Estatísticas da Wikipédia lezgian

Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Articles per size range / Records per namespace / Most edited articles / Zeitgeist
  May 2016: The major overhaul of Wikistats reports has entered a new phase.  

  First phase focused on migrating the traffic analysis reports to our new infrastructure. Those are operational now.  
  The Analytics Team will now proceed to also migrate data collection and reporting about wiki content and contributors.  
  First results are expected later this year.  

  More info at this announcement
  You can see the first wireframes for Wikistats 2.0 and comment on the design here.


Most metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.

Some metrics have been collected from the full archive dump which runs on lower frequency than the usual monthly cycle.
These metrics are columns F,I,J,K,M,N,O,P,Q,R from the first table.

See also metrics definitions

Monthly counts & Quarterly rankings: março 2017
DataWikipedistasArtigosBase de dadosLigações
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
mar 2017+2%   +2%      -71%      +4%
fev 20170%   +17%      +330%      +53%
jan 20170%   +2%      -31%      +4%
dez 2016+2%   +5%      +115%      +8%
nov 20160%   +2%      -24%      +5%
out 20160%   +4%      +137%      +2%
mar 2017661323,8 k 311,9   618      1,2 k
fev 201765 313,7 k 2012   2,2 k      1,2 k
jan 201765 313,2 k 213,4   502      767
dez 2016651513,1 k 513,6   732      737
nov 201664 312,9 k 214,1   340      682
out 201664 512,9 k 314,3   445      647
set 20166413 2,8 k  14,6   188      634
ago 201663 112,8 k  14,6   193      631
jul 201663 312,8 k  14,5   308      630
jun 201663 112,7 k  14,5   170      621
mai 201663 112,7 k  14,5   197      621
abr 201663 1 2,7 k  14,4   72      619
mar 201663 412,7 k  14,4   198      619
fev 201663 412,7 k  14,4   203      614
jan 20166316 2,7 k  14,4   241      614
dez 201562 2 2,7 k  14,3   48      613
nov 201562 3 2,7 k  14,3   118      612
out 2015621512,7 k 114,3   246      609
set 201561 212,7 k 214,3   284      607
ago 201561 412,6 k  14,5   246      604
jul 201561 412,6 k 214,5   594      601
jun 201561 412,5 k 314,7   433      588
mai 201561 312,4 k 815,1   1,3 k      580
abr 2015611422,2 k 216,1   554      577
mar 2015601612,1 k  16,3   552      563
fev 201559 4 2,1 k 116,1   141      554
jan 201559 3 2,1 k 116,2   90      548
dez 201459 3 2,1 k  16,3   46      546
nov 201459 2 2,1 k  16,2   65      544
out 20145913 2,1 k  16,3   110      543
set 20145813 2,1 k 116,3   70      540
ago 201457 412,1 k 216,4   287      538
jul 201457 212,0 k 116,7   177      531
jun 20145726 2,0 k 116,8   230      528
mai 2014551612,0 k 116,9   279      520
abr 201454 4 1,9 k  17   159      498
mar 201454 4 1,9 k  17   137      491
fev 201454 2 1,9 k1,7 k 17233180%39%858,5 Mb587 k36 k2402,3 k5,4 k485
jan 2014542611,9 k1,7 k 17233380%38%3548,5 Mb584 k36 k2402,2 k5,4 k482
dez 201352 3 1,9 k1,7 k 16,9233080%38%1448,5 Mb581 k35 k2402,2 k5,4 k479
nov 201352 4 1,9 k1,7 k116,9232880%38%1728,4 Mb578 k35 k2402,2 k5,4 k478
out 2013521311,9 k1,7 k317233279%39%5288,4 Mb574 k35 k2432,2 k5,3 k472
set 201351 311,8 k1,6 k217,5226578%36%5707,7 Mb533 k32 k3552,2 k4,9 k469
ago 201351 221,7 k1,6 k517,7218578%34%9037,3 Mb500 k31 k3552,2 k4,6 k464
jul 201351 2 1,6 k1,4 k118,8207076%29%1576,3 Mb433 k27 k5312,1 k3,9 k429
jun 201351 311,6 k1,4 k218,9205775%29%6346,1 Mb426 k26 k5342,1 k3,9 k427
mai 201351 211,5 k1,3 k219,4199274%27%4115,7 Mb395 k24 k4862,1 k3,5 k415
abr 201351 521,4 k1,2 k120194273%25%6615,3 Mb370 k23 k4892,1 k3,2 k414
mar 2013511511,4 k1,2 k 20,1187172%24%2,1 k4,9 Mb346 k22 k1,1 k2,1 k3,0 k399
fev 201350 321,4 k1,2 k318,8183473%23%1,3 k6,5 Mb337 k21 k67 k2,1 k2,9 k391
jan 201350 421,3 k1,1 k218,9182571%23%1,6 k6,2 Mb318 k21 k66 k2,1 k2,8 k384
dez 201250 511,2 k1,1 k218,6180972%22%1,2 k5,9 Mb301 k20 k64 k2,1 k2,6 k373
nov 2012501711,2 k1,0 k418,6174871%19%1,1 k5,5 Mb276 k18 k63 k2,1 k2,4 k362
out 2012492521,1 k946619,4175768%18%1,2 k5,1 Mb254 k17 k61 k1,9 k2,2 k354
set 201247 51865746122,4185161%21%1,3 k4,5 Mb220 k15 k58 k1,5 k1,9 k338
ago 201247162835711121,7178860%20%9654,3 Mb204 k15 k56 k1,5 k1,7 k333
jul 2012462123814689121,1167359%19%1,3 k3,9 Mb186 k13 k54 k1,2 k1,6 k313
jun 2012441133775637220,4145455%17%1,7 k3,4 Mb154 k11 k50 k1,1 k1,4 k290
mai 201243193717564219,7123750%15%2,2 k2,9 Mb121 k8,2 k47 k1,0 k1,1 k247
abr 201242318566450031898444%12%3,1 k2,4 Mb89 k6,2 k42 k790727184
mar 20123910215560393115,881139%9%2,4 k1,8 Mb61 k3,4 k34 k70834890
fev 201229 41532388 12,180040%8%6821,6 Mb59 k3,2 k28 k68830785
jan 201229121529386 10,978040%8%2331,4 Mb57 k3,3 k23 k68730681
dez 201128 41525383110,677240%8%2911,4 Mb56 k3,2 k23 k68430481
nov 201128371503370110,478942%8%4331,3 Mb55 k3,1 k21 k66430374
out 201125 4 484348 9,978441%8%3491,3 Mb52 k2,8 k21 k65029757
set 201125410247934549,378741%8%7581,1 Mb52 k2,8 k14 k64931355
ago 201121510237426959,987643%10%1,1 k954 kb45 k2,4 k12 k53331138
jul 201116281219166111,973245%8%361537 kb23 k8298,7 k35918712
jun 201114 51178131212,680452%10%1,2 k487 kb21 k6528,0 k28016411
mai 2011143811115719,860327%12%436322 kb9,9 k2967,3 k106298
abr 20111125 784018,451126%12%157210 kb5,8 k1484,9 k8816
mar 2011923 603418,260230%15%141201 kb5,3 k1284,9 k7516
fev 20117   4031 8,883642%22%3169 kb4,9 k1223,7 k56 6
jan 20117   3931 983644%23%3167 kb4,9 k1223,7 k56 6
dez 2010712 3931 8,983644%23%74167 kb4,9 k1223,7 k56 6
nov 20106   3923 7131138%23% 130 kb7,8 k1219195922
out 2010612 3923 7131138%23%36130 kb7,8 k1219195922
set 2010511 362216,6145742%19%113128 kb7,6 k1219186322
ago 2010422 1818 6,9103167%28%5766 kb2,9 k12089457 1
jul 20102   55 13,685760%40%415 kb956151334 1
jun 20102   55 12,885760%40% 15 kb956151334 1
mai 20102   55 12,885760%40%315 kb956151334 1
abr 20102   55 12,285760%40% 15 kb956151334 1
mar 20102   55 12,285760%40% 15 kb956151334 1
fev 20102   55 12,285760%40% 15 kb956151334 1
jan 20102   55 12,285760%40%315 kb956151334 1
dez 20092   55 11,685760%40% 15 kb956151294 1
nov 20092   55 11,685760%40% 15 kb956151294 1
out 20092   55 11,685760%40% 15 kb956151294 1
set 20092   55 11,685760%40% 15 kb956151294 1
ago 20092   55 11,685760%40% 15 kb956151294 1
jul 20092   55 11,685760%40%115 kb956151294 1
jun 20092   55 11,485760%40% 14 kb95615184 1
mai 20092   55 11,485760%40% 14 kb95615184 1
abr 20092   55 11,485760%40% 14 kb95615184 1
mar 20092   55 11,485760%40% 14 kb95615184 1
fev 20092   55 11,485760%40% 14 kb95615184 1
jan 20092   55 11,485760%40% 14 kb95615184 1
dez 20082 1 55 11,485760%40%914 kb95615184 1
nov 20082   55 9,682660%40%112 kb9261183 1
out 20082   55 9,482560%40% 12 kb9231183 1
set 20082   55 9,482560%40% 12 kb9231183 1
ago 20082   55 9,482560%40% 12 kb9231183 1
jul 20082   55 9,482560%40% 12 kb9231183 1
jun 20082   55 9,482560%40% 12 kb9231183 1
mai 20082   55 9,482560%40%612 kb9231183 1
abr 20082   55 8,282560%40%412 kb9231183 1
mar 20082   55 7,481360%40%712 kb9071183 1
fev 20082   34 101615100%100% 19 kb1,3 k6921111
jan 20082 1 34 101615100%100%519 kb1,3 k6921111
dez 2007211 32 8,3145467%67%1718 kb7626629 1
nov 20071   11 82920100%100%65,9 kb3476328  
out 200711  1  242  2104 6     
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternas

> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
The following table ranks this project in relation to projects in other languages with 1000+ articles
jan 2017174 145138194 124175   130      240
out 2016172 122136201 112169   126      240
jul 2016171 152138201  169   134      240
abr 2016168 194 200  172   170      240
jan 2016167148122 199  172   145      240
out 2015167137125141196 147173   147      240
jul 2015167 136130194 112177   116      240
abr 2015166153140113198 125165   126      240
jan 2015167 155 196 157162   179      240
out 2014165143151 197  163   159      240
jul 2014165 167136197 149160   153      240
abr 2014168 140 197  157   161      240
jan 2014164117121141195180158160506829142146160158202140133240
out 2013162147158129194180104163476927109147158158209139133240
jul 2013161140171138201184149152597752158155171169186138139240
abr 2013161144129111202184155143688360138161173174195138144240
jan 2013157147137103202182120150708569154181177172198141143240
out 201215610912410520618685142769787174187182176200141151240
jul 20121591008894211197150207206206204167196188179202152156240
abr 2012163857676212203107205204204201110207207202210165181240
jan 2012183143170135215209149204203203200221218219217220172200240
out 2011190148141147215209161203202202199218215217220220171198240
jul 201121711299133225221156200199199196216226224225226189206240
abr 201122298130136235229149196195195192221232233233230221236240
jan 2011235151216138238232156195194194191239234234233233230236240
out 2010235145172131238234153188187187185234235229234236224236240
jul 2010239160216141239236156183182182180239236236236236236236240
abr 2010239148204138239235154180179179178239236236236236235236240
jan 2010238145204132238235151179179179178233237237236236235237240
out 2009238144204135238235155176176176175235237237236236233237240
jul 2009237188200135237234149170170170169232235235235235234235240
abr 2009236140195145235233145167167167166234235235235235233232240
jan 2009235134205132235232146162162162161238234234234234233233239
out 2008234137198133233228144156156156155234231231231231231232237
jul 2008232145200133230225146150150150148231228228228229227231236
abr 2008230148203129229225147145145144142229227226228229226229236
jan 2008227149194134227222153140140139138223224222217224216223232
out 2007227129194133229226147138138136136222228227227223220220231
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
 WikipedistasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikipedistas (usuários registrados)
A = Wikipedistas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikipedistas que editaram pelo menos dez vezes desde que chegaram
C = Wikipedistas que contribuíram cinco vezes ou mais este mês
D = Wikipedistas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Artigos que contêm pelo menos uma ligação interna e 200 caracteres de texto legível, não contando códigos wiki e html,
      ligações ocultas, etc.; títulos também não contam (outras colunas são baseadas no método oficial de contagem)
G = Novos artigos por dia no mês passado
H = Número médio de revisões por artigo
I = Tamanho médio dos artigos em bytes
J = Porcentagem de artigos com pelo menos 0,5 kb de texto legível (veja F)
K = Porcentagem de artigos com pelo menos 2 kb de texto legível (veja F)

Base de dados
L = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
M = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
N = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

O = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
P = Total de ligações para outras wikipédias
Q = Total de imagens apresentadas
R = Total de ligações para outros sítios
S = Total de páginas de redirecionamento

Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  5  10  100  1000  1  3  5  10  25  100  5  10  1  3  5  10  25  100  250  5  10  100 
mar 201711433321 1   43311   533331111 
fev 201713632211122  211     73221  11 
jan 201711331111     6       422111 11 
dez 201611753211     6321    54221  11 
nov 2016733221  1   2221    622111 11 
out 201610555311     4322    1065111 11 
set 2016104332  11  32      51111     
ago 2016821111      31      421       
jul 2016733221      2       4211   11 
jun 20161321111      1       52     11 
mai 2016731111      2       411    11 
abr 201671111      5       9211   11 
mar 20161144211  1   1       411    11 
fev 2016964311      311     811    22 
jan 2016147643      411     72111  22 
dez 20158321   1   211     6311   22 
nov 201554331      4       81     22 
out 20151275311      1       9111   32 
set 2015432211  1   721     73221  32 
ago 2015844411      41      84422  33 
jul 201510443311 1   211     54421  22 
jun 201511542211     21      75431  22 
mai 2015133332111    5331    733322 22 
abr 201511544321 11  5221  22533221 22 
mar 201512763211 11  311   115211   32 
fev 2015115431      31      7311   22 
jan 201584332      831     5211   22 
jan 201711331111     6       422111 11 
out 201610555311     4322    1065111 11 
jul 2016733221      2       4211   11 
abr 201671111      5       9211   11 
jan 2016147643      411     72111  22 
out 20151275311      1       9111   32 
jul 201510443311 1   211     54421  22 
abr 201511544321 11  5221  22533221 22 
jan 201584332      831     5211   22 
out 2014114322  1   2       82111  22 
jul 2014922211      1       43221  22 
abr 2014115433  1   221     72221  21 
jan 20141286431  11  321     5211   32 
out 20139432111 21  62      632211111 
jul 201342222      31      92221  33 
abr 201313555321 43  4443    1133322 541
jan 201315544221 1363 6322    933321 961
out 201211655321 862 74321   1254321 851
jul 2012181212853  872 1711842   2314131031 771
abr 201232211810754 971 341914853  552212774143 
jan 2012742221      1       1         
out 201185441  111         11111  11 
jul 201110885111     322     421111    
abr 201165551      1       1         
jan 2011                            
out 20103221               2111      
jul 2010                            
abr 2010                  2         
jan 2010                            
out 2009                            
jul 20091                           
abr 2009                            
jan 2009                  1         
out 2008                            
jul 2008                  2         
abr 200811                          
jan 2008111                          
out 20072                           


Distribuição de edições de artigos por wikipedistas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...

