Estatísticas da Wikipédia mirandese

Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Articles per size range / Records per namespace / Most edited articles / Zeitgeist
  Dec 2017: WMF Analytics Team is happy to announce the first release of Wikistats 2

  Wikistats has been redesigned for architectural simplicity, faster data processing, and a more dynamic and interactive user experience. The data used in the reports will also be made available for external processing.  

  First goal is to match the numbers of the current system, and to provide the most important reports, as decided by the Wikistats community (see survey).  
  Over time, we will continue to migrate reports and add new ones that you find useful. We can also analyze the data in new and interesting ways, and look forward to hearing your feedback and suggestions.  

  You can go directly to Wikipedia mirandese


Most metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.

Some metrics have been collected from the full archive dump which runs on lower frequency than the usual monthly cycle.
These metrics are columns F,I,J,K,M,N,O,P,Q,R from the first table.

See also metrics definitions

Monthly counts & Quarterly rankings: maio 2018
DataWikipedistasArtigosBase de dadosLigações
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
mai 20180%   0%      -30%      0%
abr 20180%   +1%      +4%      0%
mar 20180%   0%      -64%      0%
fev 2018+1%   +2%      +108%      +2%
jan 20180%   0%      -36%      +2%
dez 2017+3%   +1%             +4%
mai 201873 1 3,9 k  13,3   83      415
abr 201873 3 3,9 k 113,3   118      415
mar 201873 4 3,8 k 113,4   113      413
fev 20187314 3,8 k 213,4   316      413
jan 201872 2 3,7 k  13,6   152      405
dez 2017722313,7 k 113,6   237      396
nov 20177011 3,7 k  13,6   18      380
out 2017691213,7 k  13,6   142      380
set 201768 213,7 k  13,5   222      370
ago 201768 213,7 k  13,5   240      343
jul 201768 4 3,7 k  13,5   41      310
jun 201768 423,7 k 813,5   574      308
mai 2017684523,5 k 2114,2   876      307
abr 201764 1 2,8 k  17,1   32      307
mar 201764   2,8 k  17,1   12      304
fev 201764 1 2,8 k  17,1   24      304
jan 2017641212,8 k 117,2   169      304
dez 201663   2,8 k  17,3   25      294
nov 201663   2,8 k  17,3   8      294
out 201663   2,8 k  17,3   16      294
set 201663 1 2,8 k  17,3   71      294
ago 20166322 2,8 k 117,2   147      294
jul 20166111 2,7 k 117,4   39      286
jun 201660   2,7 k  17,6   10      286
mai 201660   2,7 k  17,6   16      286
abr 201660   2,7 k  17,6   13      286
mar 20166012 2,7 k  17,6   45      286
fev 201659   2,7 k  17,6   16      286
jan 201659   2,7 k  17,6   15      286
dez 201559   2,7 k  17,6   15      286
nov 201559   2,7 k  17,6   17      286
out 20155911 2,7 k  17,6   30      286
set 201558   2,7 k  17,6   21      284
ago 20155811 2,7 k  17,6   40      284
jul 201557   2,7 k  17,6   24      284
jun 201557   2,7 k  17,6   23      284
mai 20155711 2,7 k  17,6   224      284
abr 201556   2,7 k  17,5   21      284
mar 201556   2,7 k  17,5   19      284
fev 201556   2,7 k  17,5   9      284
jan 201556 1 2,7 k  17,5   35      284
dez 201456   2,7 k  17,5   20      282
nov 201456   2,7 k  17,5   39      282
out 201456   2,7 k  17,5   18      280
set 20145622 2,7 k  17,5   31      278
ago 201454 1 2,7 k  17,5   30      278
jul 201454   2,7 k  17,5   15      278
jun 201454   2,7 k  17,5   30      278
mai 201454   2,7 k  17,6   36      278
abr 201454 1 2,7 k 117,6   35      278
mar 20145411 2,6 k  17,7   35      278
fev 201453   2,6 k2,6 k 17,7685487%52%4422 Mb3,1 M148 k4472099,8 k278
jan 201453 1 2,6 k2,5 k 17,7687487%52%3322 Mb3,1 M148 k4462019,8 k273
dez 20135312 2,6 k2,5 k 17,7687687%52%5122 Mb3,1 M148 k5001919,8 k273
nov 20135212 2,6 k2,5 k 17,7688987%52%5022 Mb3,1 M148 k5001919,8 k273
out 20135122 2,6 k2,5 k 17,8691687%52%3822 Mb3,1 M147 k5001919,8 k273
set 2013492222,6 k2,5 k3017,8692587%52%91122 Mb3,1 M147 k4661899,8 k272
ago 20134712 1,7 k1,6 k126,5811982%57%6317 Mb2,4 M115 k3941876,5 k266
jul 201346 1 1,7 k1,6 k 27,1812084%59%3317 Mb2,4 M115 k6551856,4 k266
jun 201346 1 1,7 k1,6 k127,1813384%59%9617 Mb2,4 M115 k6771826,4 k264
mai 201346 311,6 k1,6 k427,6828084%59%31417 Mb2,4 M115 k7061826,4 k261
