Estatísticas da Wikipédia lezgian

Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Articles per size range / Records per namespace / Most edited articles / Zeitgeist
  May 2016: The major overhaul of Wikistats reports has entered a new phase.  

  First phase focused on migrating the traffic analysis reports to our new infrastructure. Those are operational now.  
  The Analytics Team will now proceed to also migrate data collection and reporting about wiki content and contributors.  
  First results are expected later this year.  

  More info at this announcement
  You can still tell us which reports you want to see preserved, in this survey.


Most metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.

Some metrics have been collected from the full archive dump which runs on lower frequency than the usual monthly cycle.
These metrics are columns F,I,J,K,M,N,O,P,Q,R from the first table.

See also metrics definitions

Monthly counts & Quarterly rankings: agosto 2016
DataWikipedistasArtigosBase de dadosLigações
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
ago 20160%   0%      -37%      0%
jul 20160%   0%      +81%      +1%
jun 20160%   0%      -14%      0%
mai 20160%   0%      +174%      0%
abr 20160%   0%      -64%      0%
mar 20160%   0%      -2%      +1%
ago 201661 112,8 k  14,6   193      629
jul 201661 312,8 k  14,5   308      628
jun 201661 112,8 k  14,5   170      619
mai 201661 112,7 k  14,5   197      619
abr 201661 1 2,7 k  14,4   72      617
mar 201661 412,7 k  14,4   198      617
fev 201661 412,7 k  14,4   203      612
jan 20166116 2,7 k  14,4   242      612
dez 201560 2 2,7 k  14,3   48      611
nov 201560 3 2,7 k  14,3   118      610
out 2015601512,7 k 114,3   246      607
set 201559 212,7 k 214,3   284      605
ago 201559 412,6 k  14,5   246      602
jul 201559 412,6 k 214,5   594      599
jun 201559 412,5 k 314,7   434      586
mai 201559 312,4 k 815,1   1,3 k      578
abr 2015591412,2 k 216,1   554      575
mar 2015581512,1 k  16,3   553      561
fev 201557 4 2,1 k 116,1   141      553
jan 201557 3 2,1 k 116,2   90      547
dez 201457 3 2,1 k  16,3   46      545
nov 201457 2 2,1 k  16,2   65      543
out 20145713 2,1 k  16,3   110      542
set 20145613 2,1 k 116,3   70      539
ago 201455 412,1 k 216,4   287      537
jul 201455 212,0 k 116,7   177      530
jun 20145526 2,0 k 116,8   230      527
mai 20145316 2,0 k 116,9   279      519
abr 201452 4 1,9 k  17   159      497
mar 201452 4 1,9 k  17   137      490
fev 201452 2 1,9 k1,7 k 17233180%38%858,5 Mb587 k36 k2402,3 k5,4 k484
jan 2014522611,9 k1,7 k 17233379%38%3548,5 Mb584 k36 k2402,2 k5,4 k481
dez 201350 3 1,9 k1,7 k 16,9233080%38%1448,5 Mb581 k35 k2402,2 k5,4 k478
nov 201350 4 1,9 k1,7 k116,9232879%38%1728,4 Mb578 k35 k2402,2 k5,4 k477
out 2013501311,9 k1,7 k317233279%38%5288,4 Mb574 k35 k2432,2 k5,3 k471
set 201349 311,8 k1,6 k217,5226578%36%5707,7 Mb533 k32 k3552,2 k4,9 k468
ago 201349 211,7 k1,6 k517,7218577%34%9037,3 Mb500 k31 k3552,2 k4,6 k463
jul 201349 2 1,6 k1,4 k118,8207075%29%1576,3 Mb433 k27 k5312,1 k3,9 k428
jun 201349 311,6 k1,4 k218,9205775%29%6356,1 Mb426 k26 k5342,1 k3,9 k426
mai 201349 211,5 k1,3 k219,4199274%27%4115,7 Mb395 k24 k4862,1 k3,5 k414
abr 201349 521,4 k1,2 k120194273%25%6655,3 Mb370 k23 k4892,1 k3,2 k413
mar 2013491511,4 k1,2 k 20,1187171%24%2,1 k4,9 Mb346 k22 k1,1 k2,1 k3,0 k398
fev 201348 321,4 k1,2 k318,8183472%23%1,3 k6,5 Mb337 k21 k67 k2,1 k2,9 k390
jan 201348 421,3 k1,1 k218,9182571%23%1,6 k6,2 Mb318 k21 k66 k2,1 k2,8 k384
dez 201248 511,2 k1,1 k218,5180972%22%1,2 k5,9 Mb301 k20 k64 k2,1 k2,6 k373
nov 2012481711,2 k1,0 k418,6174870%19%1,1 k5,5 Mb276 k18 k63 k2,1 k2,4 k362
out 2012472521,1 k946619,4175768%18%1,2 k5,1 Mb254 k17 k61 k1,9 k2,2 k354
set 201245 51868746122,5185161%21%1,3 k4,5 Mb220 k15 k58 k1,5 k1,9 k338
ago 201245162838711121,7178860%20%9714,3 Mb204 k15 k56 k1,5 k1,7 k333
jul 2012441123817689121,1167359%19%1,3 k3,9 Mb186 k13 k54 k1,2 k1,6 k313
jun 2012431133778637220,4145454%17%1,7 k3,4 Mb154 k11 k50 k1,1 k1,4 k290
mai 201242193719564219,7123750%15%2,2 k2,9 Mb121 k8,2 k47 k1,0 k1,1 k247
abr 201241317566650031898444%12%3,1 k2,4 Mb89 k6,2 k42 k790727184
mar 2012388206562393115,881139%9%2,4 k1,8 Mb61 k3,4 k34 k70834890
fev 201230141534388 12,180040%8%7051,6 Mb59 k3,2 k28 k68830785
jan 201229121530386 10,978040%8%2331,4 Mb57 k3,3 k23 k68730681
dez 201128 41526383110,577240%8%2911,4 Mb56 k3,2 k23 k68430481
nov 201128371504370110,478941%8%4341,3 Mb55 k3,1 k21 k66430374
out 201125 4 485348 9,978441%8%3491,3 Mb52 k2,8 k21 k65029757
set 201125410248034549,378741%8%7641,1 Mb52 k2,8 k14 k64931355
ago 201121610237426959,987643%10%1,1 k954 kb45 k2,4 k12 k53331138
jul 201115181219166111,973245%8%361537 kb23 k8298,7 k35918712
jun 201114 51178131212,680452%10%1,2 k487 kb21 k6528,0 k28016411
mai 2011143811115719,860327%12%436322 kb9,9 k2967,3 k106298
abr 20111125 784018,451126%12%157210 kb5,8 k1484,9 k8816
mar 2011923 603418,260230%15%141201 kb5,3 k1284,9 k7516
fev 20117   4031 8,883642%22%3169 kb4,9 k1223,7 k56 6
jan 20117   3931 983644%23%3167 kb4,9 k1223,7 k56 6
dez 2010712 3931 8,983644%23%74167 kb4,9 k1223,7 k56 6
nov 20106   3923 7131138%23% 130 kb7,8 k1219195922
out 2010612 3923 7131138%23%36130 kb7,8 k1219195922
set 2010511 362216,6145742%19%113128 kb7,6 k1219186322
ago 2010422 1818 6,9103167%28%5766 kb2,9 k12089457 1
jul 20102   55 13,685760%40%415 kb956151334 1
jun 20102   55 12,885760%40% 15 kb956151334 1
mai 20102   55 12,885760%40%315 kb956151334 1
abr 20102   55 12,285760%40% 15 kb956151334 1
mar 20102   55 12,285760%40% 15 kb956151334 1
fev 20102   55 12,285760%40% 15 kb956151334 1
jan 20102   55 12,285760%40%315 kb956151334 1
dez 20092   55 11,685760%40% 15 kb956151294 1
nov 20092   55 11,685760%40% 15 kb956151294 1
out 20092   55 11,685760%40% 15 kb956151294 1
set 20092   55 11,685760%40% 15 kb956151294 1
ago 20092   55 11,685760%40% 15 kb956151294 1
jul 20092   55 11,685760%40%115 kb956151294 1
jun 20092   55 11,485760%40% 14 kb95615184 1
mai 20092   55 11,485760%40% 14 kb95615184 1
abr 20092   55 11,485760%40% 14 kb95615184 1
mar 20092   55 11,485760%40% 14 kb95615184 1
fev 20092   55 11,485760%40% 14 kb95615184 1
jan 20092   55 11,485760%40% 14 kb95615184 1
dez 20082 1 55 11,485760%40%914 kb95615184 1
nov 20082   55 9,682660%40%112 kb9261183 1
out 20082   55 9,482560%40% 12 kb9231183 1
set 20082   55 9,482560%40% 12 kb9231183 1
ago 20082   55 9,482560%40% 12 kb9231183 1
jul 20082   55 9,482560%40% 12 kb9231183 1
jun 20082   55 9,482560%40% 12 kb9231183 1
mai 20082   55 9,482560%40%612 kb9231183 1
abr 20082   55 8,282560%40%412 kb9231183 1
mar 20082   55 7,481360%40%712 kb9071183 1
fev 20082   34 101615100%100% 19 kb1,3 k6921111
jan 20082   34 101615100%100%519 kb1,3 k6921111
dez 2007211 32 8,3145467%67%1718 kb7626629 1
nov 20071   11 82920100%100%65,9 kb3476328  
out 200711  1  242  2104 6     
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternas

> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
The following table ranks this project in relation to projects in other languages with 1000+ articles
jul 2016172 154138201  173   134      256
abr 2016169 199 200  178   174      256
jan 2016168149122 199  178   149      256
out 2015167137125142196 151178   149      256
jul 2015167 136129195 115182   116      256
abr 2015166163140148198 127170   127      256
jan 2015168 153 196 159167   179      256
out 2014163139151 196  168   161      256
jul 2014166 170135197 149165   154      256
abr 2014169 137 198  162   162      256
jan 2014166116120142195181159165507029142146160157207139133256
out 2013165148158127195181104168476828109147158157214138133256
jul 2013163142173135204186155155607852158155173171187137139256
abr 2013163147128107206186156148698361140162176176197137144256
jan 2013158149137103206185120155728770154183180174203140143256
out 201215810912210321119085148789891173190185178205140151256
jul 20121631348892215201150212211211209166199191181207153159256
abr 2012163887776219206107210209209206110210211207213165184256
jan 2012186147171134222213151209208208205230224225223228174205256
out 2011193153142145223213162208207207204225221223227227173204256
jul 201122614599136234228158205204204201222236231235239192212256
abr 201123497129133251243155203202202199231247247250246232252256
jan 2011251156225137253246159201200200197255250248250249243252256
out 2010250145169129253248154193192192190249249243250252236252256
jul 2010255161221140255252157188187187185255252252252252251252256
abr 2010255151212135255252157185184184183255252252252252250252256
jan 2010255145206130255253154183183183182250253253253253251253256
out 2009255146212135255253162180180180179252253253253253250253256
jul 2009253193206132254251152173173173172248251251252252251251256
abr 2009253140205144253251147170170170169251251251252252249249256
jan 2009252134210131252250149165165165164254251251251251249250256
out 2008250138202129250246146159159159158251248248248249247248254
jul 2008248153205133247243150153153153151248245245245247243247253
abr 2008246149209128246243152148148147145246244243245247242245253
jan 2008243152210134245240155143143142141239241238233242230239249
out 2007244135202133247242150141141139139240245243243240237237248
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
 WikipedistasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikipedistas (usuários registrados)
A = Wikipedistas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikipedistas que editaram pelo menos dez vezes desde que chegaram
C = Wikipedistas que contribuíram cinco vezes ou mais este mês
D = Wikipedistas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Artigos que contêm pelo menos uma ligação interna e 200 caracteres de texto legível, não contando códigos wiki e html,
      ligações ocultas, etc.; títulos também não contam (outras colunas são baseadas no método oficial de contagem)
G = Novos artigos por dia no mês passado
H = Número médio de revisões por artigo
I = Tamanho médio dos artigos em bytes
J = Porcentagem de artigos com pelo menos 0,5 kb de texto legível (veja F)
K = Porcentagem de artigos com pelo menos 2 kb de texto legível (veja F)

Base de dados
L = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
M = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
N = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

O = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
P = Total de ligações para outras wikipédias
Q = Total de imagens apresentadas
R = Total de ligações para outros sítios
S = Total de páginas de redirecionamento

Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  5  10  100  1000  1  3  5  10  25  100  5  10  1  3  5  10  25  100  250  5  10  100 
ago 2016821111      31      421       
jul 2016733221      2       4211   11 
jun 20161321111      1       52     11 
mai 2016721111      2       411    11 
abr 201671111      5       9211   11 
mar 20161144111  1   1       411    11 
fev 2016964311      311     811    22 
jan 2016137653      411     72111  22 
dez 20158321   1   211     6311   22 
nov 201553331      4       81     22 
out 20151275311      1       9111   32 
set 2015432211  1   721     73221  32 
ago 2015844411      41      84422  33 
jul 201510443311     211     54421  22 
jun 201511542211     21      75431  22 
mai 2015133332111    5331    733322 22 
abr 201511544311     5221  22533221 22 
mar 201512653211 11  311   115211   32 
fev 2015115431      31      7311   22 
jan 201584332      831     5211   22 
dez 20148331       5       611    22 
nov 201452221  11  21      62211  22 
out 2014114322      2       82111  22 
set 201493331      711     6111   22 
ago 2014844421  11  41      94433  22 
jul 2014922211      1       43221  22 
jun 201496652  11  32      4211   22 
mai 2014176663      3221    94322  22 
abr 2014115432  1   221     72221  21 
mar 2014134441  11  421     5111   22 
fev 201415222       321     7111   22 
jan 20141286431  11  321     5211   32 
jul 2016733221      2       4211   11 
abr 201671111      5       9211   11 
jan 2016137653      411     72111  22 
out 20151275311      1       9111   32 
jul 201510443311     211     54421  22 
abr 201511544311     5221  22533221 22 
jan 201584332      831     5211   22 
out 2014114322      2       82111  22 
jul 2014922211      1       43221  22 
abr 2014115432  1   221     72221  21 
jan 20141286431  11  321     5211   32 
out 20139432111 21  62      632211111 
jul 201342222      31      92221  33 
abr 201313555321 33  4443    1133322 541
jan 201315543221 1363 6322    933321 961
out 201211655321 862 74321   1254321 851
jul 2012181212853  872 1711842   2314131031 771
abr 201232211710754 971 341914853  552212774143 
jan 2012742221      1       1         
out 201185441  111         11111  11 
jul 201110884111     322     421111    
abr 201165551      1       1         
jan 2011                            
out 20103221               2111      
jul 2010                            
abr 2010                  2         
jan 2010                            
out 2009                            
jul 20091                           
abr 2009                            
jan 2009                  1         
out 2008                            
jul 2008                  2         
abr 200811                          
jan 200811                          
out 20072                           