Edições >=WikipedistasEdições total


11 wikipedistas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias

 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
30 dias
30 dias
30 dias
30 dias
Aslan XasiyevUC1 015,0353453,13935mar 27, 201218292,47384--
Soul TrainUC2 05,071536,58645mar 28, 201218281343--
MugerganetsUC6 01,1733128-out 13, 201216292272--
FrhdkazanUC14+95201197472433jan 26, 2016429----
RamzankaUC90+661--dez 18, 20161022---
ChenspecUC172+14321--mai 14, 2016320----
Batman 069UC179...22--mar 13, 201717----
XRayUC344...11--mar 04, 201726----
Lezgi rushUC345...11--mar 27, 20173----
AlexandronikosUC346...11--mar 30, 2017 ----
JcbUC347...11--mar 31, 2017 ----


20 wikipedistas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

  Primeira ediçãoúltima edição
Namik555UC32,766mar 07, 20112215abr 21, 20121804
MigraghviUC41,628ago 31, 20112038fev 17, 201741
LezgistxaUC51,493set 20, 20112018jun 01, 20121763
User from DagUC7747ago 17, 20102417fev 26, 201732
SPQRobinUC8625mar 27, 20121829mar 27, 20121829
Tamara UstinovaUC9584nov 14, 20111963dez 04, 20131212
KmoksyUC10512ago 11, 20112058fev 12, 2015777
Aslan4ikUC11412jan 21, 20121895mar 27, 20121829
MaxBioHazardUC12386mar 11, 2015750mar 11, 2015750
Saint JohannUC13385mar 28, 20121828out 15, 20121627
Cekli829UC15190mar 10, 20112212abr 24, 2016340
MaqiviUC16153out 07, 20112001set 03, 20131304
U.SteeleUC17125ago 02, 20112067mar 31, 20121825
LezgiUC18116abr 27, 20112164jun 02, 20121762
HydrizUC19103jan 30, 20141155jan 30, 20141155
NessajaUC2090abr 25, 20121800out 05, 2014907
МаликумUC2189fev 07, 20121878jun 30, 2016273
ZagirskiUC2277set 16, 2016195out 30, 2016151
91i79UC2355mar 27, 20121829out 12, 2014900
Master ShadowUC2453out 12, 20102361dez 14, 20102298


Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 1.804 edições foram feitas por usuários anônimos, de um total de 45.270 edições ( 3e %)

43 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
MerlIwBotUC12,600mai 27, 20112134ago 09, 20131329--
EmausBotUC21,636abr 16, 20121809nov 09, 20131237--
AddbotUC31,461mar 07, 20131484ago 16, 20131322--
XqbotUC41,085abr 16, 20121809mar 06, 201724--
JackieBotUC5907abr 26, 20121799dez 01, 2014850--
AvocatoBotUC6443mar 29, 20121827jul 07, 20121727--
GerakibotUC7324mai 24, 20121771mar 06, 20131485--
RedBotUC8170abr 22, 20121803ago 21, 20121682--
Makecat-botUC9149nov 01, 20121610mar 03, 20131488--
LegobotUC10106mar 11, 20131480abr 02, 20131458--
CommonsDelinkerUC1199abr 26, 20112165mar 05, 201725--
Idioma-botUC1296mar 27, 20121829mar 04, 20131487--
Justincheng12345-botUC1389jun 25, 20121739jan 10, 20131540--
MBHbotUC1467mar 11, 2015750mar 11, 2015750--
EscarbotUC1565abr 03, 20121822set 07, 2016204--
YFdyh-botUC1663jul 01, 20121733fev 18, 20131501--
LaaknorBotUC1760mai 22, 20121773mar 05, 20131486--
JhsBotUC1855mar 28, 20121828jul 08, 20121726--
VolkovBotUC1947abr 28, 20121797fev 27, 20131492--
KamikazeBotUC2045mar 29, 20121827jan 24, 20131526--
JAnDbotUC2141mar 29, 20121827jul 02, 20131367--
AvicBotUC2240jun 01, 20121763dez 09, 20121572--
CarsracBotUC2335mar 31, 20121825fev 12, 20131507--
HiW-BotUC2429abr 07, 20121818out 18, 20121624--
VagobotUC2522mar 29, 20121827abr 30, 20121795--
SantoshBotUC2622out 21, 20121621jan 31, 20131519--
SynthebotUC2721set 20, 20121652jan 25, 20131525--
タチコマ robotUC2813dez 05, 20111942out 21, 20121621--
PixelBotUC2913jul 20, 20121714mar 06, 20131485--
JotterbotUC3012jan 15, 20131535jan 18, 20131532--
Crochet.david.botUC316mai 07, 20083249mai 07, 20083249--
RobbotUC326mai 07, 20121788jan 02, 20131548--
CocuBotUC335ago 26, 20121677dez 15, 20121566--
OctraBotUC345mai 12, 20141053jan 30, 2015790--
NjardarBotUC354ago 28, 20121675ago 31, 20121672--
YiFeiBotUC363ago 05, 2015603ago 05, 2015603--
SassoBotUC372mai 29, 20121766jan 07, 20131543--
ObersachsebotUC382nov 24, 20121587jan 08, 20131542--
DragonBotUC392jan 13, 20131537jan 14, 20131536--
MalarzBOTUC401ago 18, 20121685ago 18, 20121685--
GhalyBotUC411jan 18, 20131532jan 18, 20131532--
SAMI.BotUC421fev 05, 20131514fev 05, 20131514--
MastiBotUC431mar 01, 20131490mar 01, 20131490--


Artigos que contêm pelo menos uma ligação interna e .. caracteres de texto legível, não contando códigos wiki e html,
ligações ocultas, etc.; títulos também não contam  (excluindo páginas de redirecionamento)

 < 32 ch< 64 ch< 128 ch< 256 ch< 512 ch< 1 k ch< 2 k ch< 4 k ch< 8 k ch< 16 k ch< 32 k ch< 64 k ch


Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.