abr 20134623 1,5 k1,4 k129,4822383%58%16915 Mb2,2 M109 k6981816,0 k241
mar 201344 111,5 k1,4 k129,7828683%59%2,0 k15 Mb2,2 M109 k2,9 k1795,9 k241
fev 201344 2 1,5 k1,4 k 29,1844084%60%73718 Mb2,2 M108 k90 k1495,8 k240
jan 2013441411,5 k1,4 k128,6844584%60%1,2 k18 Mb2,2 M108 k90 k1495,8 k239
dez 2012431311,5 k1,4 k428,2850685%61%1,0 k18 Mb2,2 M108 k88 k1495,8 k239
nov 20124211 1,3 k1,3 k230,2860385%59%86716 Mb2,0 M99 k83 k1374,8 k226
out 20124112 1,3 k1,2 k 30,7854884%57%80715 Mb1,9 M95 k79 k904,4 k215
set 201240 1 1,3 k1,2 k 30,2856684%57%65315 Mb1,9 M95 k79 k934,4 k215
ago 201240   1,3 k1,2 k 29,9861684%58%65715 Mb1,9 M95 k78 k944,3 k215
jul 20124023 1,3 k1,2 k 29,4862184%58%83315 Mb1,9 M95 k78 k954,3 k215
jun 201238 1 1,2 k1,2 k 29867884%58%80915 Mb1,9 M95 k77 k974,3 k215
mai 201238   1,2 k1,2 k 28,4869684%58%77115 Mb1,9 M95 k76 k924,3 k214
abr 201238 2 1,2 k1,2 k 27,9870684%58%86115 Mb1,9 M95 k76 k914,3 k214
mar 201238 3 1,2 k1,2 k127,4899385%59%95016 Mb2,0 M95 k75 k924,3 k214
fev 20123812 1,2 k1,1 k127,3916186%60%82815 Mb2,0 M95 k73 k954,3 k213
jan 201237   1,2 k1,1 k 27,5943289%62%61215 Mb2,0 M95 k71 k934,2 k212
dez 20113712 1,2 k1,1 k 27,1945989%62%85015 Mb2,0 M95 k71 k914,2 k212
nov 20113614 1,1 k1,1 k126,6951289%62%92215 Mb2,0 M94 k70 k914,2 k212
out 20113514 1,1 k1,1 k 26,1958990%63%80415 Mb1,9 M94 k69 k884,2 k207
set 201134   1,1 k1,1 k 25,8967190%63%58615 Mb1,9 M94 k68 k854,1 k206
ago 201134 4 1,1 k1,1 k 25,3968890%63%71515 Mb1,9 M93 k68 k874,1 k206
jul 20113423 1,1 k1,1 k124,8972190%63%88815 Mb1,9 M93 k68 k874,1 k206
jun 2011321  1,1 k1,1 k 24,7994491%64%89915 Mb1,9 M93 k66 k864,0 k206
mai 201131 2 1,1 k1,0 k 24995391%65%76615 Mb1,9 M93 k65 k944,0 k205
abr 20113117 1,1 k1,0 k123,4996192%65%82515 Mb1,9 M93 k65 k923,9 k205
mar 201130 2 1,0 k1,0 k 23,1996992%65%96015 Mb1,9 M91 k63 k923,8 k204
fev 201130 1 1,0 k1,0 k 22,31001192%65%69814 Mb1,9 M91 k62 k883,8 k204
jan 2011301511,0 k1,0 k121,71008492%65%1,3 k14 Mb1,9 M91 k61 k913,8 k202
dez 201029 1 1,0 k987 211033392%66%75314 Mb1,9 M91 k60 k903,8 k179
nov 201029 1 999978 20,41039192%66%64514 Mb1,9 M90 k59 k913,8 k178
out 20102916 996975119,81042492%67%70114 Mb1,9 M90 k59 k963,8 k176
set 20102824 979959 19,41055792%67%71914 Mb1,9 M90 k57 k973,8 k175
ago 201026 2 964951 191061593%68%97914 Mb1,9 M89 k56 k973,7 k172
jul 20102613 954941 18,21068493%68%70914 Mb1,9 M89 k55 k1023,7 k171
jun 20102511 939925 17,71083693%69%73014 Mb1,8 M89 k54 k1083,7 k169
mai 20102413 934918 171079893%68%72514 Mb1,8 M88 k53 k1093,6 k169
abr 201023 52923908116,41091193%69%1,1 k14 Mb1,8 M88 k52 k1083,6 k168
mar 201023171896880315,61121693%69%1,3 k14 Mb1,8 M87 k51 k1463,6 k157
fev 201022 9 806801115,81188394%70%83913 Mb1,7 M81 k46 k1573,4 k133
jan 201022363781775115,31211194%70%2,3 k13 Mb1,7 M79 k45 k1663,3 k120
dez 200919251744737 12,91275894%71%83812 Mb1,7 M77 k42 k2763,3 k75
nov 200917141740733 11,91275894%70%1,2 k12 Mb1,6 M76 k41 k6173,3 k72
out 200916142733723110,41329993%71%1,1 k12 Mb1,6 M76 k40 k1,3 k3,2 k64
set 200915571707699 9,31383294%72%98712 Mb1,6 M75 k32 k1,6 k3,1 k54
ago 200910141697686181446293%72%2,3 k12 Mb1,6 M75 k25 k2,8 k3,1 k41
jul 20099 1 670662 4,91532594%74%4112 Mb1,6 M74 k13 k2,8 k3,1 k39
jun 20099 2166766154,91533794%75%47712 Mb1,6 M74 k13 k2,8 k3,1 k39
mai 20099 2151650615,41384892%71%1428,1 Mb1,1 M52 k12 k2,2 k2,0 k37
abr 2009926247346475,61286892%71%5776,9 Mb945 k47 k12 k2,0 k1,6 k35
mar 2009713126225217,81050285%60%2843,3 Mb428 k21 k11 k91284626
fev 2009624222020938870983%56%7142,4 Mb295 k16 k10 k72462724
jan 20094 2113813017,6528276%40%301972 kb118 k5,7 k5,0 k27316015
dez 20084 511018817,5229964%22%421316 kb38 k1,7 k1,8 k1267412
nov 20084 2 5540 6,169251%4%3753 kb6,3 k20120715294
out 20084   5238 5,765450%4%449 kb5,8 k15919216264
set 20084   5138 5,766351%4% 49 kb5,7 k15719216254
ago 20084   5138 5,766351%4% 49 kb5,7 k15719216254
jul 2008422 5138 5,766351%4%3149 kb5,7 k15719216254
jun 20082   4937 5,363651%2%1141 kb5,5 k1246510244
mai 20082 1 473515,362049%2%9239 kb5,1 k1156110174
abr 20082   2420 6,659450% 6421 kb2,6 k73261093
mar 20082   1713 5,556653% 2714 kb1,7 k6410912
fev 2008221 139 5,258254% 6711 kb1,3 k563912
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternas

> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
The following table ranks this project in relation to projects in other languages with 1000+ articles
abr 2018179 162 188 157184   179      278
jan 2018177 187 189  181   174      278
out 2017178145181143188  179   168      278
jul 2017176 151 186  182   204      278
abr 2017182 199 206  156   203      278
jan 2017178145172139204 148157   157      278
out 2016178   204  155   232      278
jul 2016178138201 203 141154   192      278
abr 2016179   202  154   232      278
jan 2016177   200  155   235      278
out 2015176137206 196  157   211      278
jul 2015177   194  159   210      278
abr 2015177   193  160   236      278
jan 2015174 194 190  158   201      278
out 2014171   188  158   221      278
jul 2014172   187  158   233      278
abr 2014169 208 185 151161   216      278
jan 20141661751951481841591591611439209114105107190235116278
out 20131671121751291811591501612449194115104107194234117278
jul 2013171144193138200182160901513200121107110183234124278
abr 2013168101155152205184153701543187124108111187235125277
jan 2013173136136143202181150691472177133107111193241125277
out 2012172138171140206182152601442196139108113196250132277
jul 201217399156146204183155661422195135108113196248131277
abr 2012174143174150202180152711391195133105111194250124277
jan 2012171161232145204180152701201201130105109194247122277
out 2011174138140151204179164761131198127102107192247120277
jul 2011172113153145202175159831111193122102106189245119277
abr 20111741361051362011701489217118811897102188239117277
jan 201117214212913220016415210116118211996101185242116277
out 201016914511213519316314419319219118918911795101182234110277
jul 201017314216214418916116018918818718518911692100180232110277
abr 20101791561191011861611441861851841831651139198176232110277
jan 201017781121851871641441831831821811181149199175217110277
out 2009195133125971881621531811811801791601139098174122105277
jul 2009232196192137185164152173173172171248109889721594105277
abr 20092279911210619517282170170169168175128100105212105120277
jan 2009258136163127227212139165165164163204201168170229189190276
out 2008254143210137245234147159159158157263261243246263256232274
jul 2008249102168135240228150153153152150249256239243262252224273
abr 2008262152219133253237154148148146144235260248250263255240273
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
 WikipedistasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikipedistas (usuários registrados)
A = Wikipedistas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikipedistas que editaram pelo menos dez vezes desde que chegaram
C = Wikipedistas que contribuíram cinco vezes ou mais este mês
D = Wikipedistas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Artigos que contêm pelo menos uma ligação interna e 200 caracteres de texto legível, não contando códigos wiki e html,
      ligações ocultas, etc.; títulos também não contam (outras colunas são baseadas no método oficial de contagem)
G = Novos artigos por dia no mês passado
H = Número médio de revisões por artigo
I = Tamanho médio dos artigos em bytes
J = Porcentagem de artigos com pelo menos 0,5 kb de texto legível (veja F)
K = Porcentagem de artigos com pelo menos 2 kb de texto legível (veja F)