Distribuição de edições de artigos por wikipedistas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...

Edições >=WikipedistasEdições total


8 wikipedistas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias

 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
30 dias
30 dias
30 dias
30 dias
Aslan4ikUC1 011,4021672,8927jan 21, 201216831,5174--
Soul TrainUC2 04,77246,1972mar 28, 20121616114---
FlorsteinUC146+11721--dez 07, 2014632----
AcerUC162...22--ago 13, 201617----
DARIO SEVERIUC163...22--ago 19, 201611----
TurnlessUC312...1121ago 16, 201614----
FelicilijonasUC313...11--ago 16, 201614----
HosseiniranUC314...11--ago 27, 20163----


20 wikipedistas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

  Primeira ediçãoúltima edição
Namik555UC32,769mar 07, 20112003abr 21, 20121592
MigraghviUC41,576ago 31, 20111826jan 26, 2016217
LezgistxaUC51,497set 20, 20111806jun 01, 20121551
MugerganetsUC61,151out 13, 20121417jul 22, 201639
User from DagUC7718ago 17, 20102205jun 13, 201678
SPQRobinUC8627mar 27, 20121617mar 27, 20121617
Tamara UstinovaUC9586nov 14, 20111751dez 04, 20131000
KmoksyUC10512ago 11, 20111846fev 12, 2015565
MaxBioHazardUC11387mar 11, 2015538mar 11, 2015538
Saint JohannUC12385mar 28, 20121616out 15, 20121415
Cekli829UC13190mar 10, 20112000abr 24, 2016128
MaqiviUC14153out 07, 20111789set 03, 20131092
U.SteeleUC15125ago 02, 20111855mar 31, 20121613
LezgiUC16116abr 27, 20111952jun 02, 20121550
МаликумUC17107fev 07, 20121666jun 30, 201661
HydrizUC18103jan 30, 2014943jan 30, 2014943
NessajaUC1990abr 25, 20121588out 05, 2014695
91i79UC2055mar 27, 20121617out 12, 2014688
Master ShadowUC2153out 12, 20102149dez 14, 20102086
FsFUC2248jul 26, 20121496jul 29, 20121493


Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 1.750 edições foram feitas por usuários anônimos, de um total de 40.384 edições ( 4e %)

43 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
MerlIwBotUC12,602mai 27, 20111922ago 09, 20131117--
EmausBotUC21,643abr 16, 20121597nov 09, 20131025--
AddbotUC31,465mar 07, 20131272ago 16, 20131110--
XqbotUC41,061abr 16, 20121597mar 06, 20131273--
JackieBotUC5908abr 26, 20121587dez 01, 2014638--
AvocatoBotUC6443mar 29, 20121615jul 07, 20121515--
GerakibotUC7325mai 24, 20121559mar 06, 20131273--
RedBotUC8170abr 22, 20121591ago 21, 20121470--
Makecat-botUC9149nov 01, 20121398mar 03, 20131276--
LegobotUC10106mar 11, 20131268abr 02, 20131246--
Idioma-botUC1196mar 27, 20121617mar 04, 20131275--
Justincheng12345-botUC1289jun 25, 20121527jan 10, 20131328--
MBHbotUC1367mar 11, 2015538mar 11, 2015538--
YFdyh-botUC1463jul 01, 20121521fev 18, 20131289--
CommonsDelinkerUC1560abr 26, 20111953ago 26, 20164--
LaaknorBotUC1660mai 22, 20121561mar 05, 20131274--
JhsBotUC1755mar 28, 20121616jul 08, 20121514--
EscarbotUC1847abr 03, 20121610out 16, 20121414--
VolkovBotUC1947abr 28, 20121585fev 27, 20131280--
KamikazeBotUC2045mar 29, 20121615jan 24, 20131314--
JAnDbotUC2141mar 29, 20121615jul 02, 20131155--
AvicBotUC2240jun 01, 20121551dez 09, 20121360--
CarsracBotUC2335mar 31, 20121613fev 12, 20131295--
HiW-BotUC2429abr 07, 20121606out 18, 20121412--
VagobotUC2522mar 29, 20121615abr 30, 20121583--
SantoshBotUC2622out 21, 20121409jan 31, 20131307--
SynthebotUC2721set 20, 20121440jan 25, 20131313--
PixelBotUC2813jul 20, 20121502mar 06, 20131273--
タチコマ robotUC2913out 20, 20121410out 21, 20121409--
JotterbotUC3012jan 15, 20131323jan 18, 20131320--
Crochet.david.botUC316mai 07, 20083037mai 07, 20083037--
RobbotUC326mai 07, 20121576jan 02, 20131336--
CocuBotUC335ago 26, 20121465dez 15, 20121354--
OctraBotUC345mai 12, 2014841jan 30, 2015578--
NjardarBotUC354ago 28, 20121463ago 31, 20121460--
YiFeiBotUC363ago 05, 2015391ago 05, 2015391--
SassoBotUC372mai 29, 20121554jan 07, 20131331--
ObersachsebotUC382nov 24, 20121375jan 08, 20131330--
DragonBotUC392jan 13, 20131325jan 14, 20131324--
MalarzBOTUC401ago 18, 20121473ago 18, 20121473--
GhalyBotUC411jan 18, 20131320jan 18, 20131320--
SAMI.BotUC421fev 05, 20131302fev 05, 20131302--
MastiBotUC431mar 01, 20131278mar 01, 20131278--


Artigos que contêm pelo menos uma ligação interna e .. caracteres de texto legível, não contando códigos wiki e html,
ligações ocultas, etc.; títulos também não contam  (excluindo páginas de redirecionamento)

