Estatísticas da Wikipédia marshallese
Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Articles per size range / Records per namespace / Most edited articles / Zeitgeist
 
Monthly counts & Quarterly rankings
 
DataWikipedistasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia		médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P____Q____R____S__
fev 20111   116 21,332418  14 kb66910340(3)  
jan 20111   116 21,332418  14 kb66910340(3)  
dez 20101   116 21,332418  14 kb66910340(3)  
nov 20101   116 21,332418  14 kb66910340(3)  
out 20101   116 21,332418  14 kb66910340(3)  
set 20101   116 21,332418  14 kb66910340(3)  
ago 20101   116 21,332418  14 kb66910340(3)  
jul 20101   116 21,332418  14 kb66910340(3)  
jun 20101   116 21,332418  14 kb66910340(3)  
mai 20101   116 21,332418  14 kb66910340(3)  
abr 20101   116 21,332418  14 kb66910340(3)  
mar 20101   116 21,332418  14 kb66910340(3)  
fev 20101   116 21,332418  14 kb66910340(3)  
jan 20101   116 21,332418  14 kb66910340(3)  
dez 20091   116 21,332418  14 kb66910340(3)  
nov 20091   116 21,332418  14 kb66910340(3)  
out 20091   116 21,332418  14 kb66910340(3)  
set 20091   116 21,332418  14 kb66910340(3)  
ago 20091   116 21,332418  14 kb66910340(3)  
jul 20091   116 21,332418  14 kb66910340(3)  
jun 20091   116 21,332418  14 kb66910340(3)  
mai 20091   116 21,332418  14 kb66910340(3)  
abr 20091   116 21,332418  14 kb66910340(3)  
mar 20091   116 21,332418  14 kb66910340(3)  
fev 20091   116 21,332418 114 kb66910340(3)  
jan 20091   126 19,431017  14 kb69210340(3)  
dez 20081   126 19,431017  14 kb69210340(3)  
nov 20081   126 19,431017  14 kb69210340(3)  
out 20081   126 19,431017  14 kb69210340(3)  
set 20081   126 19,431017  14 kb69210340(3)  
ago 20081   126 19,431017  14 kb69210340(3)  
jul 20081   126 19,431017  14 kb69210340(3)  
jun 20081   126 19,431017  14 kb69210340(3)  
mai 20081   126 19,431017 514 kb69210340(3)  
abr 20081   127 1935225 1817 kb78414465(3)5 
mar 20081   126 17,524317 815 kb52014457(3)5 
fev 20081   126 16,824317 1015 kb52014449(3)5 
jan 20081 1 126 1624017 1915 kb51214442(3)5 
dez 20071   105 17,325520 913 kb45314404(3)5 
nov 20071   105 16,425520 1213 kb45314398(3)5 
out 20071 3 95 16,928222 3811 kb45014338(2)5 
set 20071   74 16,330329 98,5 kb37714253(2)5 
ago 20071   74 1530329 48,4 kb37714251(1)5 
jul 20071   74 14,430329 128,3 kb37714247(1)5 
jun 20071   64 14,835433 88,4 kb39713244(1)5 
mai 20071   64 13,535433 58,2 kb39713242(1)5 
abr 20071   64 12,735433 48,0 kb39713238(1)5 
mar 20071   64 1235950 88,0 kb40213237(1)5 
fev 20071 1 64 10,735950 157,9 kb40213236(1)5 
jan 20071   54 9,840460 67,1 kb37613208( )5 
dez 20061   54 8,645460 17,2 kb40913180( )22 
nov 20061   54 8,445460 37,0 kb40913173( )22 
out 20061   54 7,845460  6,9 kb40913172( )22 
set 20061   54 7,845460 16,9 kb40913172( )22 
ago 20061   54 7,640360 26,3 kb37413172( )5 
jul 20061   43 934050 12,8 kb261917( )  
jun 20061   54 744960  5,4 kb41113125( )5 
mai 20061   54 744960 75,4 kb41113125( )5 
abr 20061   54 5,635540  3,6 kb34213125( )5 
mar 20061   54 5,635540 83,6 kb34213125( )5 
fev 20061   44 542625  3,5 kb33312125( )5 
jan 20061   44 542625  3,5 kb33312125( )5 
dez 20051   44 542625 23,5 kb33312125( )5 
nov 20051   44 4,542625 23,5 kb33312123( )5 
out 20051   33 5,339933  2,9 kb2383122( )5 
set 20051   33 5,339933 32,9 kb2383122( )5 
ago 20051   22 6,547450 12,4 kb1962107( )5 
jul 20051   22 651650  2,5 kb2062107( )7 
jun 20051   22 651650 72,5 kb2062107( )7 
mai 20051   11 5748100  2,1 kb129 107( )7 
abr 20051   11 5748100 12,1 kb129 107( )7 
mar 20051   11 4623100  2,0 kb112 107( )7 
fev 20051   11 4623100  2,0 kb112 107( )7 
jan 20051   11 4623100  2,0 kb112 107( )7 
dez 20041   11 4623100  2,0 kb112 107( )7 
nov 20041   11 4623100 22,0 kb112 107( )7 
out 20041   11 2445   1,8 kb77 107( )8 
set 20041   11 2445  11,8 kb77 107( )8 
ago 200411  11 1445  11,8 kb77 106( )9 
 totalnovosediçõescontagemnovos
por dia		médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
 WikipedistasArtigosBase de dadosLigações