categorizados 1
mar 20175,0 k379123111231,5 k 1,5 k       731
fev 20174,9 k37912191231,4 k 1,3 k       711
jan 20173,9 k37712191231,4 k 1,2 k       711
dez 20163,8 k37712191231,4 k 1,2 k       711
nov 20163,6 k37612191231,4 k 1,1 k       711
out 20163,5 k37510391211,4 k 1,1 k       711
set 20163,4 k3701029901,4 k 1,1 k       711
ago 20163,4 k3681019851,4 k 1,1 k       711
jul 20163,4 k3671019851,4 k 1,1 k       711
jun 20163,4 k3661008851,4 k 1,1 k       7 1
mai 20163,4 k3661008851,4 k 1,1 k       7 1
abr 20163,4 k3651008851,4 k 1,1 k       7 1
mar 20163,3 k3601008851,4 k 1,1 k       7 1
fev 20163,3 k360998851,4 k 1,1 k       7 1
jan 20163,3 k359998851,4 k 1,1 k       7 1
dez 20153,3 k357978851,4 k 1,1 k       7 1
nov 20153,3 k353968851,4 k 1,1 k       7 1
out 20153,3 k352948851,4 k 1,1 k       7 1
set 20153,3 k351948851,4 k 1,1 k       7 1
ago 20153,2 k349938851,3 k 1,1 k       7 1
jul 20153,2 k349928821,3 k 1,1 k       7 1
jun 20153,1 k348928821,3 k 1,1 k       7 1
mai 20153,0 k347928821,3 k 1,1 k       7 1
abr 20152,8 k344908821,3 k 1,0 k       7 1
mar 20152,7 k344878821,2 k 1,0 k       7 1
fev 20152,7 k341848811,2 k 1,0 k       7 1
jan 20152,7 k337848811,2 k 1,0 k       7 1
dez 20142,6 k331828811,2 k 999       7 1
nov 20142,6 k328818811,2 k 998       7 1
out 20142,6 k325808811,2 k 996       7 1
set 20142,6 k324788811,2 k 985       7 1
ago 20142,6 k319778781,2 k 985       7 1
jul 20142,5 k314768781,2 k 980       7 1
jun 20142,5 k313758781,1 k 978       7 1
mai 20142,5 k313748771,1 k 971       7 1
abr 20142,4 k309718751,1 k 964       7 1
mar 20142,4 k307698751,1 k 963       7 1
fev 20142,4 k304688751,1 k 961      537 1
jan 20142,4 k299678751,1 k 958      2107 1
dez 20132,4 k295658751,1 k 954      1137 1
nov 20132,4 k295648751,1 k 943      1387 1
out 20132,3 k288638751,1 k 936      4447 1
set 20132,3 k284627751,1 k 918      5516 1
ago 20132,2 k270587751,1 k 898      8766 1
jul 20132,0 k266537711,0 k 840      1356 1
jun 20132,0 k264527691,0 k 823      6016 1
mai 20131,9 k26050364989 766      3772 1
abr 20131,8 k25449364980 751      5862 1
mar 20131,8 k24548363943 723      4382 1
fev 20131,8 k22945363931 708      3882 1
jan 20131,7 k21843356916 682      9242 1
dez 20121,6 k21341356884 657      5762 1
nov 20121,5 k20139356854 638      5052 1
out 20121,4 k18937155809 633      644  1
set 20121,2 k18535153784 615      409  1
ago 20121,2 k17734148719 543      452  1
jul 20121,1 k16929 41670 525      646   
jun 20121,1 k15928 38616 489      1073   
mai 201296413919 36543 418      1592   
abr 201284812712 24291 251      2538   
mar 2012650613  134 89      1918   
fev 2012617    97 68      208   
jan 2012610    95 68      222   
dez 2011606    95 67      266   
nov 2011577    88 61      427   
out 2011541    86 49      144   
set 2011534    83 45      745   
ago 2011412    77 28      1085   
jul 2011231    66 15      351   
jun 2011189    47 12      1134   
mai 2011119    11 7      360   
abr 201184    10 6      120   
mar 201166    10 3      114   
fev 201146    10 3      3   
jan 201145    10 3          
dez 201045    10 3      73   
nov 201041    10 3          
out 201041    10 3      25   
set 201038    6 3      27   
ago 201019    6 3      57   
jul 20106    6 3          
jun 20106    6 3          
mai 20106    6 3          
abr 20106    6 3          
mar 20106    5 3          
fev 20106    5 3          
jan 20106    5 3          
dez 20096    5 3          
nov 20096    5 3          
out 20096    5 3          
set 20096    5 3          
ago 20096    5 3          
jul 20096    5 3      1   
jun 20096    5 3          
mai 20096    5 3          
abr 20096    5 3          
mar 20096    5 3          
fev 20096    5 3          
jan 20096    5 3          
dez 20086    5 3      9   
nov 20086    2            
out 20086    2            
set 20086    2            
ago 20086    2            
jul 20086    2            
jun 20086    2            
mai 20086    2            
abr 20086    2            
mar 20086    2            
fev 20084    1            
jan 20084    1            
dez 20074    1            
nov 20071    1            
out 20071    1            


Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons



For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

out 2007: 1 2 Кьилин ччин

nov 2007: 1 2 Кьилин ччин

dez 2007: 1 2 Кьилин ччин

jan 2008: 1 1 Кьилин ччин

mar 2008: 1 2 Википедия , 2 1 Кьилин ччин

abr 2008: 1 1 Кьилин ччин

nov 2008: 1 1 Кьилин ччин

dez 2008: 1 1 Кьилин ччин

jul 2009: 1 1 Кьилин ччин

ago 2010: 1 3 Урусат , 2 3 Кьвевар , 3 3 Дагъустан , 4 2 Кьилин ччин , 5 2 Футбол

set 2010: 1 2 Кьилин ччин , 2 2 Лезги кхьинар , 3 2 Андорра

out 2010: 1 2 Шри-Ланка , 2 2 Африка

dez 2010: 1 3 Баку , 2 2 Шри-Ланка , 3 2 ЦӀийи Зеландия , 4 2 Футбол , 5 2 Талибан , 6 2 СтIал Сулейман , 7 2 Урусат , 8 2 Пакистан , 9 2 Лезгистан , 10 2 Лезги

fev 2011: 1 1 Кьилин ччин

mar 2011: 1 3 Эрменистан , 2 3 Азербайжан , 3 2 Чувудар , 4 2 Париж , 5 2 Нил , 6 2 Гьайванар , 7 2 Лезгияр , 8 2 Гибралтар , 9 1 НуькI

abr 2011: 1 4 Кьилин ччин , 2 4 КцӀар , 3 3 Къазакъстан , 4 3 Ирландия , 5 2 Шри-Ланка , 6 2 Лезгистан , 7 2 Лезги чIал , 8 2 Лам

mai 2011: 1 5 ЧIехибритания , 2 5 Азия , 3 4 Лезгистан , 4 3 Советрин Социализмдин Республикайрин ГалкӀ , 5 2 Эрменистан , 6 2 Шри-Ланка , 7 2 Чувуд чӀал , 8 2 Китай чIал , 9 2 Туьрк чIал , 10 2 ТӀаратӀ , 11 2 Кьиблепатан Америка , 12 2 Къавкъаз , 13 1 Кьилин ччин

jun 2011: 1 4 Океания , 2 3 Эрменистан , 3 3 Крокодилар , 4 2 Кьилин ччин , 5 2 Юпитер , 6 2 Китайдин Халкьдин Республика , 7 2 Уганда , 8 2 Цифраяр , 9 2 Немец чIал , 10 2 Макао , 11 2 Лезгияр , 12 2 Лезгистан , 13 2 Къарагъанда , 14 2 Канада , 15 2 Кьиблепатан Америка , 16 1 НуькI

jul 2011: 1 4 Германия , 2 3 Европадин гьукуматар , 3 3 Греция , 4 2 Гьил , 5 2 Саха чӀал , 6 2 Саха Республика , 7 2 Мегьарамдхуьр , 8 2 Лезгистан , 9 2 Къазакъстан , 10 1 Кьилин ччин