 < 32 ch< 64 ch< 128 ch< 256 ch< 512 ch< 1 k ch< 2 k ch< 4 k ch< 8 k ch< 16 k ch< 32 k ch< 64 k ch


Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.

categorizados 1
ago 20163,4 k36910110891,4 k 1,1 k       7111
jul 20163,4 k36810110891,4 k 1,1 k       7111
jun 20163,4 k3671009891,4 k 1,1 k       71 1
mai 20163,4 k3671009891,4 k 1,1 k       71 1
abr 20163,4 k3661009891,4 k 1,1 k       71 1
mar 20163,4 k3611009891,4 k 1,1 k       71 1
fev 20163,3 k361999891,4 k 1,1 k       71 1
jan 20163,3 k360999891,4 k 1,1 k       71 1
dez 20153,3 k358979891,4 k 1,1 k       71 1
nov 20153,3 k354969891,4 k 1,1 k       71 1
out 20153,3 k353949891,4 k 1,1 k       71 1
set 20153,3 k352949891,4 k 1,1 k       71 1
ago 20153,2 k350939891,3 k 1,1 k       71 1
jul 20153,2 k350929861,3 k 1,1 k       71 1
jun 20153,1 k349929861,3 k 1,1 k       71 1
mai 20153,0 k348929861,3 k 1,1 k       71 1
abr 20152,8 k345909861,3 k 1,0 k       71 1
mar 20152,7 k345879861,2 k 1,0 k       71 1
fev 20152,7 k342849851,2 k 1,0 k       71 1
jan 20152,7 k338849851,2 k 1,0 k       71 1
dez 20142,7 k332829851,2 k 1,0 k       71 1
nov 20142,6 k329819851,2 k 1,0 k       71 1
out 20142,6 k326809851,2 k 999       71 1
set 20142,6 k325789851,2 k 988       71 1
ago 20142,6 k320779821,2 k 988       71 1
jul 20142,5 k315769821,2 k 983       71 1
jun 20142,5 k314759821,1 k 981       71 1
mai 20142,5 k314749811,1 k 974       71 1
abr 20142,4 k310719791,1 k 967       71 1
mar 20142,4 k308699791,1 k 966       71 1
fev 20142,4 k305689791,1 k 964      5371 1
jan 20142,4 k300679791,1 k 961      21071 1
dez 20132,4 k296659791,1 k 957      11371 1
nov 20132,4 k296649791,1 k 946      13871 1
out 20132,4 k289639791,1 k 939      44471 1
set 20132,3 k285628791,1 k 921      55161 1
ago 20132,2 k271588791,1 k 901      87661 1
jul 20132,0 k267537751,0 k 843      1356  1
jun 20132,0 k265527731,0 k 826      6026  1
mai 20131,9 k26150368988 768      3772  1
abr 20131,8 k25549368979 753      5892  1
mar 20131,8 k24648367942 724      4382  1
fev 20131,8 k23045367930 709      3882  1
jan 20131,7 k21943360916 683      9242  1
dez 20121,6 k21441360884 658      5762  1
nov 20121,5 k20239360854 639      5052  1
out 20121,4 k19037159809 634      649   1
set 20121,2 k18635156784 616      410   1
ago 20121,2 k17834151719 544      452   1
jul 20121,1 k17029 44670 526      646    
jun 20121,1 k16028 41616 490      1099    
mai 201296614019 39543 419      1594    
abr 201285012812 26291 252      2540    
mar 2012652623  134 89      1921    
fev 2012619    97 68      231    
jan 2012611    95 68      222    
dez 2011607    95 67      266    
nov 2011578    88 61      428    
out 2011542    86 49      144    
set 2011535    83 45      751    
ago 2011412    77 28      1085    
jul 2011231    66 15      351    
jun 2011189    47 12      1134    
mai 2011119    11 7      360    
abr 201184    10 6      120    
mar 201166    10 3      114    
fev 201146    10 3      3    
jan 201145    10 3           
dez 201045    10 3      73    
nov 201041    10 3           
out 201041    10 3      25    
set 201038    6 3      27    
ago 201019    6 3      57    
jul 20106    6 3           
jun 20106    6 3           
mai 20106    6 3           
abr 20106    6 3           
mar 20106    5 3           
fev 20106    5 3           
jan 20106    5 3           
dez 20096    5 3           
nov 20096    5 3           
out 20096    5 3           
set 20096    5 3           
ago 20096    5 3           
jul 20096    5 3      1    
jun 20096    5 3           
mai 20096    5 3           
abr 20096    5 3           
mar 20096    5 3           
fev 20096    5 3           
jan 20096    5 3           
dez 20086    5 3      9    
nov 20086    2             
out 20086    2             
set 20086    2             
ago 20086    2             
jul 20086    2             
jun 20086    2             
mai 20086    2             
abr 20086    2             
mar 20086    2             
fev 20084    1             
jan 20084    1             
dez 20074    1             
nov 20071    1             
out 20071    1             


Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons



For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

out 2007: 1 2 Кьилин ччин

nov 2007: 1 2 Кьилин ччин

dez 2007: 1 2 Кьилин ччин

jan 2008: 1 1 Кьилин ччин

mar 2008: 1 2 Википедия , 2 1 Кьилин ччин

abr 2008: 1 1 Кьилин ччин

nov 2008: 1 1 Кьилин ччин

dez 2008: 1 1 Кьилин ччин

jul 2009: 1 1 Кьилин ччин

ago 2010: 1 3 Урусат , 2 3 Кьвевар , 3 3 Дагъустан , 4 2 Кьилин ччин , 5 2 Футбол

set 2010: 1 2 Кьилин ччин , 2 2 Лезги кхьинар , 3 2 Андорра

out 2010: 1 2 Шри-Ланка , 2 2 Африка

dez 2010: 1 3 Баку , 2 2 Шри-Ланка , 3 2 ЦӀийи Зеландия , 4 2 Футбол , 5 2 Талибан , 6 2 СтIал Сулейман , 7 2 Урусат , 8 2 Пакистан , 9 2 Лезгистан , 10 2 Лезги

fev 2011: 1 1 Кьилин ччин

mar 2011: 1 3 Эрменистан , 2 3 Азербайжан , 3 2 Чувудар , 4 2 Париж , 5 2 Нил , 6 2 Гьайванар , 7 2 Лезгияр , 8 2 Гибралтар , 9 1 НуькI

abr 2011: 1 4 Кьилин ччин , 2 4 КцӀар , 3 3 Къазакъстан , 4 3 Ирландия , 5 2 Шри-Ланка , 6 2 Лезгистан , 7 2 Лезги чIал , 8 2 Лам

mai 2011: 1 5 ЧIехибритания , 2 5 Азия , 3 4 Лезгистан , 4 3 Советрин Социализмдин Республикайрин ГалкӀ , 5 2 Эрменистан , 6 2 Шри-Ланка , 7 2 Чувуд чӀал , 8 2 Китай чIал , 9 2 Туьрк чIал , 10 2 ТӀаратӀ , 11 2 Кьиблепатан Америка , 12 2 Къавкъаз , 13 1 Кьилин ччин