Counts for image links are based on keyword(s) found in the message file for this language: (Image).
Note that image links based on default keyword 'Image' and/or 'File' have been missed. This will be repaired on the next run.

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

Wikipedistas (usuários registrados)
A = Wikipedistas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikipedistas que editaram pelo menos dez vezes desde que chegaram
C = Wikipedistas que contribuíram cinco vezes ou mais este mês
D = Wikipedistas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Artigos que contêm pelo menos uma ligação interna e 200 caracteres de texto legível, não contando códigos wiki e html,
      ligações ocultas, etc.; títulos também não contam (outras colunas são baseadas no método oficial de contagem)
G = Novos artigos por dia no mês passado
H = Número médio de revisões por artigo
I = Tamanho médio dos artigos em bytes
J = Porcentagem de artigos com pelo menos 0,5 kb de texto legível (veja F)
K = Porcentagem de artigos com pelo menos 2 kb de texto legível (veja F)

Base de dados
L = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
M = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
N = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
O = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
P = Total de ligações para outras wikipédias
Q = Total de imagens apresentadas
R = Total de ligações para outros sítios
S = Total de páginas de redirecionamento
 

Edit activity levels of registered users and bots per group of namespaces

Namespaces: Articles = 0   Talk = 1,3,5,7,9,..   Other = 2,4,6,8,..

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 5  5  5  5  5  10  5  10 
fev 2011        
jan 2011        
dez 2010        
nov 2010        
out 2010        
set 2010        
ago 2010        
jul 2010        
jun 2010        
mai 2010        
abr 2010        
mar 2010        
fev 2010        
jan 2010        
dez 2009        
nov 2009        
out 2009        
set 2009        
ago 2009        
jul 2009        
jun 2009        
mai 2009        
abr 2009        
mar 2009        
fev 2009        
jan 2009        
dez 2008        
nov 2008        
out 2008        
set 2008        
ago 2008        
jul 2008        
jun 2008        
mai 2008        
abr 2008    1   
mar 2008      1 
fev 2008    1111
jan 20081     1 
dez 2007 1    1 
nov 2007 1  1 1 
out 200731      
set 2007        
ago 2007        
jul 2007        
jun 2007        
mai 2007 1    1 
abr 2007    2   
mar 2007    1 11
fev 20071       
jan 2007      11
dez 2006        
nov 2006        
out 2006        
set 2006        
ago 2006        
jul 2006        
jun 2006        
mai 2006        
abr 2006        
mar 2006        
fev 2006        
jan 2006        
dez 2005        
nov 2005        
out 2005        
set 2005        
ago 2005        
jul 2005        
jun 2005        
mai 2005        
abr 2005        
mar 2005        
fev 2005        
jan 2005        
dez 2004        
nov 2004        
out 2004        
set 2004        
ago 2004        

 

Distribuição de edições de artigos por wikipedistas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikipedistasEdições total
119100.0%59100.0%
3631.6%3966.1%

 

19 wikipedistas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesPrimeira ediçãoúltima edição
 posiçãototaldatadias
atrás		datadias
atrás
Ushanka19fev 20, 20071468fev 21, 20071467
Jorunn28dez 14, 20051901out 08, 20071238
Jeneme37set 18, 20071258jan 03, 20081151
Z0d165-de3Q_E--548Qow33_W-84_14oTs_-_b3r42--2_D3K246out 08, 20071238out 08, 20071238
AlefZet55out 08, 20071238out 08, 20071238
Node_ue64jul 30, 20071308jul 30, 20071308
Kanon691773out 12, 20071234out 12, 20071234
Tiyoringo83jan 01, 20081153jan 14, 20081140
Adolf92out 05, 20071241out 05, 20071241
Z0d165-de3Q_E--548Qow33_W-84_14oTs_-_b3r42--2_D3K1102out 08, 20071238out 08, 20071238
Jeremyrs112abr 10, 20081053abr 10, 20081053
?121ago 29, 20042373ago 29, 20042373
Angela131nov 13, 20042297nov 13, 20042297
Korg141mar 22, 20061803mar 22, 20061803
Dbl2010151jan 05, 20071514jan 05, 20071514
Anthropos161jul 24, 20071314jul 24, 20071314
Z0d165-de3Q_E--548Qow33_W-84_14oTs_-_b3r42--2_D3K171out 08, 20071238out 08, 20071238
MF-Warburg181mai 14, 20081019mai 14, 20081019
Pathoschild191fev 22, 2009735fev 22, 2009735