Base de dados
L = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
M = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
N = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

O = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
P = Total de ligações para outras wikipédias
Q = Total de imagens apresentadas
R = Total de ligações para outros sítios
S = Total de páginas de redirecionamento

Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  5  10  100  1000  1  3  5  10  25  100  250  5  10  1  3  5  10  25  100  250  1000  5  10  100  1000 
mai 20188111       1        5322        
abr 2018104322      511      731         
mar 2018134431      2        6221        
fev 2018104433  1   311      52211       
jan 201873222      21       2211        
dez 2017943331      211      632211      
nov 2017521        21       41111   1   
out 2017622211      21       621111      
set 20171132111  1   2221     411111      
ago 20171032111  2   5221     5222111 1   
jul 20171154        3        411         
jun 20177443321              21111       
mai 201711655222 1   1        3111        
abr 20171111    1   1        111         
mar 201741                 2           
fev 20176111       1        421         
jan 20171022111      311      5322211     
dez 20163                  21          
nov 20166                  1           
out 201652                 211         
set 20165111   11           1           
ago 2016102222      11       431         
jul 201633111  1   2        2111        
jun 20167                  1           
mai 201673        1        2           
abr 20166         2        2           
mar 20166321                1           
fev 20167     1                        
jan 20168     1   2        6           
abr 2018104322      511      731         
jan 201873222      21       2211        
out 2017622211      21       621111      
jul 20171154        3        411         
abr 20171111    1   1        111         
jan 20171022111      311      5322211     
out 201652                 211         
jul 201633111  1   2        2111        
abr 20166         2        2           
jan 20168     1   2        6           
out 20154111                3       1   
jul 201581        1        1           
abr 20159     1   1      223           
jan 2015711    11  52       31          
out 20149                  3           
jul 20145         1        2           
abr 20147111       1        5           
jan 2014921    11  1        61          
out 20131832        1        51          
jul 20131021        1        3           
abr 201313332   43  1        11211    552 
jan 20131254211  18123 62111    12532111 11113 
out 2012832    1493 1        1121     11103 
jul 201213431   1883 1        12111    12102 
abr 201214321   16153 31       911     1291 
jan 201292    15111 1        101      12111 
out 20111764    23161          1132     15123 
jul 2011123321  22132 3        74311   1191 
abr 201114773   14124 1        12531    12102 
jan 20111055321  20143 41       163221   16133 
out 2010147631  17111 3        162211   1392 
jul 201011531   18121 3        93111   1182 
abr 201010654421 1581 1042      137433   1092 
jan 20101276663111592 9332     159975211431 
out 20091464422  16121 83211    11532    43  
jul 200921111               1111        
abr 20096666421     3111     33322       
jan 2009422221      3111     54221       
out 2008                               
jul 20082222       1        421         
abr 20081                  21          


Distribuição de edições de artigos por wikipedistas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...