jun 2011: 1 4 Океания , 2 3 Эрменистан , 3 3 Крокодилар , 4 2 Кьилин ччин , 5 2 Юпитер , 6 2 Китайдин Халкьдин Республика , 7 2 Уганда , 8 2 Цифраяр , 9 2 Немец чIал , 10 2 Макао , 11 2 Лезгияр , 12 2 Лезгистан , 13 2 Къарагъанда , 14 2 Канада , 15 2 Кьиблепатан Америка , 16 1 НуькI

jul 2011: 1 4 Германия , 2 3 Европадин гьукуматар , 3 3 Греция , 4 2 Гьил , 5 2 Саха чӀал , 6 2 Саха Республика , 7 2 Мегьарамдхуьр , 8 2 Лезгистан , 9 2 Къазакъстан , 10 1 Кьилин ччин

ago 2011: 1 3 НуькI , 2 3 Кьилин ччин , 3 3 Чурчул , 4 3 Хуьшрекандиз ухшар маймун , 5 3 Супик чӀал , 6 3 Саваннадин фил , 7 3 Наукандин юпик чӀал , 8 3 Мирикина , 9 3 Латин чIал , 10 3 Кьвевар , 11 3 Ибериядин сувайрин чурчул , 12 3 ГъвечӀи панда , 13 3 Гну , 14 3 Арабрин Садхьанвай Эмиратар , 15 3 Атна чӀал , 16 3 Аляскадин юпик чӀал , 17 3 Алеут чӀал , 18 2 Яру бубал , 19 2 Юпик чӀалар , 20 2 Эяк чӀал , 21 2 Эскимос-алеут чӀалар , 22 2 Экуь вили антилопа , 23 2 Чувуд чӀал , 24 2 Чевакдин чупик чӀал , 25 2 Чапла Канададин инуит чӀал

set 2011: 1 4 Туьркиядин лезги хуьрер , 2 3 Кьилин ччин , 3 3 Шергир , 4 3 Чинеруг , 5 3 Химия , 6 3 Туьтуьнуькl , 7 3 Хундуз , 8 3 Ортажа , 9 3 Лезги кхьинар , 10 3 Къванцин цуцӀул , 11 3 Йайлакёй , 12 3 ЦуцӀул-балугъчи , 13 3 Дагъустан , 14 3 Гьатем ага ЧӀакарви , 15 3 Гиенадал ухшар кицӀ , 16 3 География , 17 3 Ахцегь , 18 2 НуькI , 19 2 Яру жанавур , 20 2 Юсуф ал-Лезги , 21 2 МичIи куьрен кард , 22 2 Шахин , 23 2 Шангъар , 24 2 Чалагъан , 25 2 ЧIехибритания

out 2011: 1 3 Кьилин ччин , 2 3 Топонимика , 3 3 Сатурн , 4 2 Чил (планета) , 5 2 Гьил , 6 2 Хашпара дин , 7 2 Футбол , 8 2 Теннис , 9 2 Урусат , 10 2 Мегьарамдхуьруьн район

nov 2011: 1 4 Рутул район , 2 4 Лезгистан , 3 3 Кьилин ччин , 4 3 Яру жанавур , 5 3 Финн чӀал , 6 3 Гъуьгъвезар , 7 3 Ахцегь , 8 3 Антилопа , 9 2 Цуругъ , 10 2 Гьил , 11 2 Хуьшрекандиз ухшар маймун , 12 2 Хуьшрекан хьтин маймун , 13 2 УсухвацI , 14 2 Урус чIал , 15 2 Урбис , 16 2 Туьрк чIал , 17 2 Топонимика , 18 2 Смугъулар (Ахцегь район) , 19 2 Ситатунга , 20 2 СикӀер , 21 2 Планета , 22 2 Пирал , 23 2 Осло , 24 2 Орхидея , 25 2 Муьгъверган

dez 2011: 1 3 Франция , 2 3 Къуйсун , 3 3 Имарат Къавкъаз , 4 2 Кьилин ччин , 5 2 Туьркменистан , 6 2 Суварин цӀиргъ , 7 2 Кеферпатан МуркIарин океан , 8 2 Монако , 9 2 Марсельеза , 10 2 Люксембург , 11 2 Индиядин океан , 12 1 НуькI

jan 2012: 1 4 Тай чӀал , 2 3 Мукьтадир , 3 2 Кьилин ччин , 4 2 Усугъчай , 5 2 Советрин Социализмдин Республикайрин ГалкӀ

fev 2012: 1 4 Кьилин ччин , 2 3 Гьажи Мегьамед Эфенди Штулви , 3 2 Мукьтадир , 4 2 Луткун , 5 2 Википедия

mar 2012: 1 13 Кьилин ччин , 2 10 Лезгияр , 3 8 Азербайжан , 4 7 Лезгистан , 5 7 Къуба , 6 7 Ингъушар , 7 7 Баку , 8 6 Урусат , 9 6 Къазакъстан , 10 6 Ахцегь район , 11 5 Эрменистан , 12 5 Европадин гьукуматар , 13 5 Советрин Социализмдин Республикайрин ГалкӀ , 14 5 ТӀаратӀ , 15 5 Лезгийрин тарих , 16 5 Кьиблепатан Америка , 17 5 Инглис чIал , 18 5 Заира Аминова , 19 5 Дагъустан , 20 5 Ахцегь , 21 5 Антарктида , 22 5 Али Султан , 23 4 Табасаранар , 24 4 Урусар , 25 4 ЦIийи Дуьнья

abr 2012: 1 6 Кьилин ччин , 2 6 Лезгияр , 3 5 Христофор Колумб , 4 5 Дуьньядин кьведлагьай дяве , 5 5 Польша , 6 5 Агъул район , 7 5 Рейн , 8 5 Литва , 9 5 Сауди Арабистан , 10 5 Пакистан , 11 5 Лезги чIал , 12 5 Азербайжан , 13 4 Исламабад , 14 4 Философия , 15 4 Боливия , 16 4 Пакистандин пайдах , 17 4 Мегьамед Мегьамедан хва Гьажиев , 18 4 Италия , 19 4 Лезги Википедия , 20 4 Сара Бернар , 21 4 ЦӀийи гафарин сиягь , 22 4 Грекрин алфавит , 23 4 Тегьран , 24 4 Урусар , 25 4 Кореядин Халкьдинни-Демократиядин Республика

mai 2012: 1 5 Португалия , 2 5 Мисри , 3 5 Ахцегь , 4 4 Каир , 5 4 Puzzling World , 6 4 Владимир Владимирович Путин , 7 4 Falco vespertinus , 8 4 I Наполеон Бонапарт , 9 4 Трпиня , 10 4 Кьилин ччин , 11 4 Италия , 12 4 Дунай , 13 4 Гъед (гьайванар) , 14 3 Абдул Мажид , 15 3 Португал чIал , 16 3 Колибри , 17 3 Дуэро , 18 3 Португалиядин шегьерар , 19 3 Альберт Эйнштейн , 20 3 Кьибле-Африкадин Республика , 21 3 Улуб , 22 3 Мастурбация , 23 3 Яру улуб , 24 3 Астероид , 25 3 Динозавраяр