  

12 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesPrimeira ediçãoúltima edição
 posiçãototaldatadias
atrás		datadias
atrás
SieBot128out 02, 20071244mai 08, 20081025
Thijs!bot215jan 19, 20071500fev 01, 20081122
BotMultichill312out 09, 20071237fev 25, 20081098
PipepBot410ago 10, 20071297fev 15, 20081108
Escarbot58ago 18, 20061654abr 03, 20081060
VolkovBot67nov 02, 20071213mai 05, 20081028
AlleborgoBot76jan 16, 20081138mai 10, 20081023
TXiKiBoT83fev 05, 20071483jun 08, 20071360
Robbot93mar 23, 20071437jul 12, 20071326
EDUCA33E101nov 25, 20071190nov 25, 20071190
Purbo_T111fev 17, 20081106fev 17, 20081106
JAnDbot121abr 30, 20081033abr 30, 20081033

 

Artigos que contêm pelo menos uma ligação interna e .. caracteres de texto legível, não contando códigos wiki e html,
ligações ocultas, etc.; títulos também não contam  (excluindo páginas de redirecionamento)

DataArtigos
 < 32 ch< 64 ch< 128 ch< 256 ch< 512 ch< 1 k ch< 2 k ch< 4 k ch< 8 k ch< 16 k ch< 32 k ch< 64 k ch
fev 201127.3%36.4%36.4%54.6%81.9%91.0%100.0%100.0%100.0%100.0%100.0%100.0%
jan 201127.3%36.4%36.4%54.6%81.9%91.0%100.0%100.0%100.0%100.0%100.0%100.0%
dez 201027.3%36.4%36.4%54.6%81.9%91.0%100.0%100.0%100.0%100.0%100.0%100.0%
nov 201027.3%36.4%36.4%54.6%81.9%91.0%100.0%100.0%100.0%100.0%100.0%100.0%
out 201027.3%36.4%36.4%54.6%81.9%91.0%100.0%100.0%100.0%100.0%100.0%100.0%
set 201027.3%36.4%36.4%54.6%81.9%91.0%100.0%100.0%100.0%100.0%100.0%100.0%
ago 201027.3%36.4%36.4%54.6%81.9%91.0%100.0%100.0%100.0%100.0%100.0%100.0%
jul 201027.3%36.4%36.4%54.6%81.9%91.0%100.0%100.0%100.0%100.0%100.0%100.0%
jun 201027.3%36.4%36.4%54.6%81.9%91.0%100.0%100.0%100.0%100.0%100.0%100.0%
mai 201027.3%36.4%36.4%54.6%81.9%91.0%100.0%100.0%100.0%100.0%100.0%100.0%
abr 201027.3%36.4%36.4%54.6%81.9%91.0%100.0%100.0%100.0%100.0%100.0%100.0%
mar 201027.3%36.4%36.4%54.6%81.9%91.0%100.0%100.0%100.0%100.0%100.0%100.0%
fev 201027.3%36.4%36.4%54.6%81.9%91.0%100.0%100.0%100.0%100.0%100.0%100.0%
jan 201027.3%36.4%36.4%54.6%81.9%91.0%100.0%100.0%100.0%100.0%100.0%100.0%
dez 200927.3%36.4%36.4%54.6%81.9%91.0%100.0%100.0%100.0%100.0%100.0%100.0%
nov 200927.3%36.4%36.4%54.6%81.9%91.0%100.0%100.0%100.0%100.0%100.0%100.0%
out 200927.3%36.4%36.4%54.6%81.9%91.0%100.0%100.0%100.0%100.0%100.0%100.0%
set 200927.3%36.4%36.4%54.6%81.9%91.0%100.0%100.0%100.0%100.0%100.0%100.0%
ago 200927.3%36.4%36.4%54.6%81.9%91.0%100.0%100.0%100.0%100.0%100.0%100.0%
jul 200927.3%36.4%36.4%54.6%81.9%91.0%100.0%100.0%100.0%100.0%100.0%100.0%
jun 200927.3%36.4%36.4%54.6%81.9%91.0%100.0%100.0%100.0%100.0%100.0%100.0%
mai 200927.3%36.4%36.4%54.6%81.9%91.0%100.0%100.0%100.0%100.0%100.0%100.0%
abr 200927.3%36.4%36.4%54.6%81.9%91.0%100.0%100.0%100.0%100.0%100.0%100.0%
mar 200927.3%36.4%36.4%54.6%81.9%91.0%100.0%100.0%100.0%100.0%100.0%100.0%
fev 200927.3%36.4%36.4%54.6%81.9%91.0%100.0%100.0%100.0%100.0%100.0%100.0%
jan 200925.0%33.3%33.3%58.3%83.3%91.6%99.9%99.9%99.9%99.9%99.9%99.9%
dez 200825.0%33.3%33.3%58.3%83.3%91.6%99.9%99.9%99.9%99.9%99.9%99.9%
nov 200825.0%33.3%33.3%58.3%83.3%91.6%99.9%99.9%99.9%99.9%99.9%99.9%
out 200825.0%33.3%33.3%58.3%83.3%91.6%99.9%99.9%99.9%99.9%99.9%99.9%
set 200825.0%33.3%33.3%58.3%83.3%91.6%99.9%99.9%99.9%99.9%99.9%99.9%
ago 200825.0%33.3%33.3%58.3%83.3%91.6%99.9%99.9%99.9%99.9%99.9%99.9%
jul 200825.0%33.3%33.3%58.3%83.3%91.6%99.9%99.9%99.9%99.9%99.9%99.9%
jun 200825.0%33.3%33.3%58.3%83.3%91.6%99.9%99.9%99.9%99.9%99.9%99.9%
mai 200825.0%33.3%33.3%58.3%83.3%91.6%99.9%99.9%99.9%99.9%99.9%99.9%
abr 200825.0%33.3%33.3%50.0%75.0%91.7%100.0%100.0%100.0%100.0%100.0%100.0%
mar 200833.3%41.6%41.6%58.3%83.3%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
fev 200833.3%41.6%41.6%58.3%83.3%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
jan 200833.3%41.6%41.6%58.3%83.3%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
dez 200730.0%40.0%40.0%60.0%80.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
nov 200730.0%40.0%40.0%60.0%80.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
out 200722.2%33.3%33.3%55.5%77.7%99.9%99.9%99.9%99.9%99.9%99.9%99.9%
set 200714.3%28.6%28.6%57.2%71.5%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
ago 200714.3%28.6%28.6%57.2%71.5%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
jul 200714.3%28.6%28.6%57.2%71.5%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
jun 20070.0%16.7%16.7%50.0%66.7%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
mai 20070.0%16.7%16.7%50.0%66.7%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
abr 20070.0%16.7%16.7%50.0%66.7%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
mar 20070.0%16.7%16.7%50.0%50.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