ago 2011: 1 3 НуькI , 2 3 Кьилин ччин , 3 3 Чурчул , 4 3 Хуьшрекандиз ухшар маймун , 5 3 Супик чӀал , 6 3 Саваннадин фил , 7 3 Наукандин юпик чӀал , 8 3 Мирикина , 9 3 Латин чIал , 10 3 Кьвевар , 11 3 Ибериядин сувайрин чурчул , 12 3 ГъвечӀи панда , 13 3 Гну , 14 3 Арабрин Садхьанвай Эмиратар , 15 3 Атна чӀал , 16 3 Аляскадин юпик чӀал , 17 3 Алеут чӀал , 18 2 Яру бубал , 19 2 Юпик чӀалар , 20 2 Эяк чӀал , 21 2 Эскимос-алеут чӀалар , 22 2 Экуь вили антилопа , 23 2 Чувуд чӀал , 24 2 Чевакдин чупик чӀал , 25 2 Чапла Канададин инуит чӀал

set 2011: 1 4 Турциядин лезги хуьрер , 2 3 Кьилин ччин , 3 3 Шергир , 4 3 Чинеруг , 5 3 Химия , 6 3 Туьтуьнуькl , 7 3 Хундуз , 8 3 Ортажа , 9 3 Лезги кхьинар , 10 3 Къванцин цуцӀул , 11 3 Йайлакёй , 12 3 ЦуцӀул-балугъчи , 13 3 Дагъустан , 14 3 Гьатем ага ЧӀакарви , 15 3 Гиенадал ухшар кицӀ , 16 3 География , 17 3 Ахцегь , 18 2 НуькI , 19 2 Яру жанавур , 20 2 Юсуф ал-Лезги , 21 2 МичIи куьрен кард , 22 2 Шахин , 23 2 Шангъар , 24 2 Чалагъан , 25 2 ЧIехибритания

out 2011: 1 3 Кьилин ччин , 2 3 Топонимика , 3 3 Сатурн , 4 2 Чил (планета) , 5 2 Гьил , 6 2 Хашпара дин , 7 2 Футбол , 8 2 Теннис , 9 2 Урусат , 10 2 Мегьарамдхуьруьн район

nov 2011: 1 4 Рутул район , 2 4 Лезгистан , 3 3 Кьилин ччин , 4 3 Яру жанавур , 5 3 Финн чӀал , 6 3 Гъуьгъвезар , 7 3 Ахцегь , 8 3 Антилопа , 9 2 Цуругъ , 10 2 Гьил , 11 2 Хуьшрекандиз ухшар маймун , 12 2 Хуьшрекан хьтин маймун , 13 2 Усугъ вацI , 14 2 Урус чIал , 15 2 Урбис , 16 2 Туьрк чIал , 17 2 Топонимика , 18 2 Смугъулар (Ахцегь район) , 19 2 Ситатунга , 20 2 СикӀер , 21 2 Планета , 22 2 Пирал , 23 2 Осло , 24 2 Орхидея , 25 2 Муьгъверган

dez 2011: 1 3 Франция , 2 3 Къуйсун , 3 3 Имарат Къавкъаз , 4 2 Кьилин ччин , 5 2 Туьркменистан , 6 2 Суварин цӀиргъ , 7 2 Кеферпатан МуркIарин океан , 8 2 Монако , 9 2 Марсельеза , 10 2 Люксембург , 11 2 Индиядин океан , 12 1 НуькI

jan 2012: 1 4 Тай чӀал , 2 3 Мукьтадир , 3 2 Кьилин ччин , 4 2 Усугъчай , 5 2 Советрин Социализмдин Республикайрин ГалкӀ

fev 2012: 1 4 Кьилин ччин , 2 2 Мукьтадир , 3 2 Луткун , 4 2 Википедия

mar 2012: 1 13 Кьилин ччин , 2 10 Лезгияр , 3 8 Азербайжан , 4 7 Лезгистан , 5 7 Къуба , 6 7 Ингъушар , 7 7 Баку , 8 6 Урусат , 9 6 Къазакъстан , 10 6 Ахцегь район , 11 6 Ахцегь , 12 5 Эрменистан , 13 5 Европадин гьукуматар , 14 5 Советрин Социализмдин Республикайрин ГалкӀ , 15 5 ТӀаратӀ , 16 5 Лезгийрин тарих , 17 5 Кьиблепатан Америка , 18 5 Ингилис чIал , 19 5 Аминова Заира Фазилан руш , 20 5 Дагъустан , 21 5 Билиж (посёлок) , 22 5 Антарктида , 23 5 Али Султан , 24 4 Табасаранар , 25 4 Урусар

abr 2012: 1 6 Кьилин ччин , 2 6 Лезгияр , 3 5 Христофор Колумб , 4 5 Дуьньядин кьведлагьай дяве , 5 5 Польша , 6 5 Агъул район , 7 5 Рейн , 8 5 Литва , 9 5 Сауди Арабистан , 10 5 Пакистан , 11 5 Лезги чIал , 12 5 Азербайжан , 13 4 Исламабад , 14 4 Философия , 15 4 Боливия , 16 4 Пакистандин пайдах , 17 4 Гьажиев Мегьамед Мегьамедан хва , 18 4 Италия , 19 4 Лезги Википедия , 20 4 Сара Бернар , 21 4 ЦӀийи гафарин сиягь , 22 4 Грекрин алфавит , 23 4 Тегьран , 24 4 Урусар , 25 4 Кореядин Халкьдинни-Демократиядин Республика

mai 2012: 1 5 Португалия , 2 5 Мисри , 3 5 Ахцегь , 4 4 Каир , 5 4 Puzzling World , 6 4 Владимир Владимирович Путин , 7 4 Falco vespertinus , 8 4 I Наполеон Бонапарт , 9 4 Трпиня , 10 4 Кьилин ччин , 11 4 Италия , 12 4 Дунай , 13 4 Гъед (гьайванар) , 14 3 Абдул Мажид , 15 3 Португал чIал , 16 3 Колибри , 17 3 Дуэро , 18 3 Португалиядин шегьерар , 19 3 Альберт Эйнштейн , 20 3 Кьибле-Африкадин Республика , 21 3 Улуб , 22 3 Мастурбация , 23 3 Яру улуб , 24 3 Астероид , 25 3 Динозавраяр

jun 2012: 1 7 Мугьаммад , 2 6 Византий империя , 3 5 Исаак Ньютон , 4 5 Аллагьдин 99 тӀвар , 5 5 Алюминий , 6 5 Урусат , 7 4 Аврил Лавин , 8 4 Гелхен , 9 4 Химиядин элементрин девирдин система , 10 4 Шахматар , 11 4 Византиядин императоррин сиягь , 12 4 Республика Корея , 13 4 The Macallan , 14 4 Суван Къарабагъ , 15 4 Китайдин Халкьдин Республика , 16 4 Финн чӀал , 17 4 Ахцегь , 18 4 Айдагьо , 19 3 Брест , 20 3 Вольфганг Амадеус Моцарт , 21 3 Математика , 22 3 Бубуяр , 23 3 Сятдин чIул , 24 3 Гьукуматдин идара авунин тегьер , 25 3 Манидин конкурс Евровидение 2012

jul 2012: 1 4 Санкт-Петербург , 2 4 ЧӀехи Француз инкъилаб , 3 4 Рим империя , 4 4 Куба , 5 3 Дуьньядин чими хьун , 6 3 Эсперанто , 7 3 Волга , 8 3 Эрнесто Че Гевара , 9 3 Яд , 10 3 Автомобилдин код , 11 3 Математика , 12 3 Чил (планета) , 13 3 Сев , 14 2 Лелевар , 15 2 Постессив аватвал , 16 2 Археяр , 17 2 Биология , 18 2 Дезоксирибонуклеин цуруцӀ , 19 2 Велс , 20 2 Садхьанвай миллетрин тешкилат , 21 2 Че Гевара , 22 2 Расим Загьирбег хва Тагирбеков , 23 2 Рахазвайбурун кьадардиз килигна чӀаларин сиягь , 24 2 Автомобил код , 25 2 Почтунин индекс