jun 2012: 1 7 Мугьаммад , 2 6 Византий империя , 3 5 Исаак Ньютон , 4 5 Аллагьдин 99 тӀвар , 5 5 Алюминий , 6 5 Урусат , 7 4 Аврил Лавин , 8 4 Гелхен , 9 4 Химиядин элементрин девирдин система , 10 4 Шахматар , 11 4 Осман империя , 12 4 Византиядин императоррин сиягь , 13 4 Республика Корея , 14 4 The Macallan , 15 4 Суван Къарабагъ , 16 4 Китайдин Халкьдин Республика , 17 4 Финн чӀал , 18 4 Ахцегь , 19 4 Айдагьо , 20 3 Брест , 21 3 Вольфганг Амадеус Моцарт , 22 3 Математика , 23 3 Бубуяр , 24 3 Сятдин чӀул , 25 3 Гьукуматдин идара авунин тегьер

jul 2012: 1 4 Санкт-Петербург , 2 4 ЧӀехи Француз инкъилаб , 3 4 Рим империя , 4 4 Куба , 5 3 Дуьньядин чими хьун , 6 3 Эсперанто , 7 3 Волга , 8 3 Эрнесто Че Гевара , 9 3 Яд , 10 3 Автомобилдин код , 11 3 Математика , 12 3 Чил (планета) , 13 3 Сев , 14 2 Лелевар , 15 2 Постессив аватвал , 16 2 Археяр , 17 2 Биология , 18 2 Дезоксирибонуклеин цуруцӀ , 19 2 Велс , 20 2 Садхьанвай миллетрин тешкилат , 21 2 Че Гевара , 22 2 Расим Загьирбег хва Тагирбеков , 23 2 Рахазвайбурун кьадардиз килигна чӀаларин сиягь , 24 2 Автомобил код , 25 2 Почтунин индекс

ago 2012: 1 7 Лезгистан , 2 5 Олимпиядин къугъунар , 3 4 Рим , 4 3 Сочи , 5 3 Биология , 6 3 Грекрин алфавит , 7 2 Экваториал Гвинея , 8 2 Чарльз Дарвин , 9 2 Искандер Македонжув , 10 2 The Beatles , 11 2 Иосиф Виссарионович Сталин , 12 2 Сингапур , 13 2 Гуржи чIал , 14 2 Хунзах район , 15 2 2012 Гатун Олимпия къугъунар , 16 2 Велс , 17 2 Эсперанто , 18 2 Куба , 19 2 Португалия , 20 2 Тегьран , 21 2 Урус чIал , 22 2 Тувалу , 23 2 Лас океан , 24 1 Никlи

set 2012: 1 3 Юлий Цезарь , 2 3 Иерусалим , 3 3 Таиланд , 4 3 Жозе Мария Эса ди Кейруш , 5 3 Ботлих , 6 3 Акуша , 7 3 Алпан , 8 3 Хошимин , 9 3 Кьулан вацI , 10 3 Париж , 11 2 Физика , 12 2 Дегь Мисри , 13 2 ПIатIар , 14 2 Сарфунъял , 15 2 Экология , 16 2 Вунгтау , 17 2 Нячанг , 18 2 Америка , 19 2 Кертагъ Давдакь , 20 2 С , 21 2 Слово (газет, Португалия) , 22 2 Эйсебио , 23 1 Исламабад

out 2012: 1 4 Мадрид , 2 4 Вена , 3 3 Хуьруьн майишат , 4 3 Кефердинни рагъакIидай Англия , 5 3 Ливерпульдин агломерация , 6 3 Неаполь , 7 3 Турин , 8 3 ЦIуру Худат (КцIар район) , 9 3 Хурай (КцIар район) , 10 3 Немец чIал , 11 2 Мирземугьаммадхъишлах , 12 2 Эрдэнэт , 13 2 Монгол чӀал , 14 2 Улан-Батор , 15 2 Чархы , 16 2 Жанахир , 17 2 ЧIал , 18 2 Карл Маркс , 19 2 Салвадор Дали , 20 2 Акбар ЧӀехи , 21 2 Гаф , 22 2 Slayer , 23 2 Пекин , 24 2 Къусарчай (Хъачмаз) , 25 2 Гуьнешли

nov 2012: 1 4 Компьютер , 2 4 Садвал , 3 3 Чепер , 4 3 Уран (планета) , 5 3 Каракорум (шегьер) , 6 3 Куритиба , 7 3 Гилияр , 8 3 Водород , 9 3 Грар , 10 3 Магьачкъала , 11 3 Дербент район , 12 2 Людвиг ван Бетховен , 13 2 Ӄ , 14 2 Дагъустандин ЦIаяр , 15 2 Дагъустан Республикадин шегьерар , 16 2 Ыгыл , 17 2 1930 йис , 18 2 Мичегь , 19 2 Калук , 20 2 Приморск (Дагъустан) , 21 2 Венесуэла , 22 2 КьепIир Къазмаяр , 23 2 Хуьлуьхъ , 24 2 ПIатIар , 25 2 Рим

dez 2012: 1 3 Кьулан СтIал , 2 3 Къайи дяве , 3 3 Вепс чӀал , 4 3 Пудлагьай рейх , 5 3 Велс , 6 3 Астероид , 7 3 Ле Корбюзье , 8 2 Камарван , 9 2 Пиперхуьр , 10 2 КIахцугъ , 11 2 Герейханован совхоздин 2-лагьай отделение , 12 2 Зари , 13 2 Алкьвадар , 14 2 Усур , 15 2 Хашпересрин финар , 16 2 Вьетнамдин дяве , 17 2 1930 йис , 18 2 Сарфунъял , 19 2 Усугъчай , 20 2 Туьрквер-месхетияр , 21 2 ТӀиб , 22 2 Марс , 23 2 Кьасумхуьр , 24 1 Пак тир Рим империя

jan 2013: 1 3 Индуизм , 2 3 Лезгияр , 3 2 Вашингтон (кьилин шегьер) , 4 2 Ахвах район , 5 2 Акуша район , 6 2 1812 йис , 7 2 1866 йис , 8 2 1878 йис , 9 2 1969 йис , 10 2 Вини СтIал , 11 2 , 12 2 Пак тир Рим империя , 13 2 Компьютер , 14 2 Велиханрин Къудрат Кибечханан хва , 15 2 Волга , 16 2 Мугьаммад , 17 2 ЧӀулав тӀеквен , 18 2 Сампи , 19 2 Промышленность , 20 2 2012 йис , 21 2 Рейн , 22 2 Пси (гьарф) , 23 2 Фи , 24 2 Ипсилон , 25 2 Тау

