1 Россиядинни-Азербайжандин сергьят

dez 2017: 1 3 Сахара , 2 2 Хуанхэ

jan 2018: 1 3 Пакистан , 2 2 Сербиядин шегьерар , 3 2 Хъачмаз район , 4 2 Дагъустандин ЦIаяр , 5 2 Кьвевар , 6 2 КцӀар , 7 2 Баку , 8 1 2018 йисуз космосдиз ахъаюнрин сиягь

fev 2018: 1 2 Биатлон 2018 йисан хъуьтӀуьн Олимпиядин къугъунрал — спринт (итимар) , 2 2 Европадин ГалкIдин уьлквейрин сиягь , 3 2 Етим Эмин , 4 1 Хоккей хъуьтIуьн 2018 йисан Олимпиядин къугъунрал (итимар)

mar 2018: 1 2 Мексикадин шегьерар

Wikipedias are initially ordered by number of speakers of the language

Speakers: Number of speakers of a language is the estimated total of primary and secondary speakers, is in many cases a very rough estimation (based on the page on the English Wikipedia about that language)
Regions are parts of the world where the language is spoken in substantial amounts (compared to total number of speakers). Regions where a language gained presence only by a recent diaspora are generally not included.
Region codes: AF:Africa, AS:Asia, EU:Europe, NA:North America, OC:Oceania, SA:South America, W:World Wide, CL:Constructed Language

Estatísticas geradas em Terça-feira, 17 de abril 2018 21:36

Dump file lezwiki-20180401-stub-meta-history.xml.gz (edits only), size 4.7 Mb as gz -> 33 Mb
Dump processed till Mar 31, 2018, on server stat1005, ready at Sat-07/04/2018-16:53 after 18 sec.

Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.