ago 2012: 1 7 Лезгистан , 2 5 Олимпиядин къугъунар , 3 4 Рим , 4 3 Сочи , 5 3 Биология , 6 3 Грекрин алфавит , 7 2 Экваториал Гвинея , 8 2 Чарльз Дарвин , 9 2 Искандер Македонжув , 10 2 The Beatles , 11 2 Иосиф Виссарионович Сталин , 12 2 Сингапур , 13 2 Гуржи чIал , 14 2 Хунзах район , 15 2 2012 Гатун Олимпия къугъунар , 16 2 Велс , 17 2 Эсперанто , 18 2 Куба , 19 2 Португалия , 20 2 Тегьран , 21 2 Урус чIал , 22 2 Тувалу , 23 2 Лас океан , 24 1 Никlи

set 2012: 1 3 Юлий Цезарь , 2 3 Иерусалим , 3 3 Таиланд , 4 3 Жозе Мария Эса ди Кейруш , 5 3 Ботлих , 6 3 Акуша , 7 3 Алпан , 8 3 Хошимин , 9 3 Кьулан вацI , 10 3 Париж , 11 2 Физика , 12 2 Дегь Мисри , 13 2 ПIатIар , 14 2 Сарфунъял , 15 2 Экология , 16 2 Вунгтау , 17 2 Нячанг , 18 2 Америка , 19 2 Кертагъ Давдакь , 20 2 С , 21 2 Слово (газет, Португалия) , 22 2 Эйсебио , 23 1 Исламабад

out 2012: 1 4 Мадрид , 2 4 Вена , 3 3 Хуьруьн майишат , 4 3 Кефердинни рагъакIидай Англия , 5 3 Ливерпульдин агломерация , 6 3 Неаполь , 7 3 Турин , 8 3 ЦIуру Худат (КцIар район) , 9 3 Хурай (КцIар район) , 10 3 Немец чIал , 11 2 Мирземугьаммадхъишлах , 12 2 Эрдэнэт , 13 2 Монгол чӀал , 14 2 Улан-Батор , 15 2 Чархы , 16 2 Жанахир , 17 2 ЧIал , 18 2 Карл Маркс , 19 2 Салвадор Дали , 20 2 Акбар ЧӀехи , 21 2 Гаф , 22 2 Slayer , 23 2 Пекин , 24 2 Къусарчай (Хъачмаз) , 25 2 Гуьнешли

nov 2012: 1 4 Компьютер , 2 4 Садвал , 3 3 Чепер , 4 3 Уран (планета) , 5 3 Каракорум (шегьер) , 6 3 Куритиба , 7 3 Гилияр , 8 3 Водород , 9 3 Грар , 10 3 Магьачкъала , 11 3 Дербент район , 12 2 Людвиг ван Бетховен , 13 2 Ӄ , 14 2 Дагъустандин ЦIаяр , 15 2 Дагъустан Республикадин шегьерар , 16 2 Ыгыл , 17 2 1930 йис , 18 2 Мичегь , 19 2 Калук , 20 2 Приморск (Дагъустан) , 21 2 Венесуэла , 22 2 КьепIир Къазмаяр , 23 2 Хуьлуьхъ , 24 2 ПIатIар , 25 2 Рим

dez 2012: 1 3 Кьулан СтIал , 2 3 Къайи дяве , 3 3 Вепс чӀал , 4 3 Пудлагьай рейх , 5 3 Велс , 6 3 Астероид , 7 3 Ле Корбюзье , 8 2 Камарван , 9 2 Пиперхуьр , 10 2 КIахцугъ , 11 2 Герейханован совхоздин 2-лагьай отделение , 12 2 Зари , 13 2 Алкьвадар , 14 2 Усур , 15 2 Хашпересрин финар , 16 2 Вьетнамдин дяве , 17 2 1930 йис , 18 2 Сарфунъял , 19 2 Усугъчай , 20 2 Туьрквер-месхетияр , 21 2 ТӀиб , 22 2 Марс , 23 2 Кьасумхуьр , 24 1 Пак тир Рим империя

jan 2013: 1 3 Индуизм , 2 3 Лезгияр , 3 2 Вашингтон (кьилин шегьер) , 4 2 Ахвах район , 5 2 Акуша район , 6 2 1812 йис , 7 2 1866 йис , 8 2 1878 йис , 9 2 1969 йис , 10 2 Вини СтIал , 11 2 , 12 2 Пак тир Рим империя , 13 2 Компьютер , 14 2 Велиханов Къудрат Кибечханан хва , 15 2 Волга , 16 2 Мугьаммад , 17 2 ЧӀулав тӀеквен , 18 2 Сампи , 19 2 Промышленность , 20 2 2012 йис , 21 2 Рейн , 22 2 Пси (гьарф) , 23 2 Фи , 24 2 Ипсилон , 25 2 Тау

fev 2013: 1 2 Фридрих Ницше , 2 2 Бум , 3 2 Къарасу , 4 2 Къарадейн , 5 2 Кичик ПIирали , 6 2 Курд (Кьвепеле) , 7 2 Кветуьклуь , 8 2 Имамлы , 9 2 Зергерли , 10 2 Зараган , 11 2 Залам , 12 2 Жигъателли , 13 2 Жорлу , 14 2 Енгиже

mar 2013: 1 3 1949 йис , 2 3 1969 йис , 3 3 Турция , 4 3 Айдагьо , 5 3 Абхазия , 6 2 Дегь Греция , 7 2 Валенсия (мана) , 8 2 Илим , 9 2 АСШ-дин граждан дяве , 10 2 Гарринча , 11 2 ЧӀулав хъалхъам , 12 2 Элвис Пресли , 13 2 Байуба , 14 2 Дунчэн (Пекин) , 15 2 Садхьанвай миллетрин тешкилат , 16 2 Каир , 17 2 ЧӀулав тӀеквен , 18 2 Лекь (анатомия) , 19 2 Яру жанавур , 20 2 Февраль , 21 2 Китайдин Халкьдин Республика , 22 2 Июль , 23 2 Лас океан , 24 2 Август , 25 2 Некхъвадайбур

abr 2013: 1 5 Амстердам , 2 3 Гонконг , 3 3 Октавиан Август , 4 3 Плазма , 5 3 Ракь , 6 3 Рио-де-Жанейро , 7 3 Метр , 8 3 Буэнос-Айрес , 9 3 Иерусалим , 10 3 Дагъустан , 11 2 Умар Хайям , 12 2 Сувар (ансамбль) , 13 2 Керимова Седакъет Къайинбеган руш , 14 2 Метаболизм , 15 2 Кизилюрт , 16 2 Лезгинцев Михаил Васильевич , 17 2 Атом , 18 2 Гьуьсейнов Абдусалам Абдулкериман хва , 19 2 Барселона (мана) , 20 2 Агъдам район , 21 2 Нежефхуьр , 22 2 Ахцегьрин гьамамар , 23 2 Грар , 24 2 Юсуф ал-Лезги , 25 2 Эфиопидин чъакъал

mai 2013: 1 3 Франция , 2 2 Москва вилаят , 3 2 Альгеро , 4 2 Алпан (манаяр) , 5 2 Алпан (астрономия)