fev 2013: 1 2 Фридрих Ницше , 2 2 Бум , 3 2 Къарасу , 4 2 Къарадейн , 5 2 Кичик ПIирали , 6 2 Курд (Кьвепеле) , 7 2 Кветуьклуь , 8 2 Имамлы , 9 2 Зергерли , 10 2 Зараган , 11 2 Залам , 12 2 Жигъателли , 13 2 Жорлу , 14 2 Енгиже

mar 2013: 1 3 1949 йис , 2 3 1969 йис , 3 3 Турция , 4 3 Айдагьо , 5 3 Абхазия , 6 2 Дегь Греция , 7 2 Валенсия (мана) , 8 2 Илим , 9 2 АСШ-дин граждан дяве , 10 2 Гарринча , 11 2 ЧӀулав хъалхъам , 12 2 Элвис Пресли , 13 2 Байуба , 14 2 Дунчэн (Пекин) , 15 2 Садхьанвай миллетрин тешкилат , 16 2 Каир , 17 2 ЧӀулав тӀеквен , 18 2 Лекь (анатомия) , 19 2 Яру жанавур , 20 2 Февраль , 21 2 Китайдин Халкьдин Республика , 22 2 Июль , 23 2 Лас океан , 24 2 Август , 25 2 Некхъвадайбур

abr 2013: 1 5 Амстердам , 2 3 Гонконг , 3 3 Октавиан Август , 4 3 Плазма , 5 3 Ракь , 6 3 Рио-де-Жанейро , 7 3 Метр , 8 3 Буэнос-Айрес , 9 3 Иерусалим , 10 3 Дагъустан , 11 2 Умар Хайям , 12 2 Сувар (ансамбль) , 13 2 Керимрин Седакъет Къайинбеган руш , 14 2 Метаболизм , 15 2 Кизилюрт , 16 2 Михаил Лезгинцев , 17 2 Атом , 18 2 Гьуьсейнов Абдусалам Абдулкериман хва , 19 2 Барселона (мана) , 20 2 Агъдам район , 21 2 Нежефхуьр , 22 2 Ахцегьрин гьамамар , 23 2 Грар , 24 2 Юсуф ал-Лезги , 25 2 Эфиопидин чъакъал

mai 2013: 1 3 Франция , 2 2 Москва вилаят , 3 2 Альгеро , 4 2 Алпан (манаяр) , 5 2 Алпан (астрономия)

jun 2013: 1 3 Марко Поло , 2 3 Демократия , 3 3 Фу , 4 2 Мидгьед Ширинбегов , 5 2 Иисусан гьакъикъи клиса , 6 2 Александр Ильич Рыбников , 7 2 Кьавал , 8 2 Агъул чIал , 9 2 Хвереж (Кьурагь район) , 10 2 Усугъ , 11 2 Вулкан (геология) , 12 2 Абилов Магьмуд Абдулрзадин хва , 13 2 Митаги хуьруьнсовет , 14 2 Хазар хуьруьнсовет , 15 1 Кьилерин хуьруьнсовет

jul 2013: 1 2 Хъачмаз район , 2 1 Зигмунд Фрейд

ago 2013: 1 3 Католицизм , 2 3 Чингисхан , 3 3 Винстон Черчилль , 4 2 Урусатдин тӀаратӀ , 5 2 Табасаран чIал , 6 2 Дагъустандин тIаратI , 7 2 Гоа (Дагъустан) , 8 2 Мыгра (Дагъустан) , 9 2 Кина (Дагъустан) , 10 2 Британиядин империя , 11 2 Вини Катрух , 12 2 Автомобиль , 13 2 Марко Поло , 14 2 Агъул чIал , 15 2 ЧIал , 16 2 Вини ЦIийихуьр , 17 2 Христофор Колумб , 18 2 ТӀаратӀ , 19 2 Лезги чIал , 20 2 Кьвевар , 21 1 Будугъ чIал

set 2013: 1 3 Авраам Линкольн , 2 3 КъирицI чIал , 3 2 Чилин зурзунар , 4 2 Хинелугъ чIал , 5 2 Нидерландар , 6 2 Китайдин Халкьдин Республика , 7 2 Саха Республика , 8 1 ЦIуру Киркар

out 2013: 1 3 Лезгияр , 2 2 Холокост , 3 2 Хамаматюрт , 4 2 Адиль-Янгиюрт , 5 2 Бабаюрт , 6 2 Чилин зурзунар , 7 2 Табасаранар , 8 1 ЧӀутрацуьк

nov 2013: 1 3 Аристотель , 2 3 Бактерияр , 3 2 Ингушетия , 4 2 UTC+4 , 5 2 Терек , 6 2 Хуьр , 7 2 Шегьер , 8 2 АхцегьвацӀ , 9 2 Мустафа Камал Ататуьрк , 10 1 Муниципал район

dez 2013: 1 3 КуртӀухъан , 2 3 Атлантик океан , 3 3 Харахуба , 4 2 Пепеяр , 5 2 Малярия , 6 1 Тарих

jan 2014: 1 3 Мирослава Вавринец , 2 3 Роджер Федерер , 3 3 Валентина Васильевна Толкунова , 4 3 Кьвепеле , 5 2 Затор , 6 2 Бойнице , 7 2 Куколивка

fev 2014: 1 3 Шахматар , 2 2 Сан-Паулу , 3 2 Гуржистан , 4 2 Абхазия , 5 1 Славян чIалар

mar 2014: 1 3 Поляк чIал , 2 3 Словак чIал , 3 3 Чех чIал , 4 2 Кашуб чIал , 5 1 НАТО

abr 2014: 1 3 Алискерово (посёлок) , 2 2 Тито Виланова , 3 2 Баламирзоев Абдул Гьажибаладин хва , 4 2 Поречье хуьруьнсовет (Тула вилаят) , 5 2 Дубна (Тула вилаят) , 6 2 Фотосинтез , 7 1 Синусоида

mai 2014: 1 3 Грек чӀал , 2 3 Сидней , 3 3 Вичи-вич кьин , 4 3 Сеул , 5 3 Салигьов Эсед Бабастанан хва , 6 3 Верем , 7 2 Metallica , 8 2 Пурни , 9 2 Мумбаи , 10 2 ТӀач , 11 2 Бебелук , 12 2 2014 ХъуьтӀуьн Олимпия къугъунар , 13 2 ЧӀулавкьал , 14 2 ЦӀегьрекарч , 15 2 Словак чIал , 16 1 Лезги литература

jun 2014: 1 2 Фернан Магеллан , 2 2 Цур , 3 2 Геология , 4 2 Етим Эмин , 5 2 Храхуба , 6 2 Гуржи чIал , 7 2 Далдам , 8 1 Инд океан

jul 2014: 1 2 Джяравица , 2 2 Европадин таж , 3 2 Квеста , 4 2 Париж бассейн , 5 1 Ботсвана