fev 20070.0%16.7%16.7%50.0%50.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
jan 20070.0%20.0%20.0%40.0%40.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
dez 20060.0%20.0%20.0%20.0%40.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
nov 20060.0%20.0%20.0%20.0%40.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
out 20060.0%20.0%20.0%20.0%40.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
set 20060.0%20.0%20.0%20.0%40.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
ago 20060.0%20.0%20.0%40.0%40.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
jul 20060.0%25.0%25.0%50.0%50.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
jun 20060.0%20.0%20.0%40.0%40.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
mai 20060.0%20.0%20.0%40.0%40.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
abr 20060.0%20.0%20.0%40.0%60.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
mar 20060.0%20.0%20.0%40.0%60.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
fev 20060.0%0.0%0.0%25.0%75.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
jan 20060.0%0.0%0.0%25.0%75.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
dez 20050.0%0.0%0.0%25.0%75.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
nov 20050.0%0.0%0.0%25.0%75.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
out 20050.0%0.0%0.0%33.3%66.6%99.9%99.9%99.9%99.9%99.9%99.9%99.9%
set 20050.0%0.0%0.0%33.3%66.6%99.9%99.9%99.9%99.9%99.9%99.9%99.9%
ago 20050.0%0.0%0.0%0.0%50.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
jul 20050.0%0.0%0.0%0.0%50.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
jun 20050.0%0.0%0.0%0.0%50.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
mai 20050.0%0.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
abr 20050.0%0.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
mar 20050.0%0.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
fev 20050.0%0.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
jan 20050.0%0.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
dez 20040.0%0.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
nov 20040.0%0.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
out 20040.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
set 20040.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
ago 20040.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1		Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110Jpg
fev 2011121063233 6      36%2
jan 2011121063233 6      36%2
dez 2010121063233 6      36%2
nov 2010121063233 6      36%2
out 2010121063233 6      36%2
set 2010121063233 6      36%2
ago 2010121063233 6      36%2
jul 2010121063233 6      36%2
jun 2010121063233 6      36%2
mai 2010121063233 6      36%2
abr 2010121063233 6      36%2
mar 2010121063233 6      36%2
fev 2010121063233 6      36%2
jan 2010121063233 6      36%2
dez 2009121063233 6      36%2
nov 2009121063233 6      36%2
out 2009121063233 6      36%2
set 2009121063233 6      36%2
ago 2009121063233 6      36%2
jul 2009121063233 6      36%2
jun 2009121063233 6      36%2
mai 2009121063233 6      36%2
abr 2009121063233 6      36%2
mar 2009121063233 6      36%2
fev 2009121043233 6      36%2
jan 2009121043223 6      33%2
dez 2008121043223 6      33%2
nov 2008121043223 6      33%2
out 2008121043223 6      33%2
set 2008121043223 6      33%2
ago 2008121043223 6      33%2
jul 2008121043223 6      33%2
jun 2008121043223 6      33%2
mai 2008121043223 6      33%2
abr 20081210432 3 6      33%2
mar 20081210022 3 5      33%2
fev 2008129522 3 5      33%2
jan 2008128322 3 5      33%2
dez 2007107822 2 4      20%2
nov 2007107522 2 4      20%2
out 200797422 1 2      11%2
set 200776512 1 2      14%2
ago 2007761 2 1 2      14%2
jul 2007753 2 1 1      14%2
jun 2007652 2 1 1      17%2
mai 2007651 2 1 1      17%2
abr 2007649 2 1 1      17%2
mar 2007645 2 1 1      17%2
fev 2007636 2 1 1      17%2
jan 2007532 1 1 1      20%1
dez 2006526 1   1      20%1
nov 2006520 1   1      20%1
out 2006519 1           1
set 2006519 1           1
ago 2006519 1           1
jul 2006518 1           1
jun 2006518 1           1
mai 2006518 1           1
abr 2006518 1           1
mar 2006517 1           1
fev 2006415 1           1
jan 2006415 1           1
dez 2005412              
nov 2005410              
out 200538              
set 200537              
ago 200526              
jul 200525              
jun 200525              
mai 200514              
abr 200513              
mar 200511              
fev 200511              
jan 200511              
dez 200411              
nov 200411              
out 20041               
set 20041               
ago 20041               