jun 2013: 1 3 Марко Поло , 2 3 Демократия , 3 3 Фу , 4 2 Мидгьед Ширинбегов , 5 2 Иисусан гьакъикъи клиса , 6 2 Александр Ильич Рыбников , 7 2 Кьавал , 8 2 Агъул чIал , 9 2 Хвереж (Кьурагь район) , 10 2 Усугъ , 11 2 Вулкан (геология) , 12 2 Абилов Магьмуд Абдулрзадин хва , 13 2 Митаги хуьруьнсовет , 14 2 Хазар хуьруьнсовет , 15 1 Кьилерин хуьруьнсовет

jul 2013: 1 2 Хъачмаз район , 2 1 Зигмунд Фрейд

ago 2013: 1 3 Католицизм , 2 3 Чингисхан , 3 3 Винстон Черчилль , 4 2 Урусатдин тӀаратӀ , 5 2 Табасаран чIал , 6 2 Дагъустандин тIаратI , 7 2 Гоа (Дагъустан) , 8 2 Мыгра (Дагъустан) , 9 2 Кина (Дагъустан) , 10 2 Британиядин империя , 11 2 Вини Катрух , 12 2 Автомобиль , 13 2 Марко Поло , 14 2 Агъул чIал , 15 2 ЧIал , 16 2 Вини ЦIийихуьр , 17 2 Христофор Колумб , 18 2 ТӀаратӀ , 19 2 Лезги чIал , 20 2 Кьвевар , 21 1 Будугъ чIал

set 2013: 1 3 Авраам Линкольн , 2 3 КъирицI чIал , 3 2 Чилин зурзунар , 4 2 Хинелугъ чIал , 5 2 Нидерландар , 6 2 Китайдин Халкьдин Республика , 7 2 Саха Республика , 8 1 ЦIуру Киркар

out 2013: 1 3 Лезгияр , 2 2 Холокост , 3 2 Хамаматюрт , 4 2 Адиль-Янгиюрт , 5 2 Бабаюрт , 6 2 Чилин зурзунар , 7 2 Табасаранар , 8 1 ЧӀутрацуьк

nov 2013: 1 3 Аристотель , 2 3 Бактерияр , 3 2 Ингушетия , 4 2 UTC+4 , 5 2 Терек вацI , 6 2 Хуьр , 7 2 Шегьер , 8 2 АхцегьвацӀ , 9 2 Мустафа Камал Ататуьрк , 10 1 Муниципал район

dez 2013: 1 3 КуртӀухъан , 2 3 Атлантик океан , 3 3 Харахуба , 4 2 Пепеяр , 5 2 ЦIай (азар) , 6 1 Тарих

jan 2014: 1 3 Мирослава Вавринец , 2 3 Роджер Федерер , 3 3 Валентина Васильевна Толкунова , 4 3 Кьвепеле , 5 2 Затор , 6 2 Бойнице , 7 2 Куколивка

fev 2014: 1 3 Шахматар , 2 2 Сан-Паулу , 3 2 Гуржистан , 4 2 Абхазия , 5 1 Славян чIалар

mar 2014: 1 3 Поляк чIал , 2 3 Словак чIал , 3 3 Чех чIал , 4 2 Кашуб чIал , 5 1 НАТО

abr 2014: 1 3 Алискерово (посёлок) , 2 2 Тито Виланова , 3 2 Баламирзоев Абдул Гьажибаладин хва , 4 2 Поречье хуьруьнсовет (Тула вилаят) , 5 2 Дубна (Тула вилаят) , 6 2 Фотосинтез , 7 1 Синусоида

mai 2014: 1 3 Грек чӀал , 2 3 Сидней , 3 3 Вичи-вич кьин , 4 3 Сеул , 5 3 Салигьов Эсед Бабастанан хва , 6 3 Верем , 7 2 Metallica , 8 2 Пурни , 9 2 Мумбаи , 10 2 ТӀач , 11 2 Бебелук , 12 2 2014 ХъуьтӀуьн Олимпия къугъунар , 13 2 ЧӀулавкьал , 14 2 ЦӀегьрекарч , 15 2 Словак чIал , 16 1 Лезги литература

jun 2014: 1 2 Фернан Магеллан , 2 2 Цур , 3 2 Геология , 4 2 Етим Эмин , 5 2 Храхуба , 6 2 Гуржи чIал , 7 2 Далдам , 8 1 Инд океан

jul 2014: 1 2 Джяравица , 2 2 Европадин таж , 3 2 Квеста , 4 2 Париж бассейн , 5 1 Ботсвана

ago 2014: 1 3 Робин Вилиамс , 2 2 Джульярд мектеб , 3 2 ЦIуьлуьк , 4 2 Хъутур-Куьредин наибвал , 5 1 Аль-Муайдар

set 2014: 1 3 Ио , 2 2 Вилиам Хьайд Волластон , 3 2 Владимир Владимирович Путин , 4 2 Юрий Алексеевич Гагарин , 5 1 Черногориядин шегьерар

out 2014: 1 2 Чай , 2 2 Балтик гьуьлуьн пешекарвилин галкIрин чил , 3 2 Латвия , 4 2 Эстония , 5 2 Братислава , 6 2 Прагьа , 7 1 Кения

nov 2014: 1 2 Анархизм , 2 2 Аргентина , 3 2 Нью-Йорк , 4 1 Амадора

dez 2014: 1 2 Дакка , 2 2 Палестина , 3 1 Къеди

jan 2015: 1 2 Сокольническая цӀар , 2 2 ТупӀалдин цӀар (Москва) , 3 1 Эседуллагь Эмирагъайрин

fev 2015: 1 2 Абдусамад Гьамидов , 2 2 Гьарйяна , 3 2 Никола Тесла , 4 2 Халилов Юсиф Мевлуьдан хва , 5 2 Экономика , 6 2 Чингисхан , 7 1 Кьилин мефтӀ

mar 2015: 1 3 Пудлагьай рейх , 2 2 Украинадин вилаятар: абурун ибарат , 3 2 Украинадин административ паюн , 4 2 I Фарнаваз , 5 2 Асалийрин Асали Мугьаммадалидин хва , 6 2 Братислава , 7 2 ЧIулав гьуьл , 8 2 Украина , 9 2 Уругвай , 10 2 Пакистан , 11 2 Немец чIал , 12 1 Фарнаваз I

abr 2015: 1 3 Грац , 2 3 Лас океан , 3 2 Линц , 4 2 Альфредо Ди Стефано , 5 2 Орёл вилаят , 6 2 Орёл (шегьер) , 7 2 Республика Крым , 8 2 Амстердам , 9 2 Мадрид , 10 2 Лионель Месси , 11 2 Испания , 12 2 Урусат , 13 2 Каспи гьуьл

mai 2015: 1 3 Ингилис Премьер-лига , 2 2 Бути (Чечня) , 3 2 Сократес , 4 2 Церхимахи , 5 2 Линц , 6 2 Кочубей (Дагъустан) , 7 2 Танк , 8 2 Нилтон Сантос , 9 2 Испания , 10 2 Науру , 11 2 Кьасумхуьр , 12 2 Истамбул , 13 2 Ингилис чIал , 14 2 Америкадин Садхьанвай Штатар , 15 1 Македония Республикадин шегьерар

jun 2015: 1 2 Инсбрук , 2 2 Ямал-Ненец АО-дин шегьерар , 3 2 Валерий Яковлевич Леонтьев , 4 2 Ханты-Манси АО-дин шегьерар , 5 2 Карелия Республикадин шегьерар , 6 2 Урусатдин шегьеррин сиягь , 7 2 Икрам Сабиран хва Алискеррин , 8 1 СССГ-дин илимрин академия