ago 2014: 1 3 Робин Вилиамс , 2 2 Джульярд мектеб , 3 2 ЦIуьлуьк , 4 2 Хъутур-Куьредин наибвал , 5 1 Аль-Муайдар

set 2014: 1 3 Ио , 2 2 Вилиам Хьайд Волластон , 3 2 Владимир Владимирович Путин , 4 2 Юрий Алексеевич Гагарин , 5 1 Черногориядин шегьерар

out 2014: 1 2 Чай , 2 2 Балтик гьуьлуьн пешекарвилин галкIрин чил , 3 2 Латвия , 4 2 Эстония , 5 2 Братислава , 6 2 Прагьа , 7 1 Кения

nov 2014: 1 2 Анархизм , 2 2 Аргентина , 3 2 Нью-Йорк , 4 1 Амадора

dez 2014: 1 2 Дакка , 2 2 Палестина , 3 1 Къеди

jan 2015: 1 2 Сокольническая цӀар , 2 2 ТупӀалдин цӀар (Москва) , 3 1 Эседуллагь Эмирагъайрин

fev 2015: 1 2 Абдусамад Гьамидов , 2 2 Гьарйяна , 3 2 Никола Тесла , 4 2 Халилов Юсиф Мевлуьдан хва , 5 2 Экономика , 6 2 Чингисхан , 7 1 Кьилин мефтӀ

mar 2015: 1 3 Пудлагьай рейх , 2 2 Украинадин вилаятар: абурун ибарат , 3 2 Украинадин административ паюн , 4 2 I Фарнаваз , 5 2 Асалийрин Асали Мугьаммадалидин хва , 6 2 Братислава , 7 2 ЧIулав гьуьл , 8 2 Украина , 9 2 Уругвай , 10 2 Пакистан , 11 2 Немец чIал , 12 1 Фарнаваз I

abr 2015: 1 3 Грац , 2 3 Лас океан , 3 2 Линц , 4 2 Альфредо Ди Стефано , 5 2 Орёл вилаят , 6 2 Орёл (шегьер) , 7 2 Республика Крым , 8 2 Амстердам , 9 2 Мадрид , 10 2 Лионель Месси , 11 2 Испания , 12 2 Урусат , 13 2 Каспи гьуьл

mai 2015: 1 3 Ингилис Премьер-лига , 2 2 Бути (Чечня) , 3 2 Сократес , 4 2 Церхимахи , 5 2 Линц , 6 2 Кочубей (Дагъустан) , 7 2 Танк , 8 2 Нилтон Сантос , 9 2 Испания , 10 2 Науру , 11 2 Кьасумхуьр , 12 2 Истамбул , 13 2 Инглис чIал , 14 2 Америкадин Садхьанвай Штатар , 15 1 Македония Республикадин шегьерар

jun 2015: 1 2 Инсбрук , 2 2 Ямал-Ненец АО-дин шегьерар , 3 2 Валерий Яковлевич Леонтьев , 4 2 Ханты-Манси АО-дин шегьерар , 5 2 Карелия Республикадин шегьерар , 6 2 Урусатдин шегьеррин сиягь , 7 2 Икрам Сабиран хва Алискеррин , 8 1 СССГ-дин илимрин академия

jul 2015: 1 3 Инсбрук , 2 3 Германиядин империя , 3 2 Александр Сергеевич Пушкин , 4 2 Стивен Джеррард , 5 2 Гьаштархан вилаятдин шегьерар , 6 2 Исайрин Радик Велединан хва , 7 2 Камчатка крайдин шегьерар , 8 2 Грац , 9 2 Воскресенское (Дубна район) , 10 1 Абдул Мукьтедир Айдинбекан хва

ago 2015: 1 3 Дубна (Тула вилаят) , 2 2 Къарачай-Черкесия Республикадин шегьерар , 3 2 Лезгияр , 4 2 Ислам , 5 2 Амазун , 6 1 СпекI

set 2015: 1 3 Хъачмаз район , 2 3 Лезгияр , 3 2 Таджикистан , 4 2 Молдова , 5 2 Нигерия , 6 2 Мисри , 7 2 Уганда , 8 2 Багьрейн , 9 1 Ассаб

out 2015: 1 4 Азербайжан , 2 2 Иан Раш , 3 2 Азербайжандин гимн , 4 2 Азербайжандин тIаратI , 5 2 Гимры , 6 2 Сербия , 7 2 Гьажи Дауд , 8 1 Грем Сунесс

nov 2015: 1 2 Deep Purple , 2 2 Кьил чIулав питунар , 3 2 Мугьаммад ЧIехибубадин хва Куругълийрин , 4 2 Кулур , 5 2 Дакка , 6 2 Мучугъ , 7 2 Суварин цӀиргъ

dez 2015: 1 2 Гьамидуллагьрин Роман Играмеддинан хва

jan 2016: 1 3 Бильгади , 2 2 Кариб гьуьл , 3 2 Мекка , 4 2 Урусатдин шегьерар , 5 2 Вишйисан дяве , 6 1 Якут чIал

fev 2016: 1 3 Байкал , 2 2 Гьольштайн , 3 2 Кефердинни-рагъакӀидай патан федерал округ , 4 1 Лев Николаевич Толстой

mar 2016: 1 4 Йугьан Круифф , 2 2 Астрахань , 3 2 Магадан , 4 1 Сирхияр

abr 2016: 1 2 Яргун , 2 2 Табасаранар , 3 1 Мугьажир

mai 2016: 1 2 Гьамзатрин Расул Гьамзатан хва , 2 2 Адиль-Янгиюрт , 3 2 Ашар , 4 1 Ергуьжар

jun 2016: 1 3 Ниж , 2 2 Хучни , 3 2 Имам Шамил , 4 2 Яргъал-РагъэкъечӀдай патан федерал округ , 5 2 Урусатдин шегьеррин сиягь , 6 1 Вачи

jul 2016: 1 2 Эмирали ТIигьиржалви , 2 2 Эквадор , 3 2 Сунияр , 4 2 Убыхар , 5 2 Александр Сергеевич Пушкин , 6 2 Къайтагъ район , 7 1 Мирза Али

ago 2016: 1 2 Хинелугъ чIал , 2 1 Эликар

Wikipedias are initially ordered by number of speakers of the language

Speakers: Number of speakers of a language is the estimated total of primary and secondary speakers, is in many cases a very rough estimation (based on the page on the English Wikipedia about that language)
Regions are parts of the world where the language is spoken in substantial amounts (compared to total number of speakers). Regions where a language gained presence only by a recent diaspora are generally not included.
Region codes: AF:Africa, AS:Asia, EU:Europe, NA:North America, OC:Oceania, SA:South America, W:World Wide, CL:Constructed Language

Estatísticas geradas em Domingo, 18 de setembro 2016 14:43

Dump file lezwiki-20160901-stub-meta-history.xml.gz (edits only), size 4.1 Mb as gz -> 29 Mb
Dump processed till Aug 31, 2016, on server stat1002, ready at Wed-07/09/2016-08:52 after 26 sec.

Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### =
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.