 

5 most edited articles (> 25 edits)
 

EdiçõesUnique usersArtigosArchived
TotalReg.Reg.Unreg.
6274%1611Majõl< 1 Mb  
3569%159Yokwe eok Maria< 1 Mb  
3327%721Main Page< 1 Mb  
2882%105Mā< 1 Mb  
2544%711Kajin M̧ajeļ< 1 Mb  

 

ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

ago 2004: 1 1 Main Page

nov 2004: 1 1 Main Page

dez 2005: 1 1 Majõl

mar 2006: 1 1 Kahkun

jan 2007: 1 1 Yokwe eok Maria

fev 2007: 1 1 Mā

jul 2007: 1 2 Main Page , 2 1 M̍ahjeł

set 2007: 1 1 Majõl

out 2007: 1 5 Yokwe eok Maria , 2 4 Majõl , 3 2 Io̧kwe eok Maria , 4 1 Jememuij iljõñ

jan 2008: 1 2 Forever Marshall Islands , 2 1 Kajin Majõl

abr 2008: 1 1 Bok in Mormon

mai 2008: 1 1 Main Page

fev 2009: 1 1 Main Page

Wikipedias are initially ordered by number of speakers of the language

Speakers: Number of speakers of a language is the estimated total of primary and secondary speakers, is in many cases a very rough estimation (based on the page on the English Wikipedia about that language)
Regions are parts of the world where the language is spoken in substantial amounts (compared to total number of speakers). Regions where a language gained presence only by a recent diaspora are generally not included.
Region codes: AF:Africa, AS:Asia, EU:Europe, NA:North America, OC:Oceania, SA:South America, W:World Wide, CL:Constructed Language

Estatísticas geradas em Segunda-feira, 4 de abril 2011 a partir de cópias do banco de dados SQL de Quinta-feira, 31 de março 2011
Versão do script:2.6
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.