jul 2015: 1 3 Инсбрук , 2 3 Германиядин империя , 3 2 Александр Сергеевич Пушкин , 4 2 Стивен Джеррард , 5 2 Гьаштархан вилаятдин шегьерар , 6 2 Исаев Радик Велединан хва , 7 2 Камчатка крайдин шегьерар , 8 2 Грац , 9 2 Воскресенское (Дубна район) , 10 1 Абдул Мукьтедир Айдинбекан хва

ago 2015: 1 3 Дубна (Тула вилаят) , 2 2 Къарачай-Черкесия Республикадин шегьерар , 3 2 Лезгияр , 4 2 Ислам , 5 2 Амазун , 6 1 СпекI

set 2015: 1 3 Хъачмаз район , 2 3 Лезгияр , 3 2 Таджикистан , 4 2 Молдова , 5 2 Нигерия , 6 2 Мисри , 7 2 Уганда , 8 2 Багьрейн , 9 1 Ассаб

out 2015: 1 4 Азербайжан , 2 2 Иан Раш , 3 2 Азербайжандин гимн , 4 2 Азербайжандин тIаратI , 5 2 Гимры , 6 2 Сербия , 7 2 Гьажи Дауд , 8 1 Грем Сунесс

nov 2015: 1 2 Deep Purple , 2 2 Кьил чIулав питунар , 3 2 Мугьаммад ЧIехибубадин хва Куругълийрин , 4 2 Кулур , 5 2 Дакка , 6 2 Мучугъ , 7 2 Суварин цӀиргъ

dez 2015: 1 2 Гьамидуллагьрин Роман Играмеддинан хва

jan 2016: 1 3 Бильгади , 2 2 Кариб гьуьл , 3 2 Мекка , 4 2 Урусатдин шегьерар , 5 2 Вишйисан дяве , 6 1 Якут чIал

fev 2016: 1 3 Байкал , 2 2 Гьольштайн , 3 2 Кефердинни-рагъакIидай патан федерал округ , 4 1 Лев Николаевич Толстой

mar 2016: 1 4 Йугьан Круифф , 2 2 Астрахань , 3 2 Магадан , 4 1 Сирхияр

abr 2016: 1 2 Яргун , 2 2 Табасаранар , 3 1 Мугьажир

mai 2016: 1 2 Гьамзатов Расул Гьамзатан хва , 2 2 Адиль-Янгиюрт , 3 2 Ашар , 4 1 Ергуьжар

jun 2016: 1 3 Ниж , 2 2 Хучни , 3 2 Имам Шамил , 4 2 Яргъал-РагъэкъечӀдай патан федерал округ , 5 2 Урусатдин шегьеррин сиягь , 6 1 Вачи

jul 2016: 1 2 Эмирали ТIигьиржалви , 2 2 Эквадор , 3 2 Сунияр , 4 2 Убыхар , 5 2 Александр Сергеевич Пушкин , 6 2 Къайтагъ район , 7 1 Мирза Али

ago 2016: 1 2 Хинелугъ чIал , 2 1 Эликар

set 2016: 1 3 Азербайжанар , 2 3 Хъачмаз , 3 3 Эрменистан , 4 2 Лезги кьуьл , 5 2 Галисий чӀал , 6 2 Республика Коми , 7 2 Агата Кристи , 8 2 Новосибирск , 9 2 Шекердин диабет , 10 2 Словакиядин шегьерар

out 2016: 1 4 Кишинёв , 2 4 Ингилисар , 3 4 Октябрдин революция , 4 4 Уфа , 5 3 Африкаанс чӀал , 6 3 Кипрдин туьрквер , 7 3 Банска-Бистрица край , 8 3 Бардеёв , 9 3 Фёдор Михайлович Достоевский , 10 3 Агьмедрин Фарид Загьидинан хва , 11 2 II-й Мануэл , 12 2 1941 йис , 13 2 Керимрин Керим Абдулхаликьан хва , 14 2 Усманрин Империя , 15 2 Гьарф , 16 1 Мануэл II

nov 2016: 1 3 Калмыкия , 2 3 16 ноябрь , 3 2 Ставропольдин край , 4 2 19 ноябрь , 5 2 Кеферпатан Къавкъаздин федерал округ , 6 2 17 ноябрь , 7 2 Екатеринбург , 8 2 Эмиррин Валентин Аллагьяран хва , 9 1 ЧIехи Къавкъаз

dez 2016: 1 2 Дербентдин эмират , 2 2 Гьакимов Къурбан Халикан хва , 3 2 Къардашев Арбен Мегьединан хва , 4 2 Къафланов Зульфикъар Шихнесиран хва , 5 2 Эфендиева Муъминат , 6 2 Гьажимурадов Жамидин Гьажимурадан хва , 7 2 Абдурагьман Абдурагьманов , 8 2 Этанол , 9 2 Экуьнин зарбвал , 10 2 Ал-Хорезми , 11 2 Рухун Али , 12 2 Къуруш , 13 2 Фейзудин Нагъиев , 14 2 Миграгъ Мардали , 15 2 Миграгъ Къемер , 16 1 Намибия

jan 2017: 1 2 Сердар Амин , 2 2 Авар ханвал , 3 2 Анжи , 4 2 Аваран , 5 2 Дагъустан , 6 1 Эрменияр

fev 2017: 1 2 Роберто Баджо , 2 2 Румыния , 3 2 Вести Агула , 4 2 Ватандин чIехи дяве , 5 2 Полякар , 6 2 Украинар , 7 2 Магнитдин чуьл , 8 2 Украинадин вилаятар: абурун ибарат , 9 2 Керимов Сулейман Абусаидан хва , 10 2 Норвегия , 11 2 Миграгъ Къемер , 12 1 Фикрет Хидиров

mar 2017: 1 3 Валентина Владимировна Терешкова , 2 3 Дмитрий Иванович Менделеев , 3 2 Гьайратар , 4 2 Антон Павлович Чехов , 5 2 Ровно , 6 2 Агъа-Къартас Амираслан , 7 2 Муьгьуьддин Садикьан хва , 8 2 Мегьамед-Гъалиб эфенди , 9 2 Штулви Гьажи Мегьамед-эфенди , 10 2 Шейх Гьажи Рамазан , 11 2 Эрзихан , 12 2 Абдул Гьамид-эфенди , 13 2 Алкьвадар Абдуллагь эфенди , 14 2 Мирзе Жабраил , 15 2 ТIигьиржал Гьажи Амирали , 16 2 Ашукь Уьзден , 17 2 Шейх Жамалуддин , 18 2 Атлухан эфенди , 19 2 Шагьпазов Сейфудин Тегьмезбеган хва , 20 2 Рагьимова Асия , 21 2 Ибрагьимов Саид , 22 2 6 март , 23 2 Татар , 24 2 Лезги Агьмед , 25 2 Етим Эмин

Wikipedias are initially ordered by number of speakers of the language

Speakers: Number of speakers of a language is the estimated total of primary and secondary speakers, is in many cases a very rough estimation (based on the page on the English Wikipedia about that language)
Regions are parts of the world where the language is spoken in substantial amounts (compared to total number of speakers). Regions where a language gained presence only by a recent diaspora are generally not included.
Region codes: AF:Africa, AS:Asia, EU:Europe, NA:North America, OC:Oceania, SA:South America, W:World Wide, CL:Constructed Language

Estatísticas geradas em Segunda-feira, 24 de abril 2017 17:29

Dump file lezwiki-20170401-stub-meta-history.xml.gz (edits only), size 4.5 Mb as gz -> 32 Mb
Dump processed till Mar 31, 2017, on server stat1002, ready at Sun-09/04/2017-03:22 after 29 sec.

Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### =
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.