Edições >=WikipedistasEdições total


8 wikipedistas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias

 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
30 dias
30 dias
30 dias
30 dias
Athena in WonderlandUC4 0798111,29117out 25, 2015948792--
CAPTAIN RAJUUC278+27621--jul 05, 2017329----
CherkashUC279+28421--set 16, 2017256----
Adrian HernandezUC283+30221--abr 27, 201833----
EpìdosisUC284+303211211abr 30, 201830----
Hermógenes Teixeira Pinto FilhoUC588...11--mai 02, 201828----
Alexander-93UC589...11--mai 19, 201811----
JarrahTreeUC590...1111mai 20, 201810----


20 wikipedistas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

  Primeira ediçãoúltima edição
PisonesUC12,078dez 06, 20093097mai 03, 20131853
CecílioUC22,016jul 29, 20083592fev 09, 20103032
ChabiUC31,644fev 24, 20083748jul 05, 20122155
SPQRobinUC5724jun 25, 20093261jun 03, 20112553
CatrapimbaUC6589mai 17, 2017378jun 08, 2017356
Manuel de SousaUC7541jan 24, 20103048mar 08, 20131909
ZeEstevesUC8531set 14, 20131719set 16, 20131717
GarsdUC9520jan 15, 20131961mar 24, 20131893
Bitus15UC10446mai 01, 2017394jul 07, 2017327
NaviaTVUC11377jan 25, 20103047mai 14, 20102938
AmaralUC12369set 18, 20131715set 18, 20131715
HexadecimalUC13365abr 15, 20131871jun 03, 20131822
BillinghurstUC14344jul 03, 20122157jun 23, 2017341
El estremeñuUC15305set 20, 20093174jan 04, 20103068
CarnelianSuthUC16305nov 18, 20122019dez 12, 20121995
AlchimistaUC17290ago 13, 20093212mai 16, 2017379
Alejandrocaro35UC18263dez 14, 2017167abr 27, 201833
EspadeiroUC19234set 08, 20093186out 27, 2016580
Gato PretoUC20166set 25, 2015978mar 22, 2017434
DARIO SEVERIUC21164mar 16, 2016805abr 20, 201840


Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 1.758 edições foram feitas por usuários anônimos, de um total de 51.288 edições ( 3e %)

50 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
XqbotUC14,546set 01, 20093193fev 20, 201899--
EmausBotUC23,876jun 26, 20102895mai 25, 20185--
Luckas-botUC33,421set 03, 20093191mai 20, 20122201--
MerlIwBotUC41,845mai 07, 20112580ago 08, 20131756--
WikitanvirBotUC51,545nov 07, 20102761abr 21, 20122230--
SieBotUC61,522ago 14, 20093211jan 25, 20112682--
ZéroBotUC71,409nov 03, 20102765mar 06, 20131911--
MelancholieBotUC81,360ago 13, 20093212nov 28, 20093105--
TXiKiBoTUC91,252set 21, 20093173jan 08, 20131968--
LegobotUC10839mar 11, 20131906abr 02, 20131884--
VolkovBotUC11833ago 16, 20093209fev 28, 20131917--
AddbotUC12752mar 07, 20131910ago 16, 20131748--
EscarbotUC13664mar 07, 20103006set 07, 2016630--
FoxBotUC14660out 03, 20093161fev 05, 20122306--
TjBotUC15544nov 17, 20102751mar 06, 20131911--
ArthurBotUC16482ago 24, 20093201nov 17, 20112386--
RedBotUC17391set 08, 20102821ago 21, 20122108--
Ripchip BotUC18380mar 06, 20112642fev 18, 20122293--
HRoestBotUC19376jun 19, 20102902fev 14, 20131931--
CommonsDelinkerUC20368dez 25, 20083443mai 19, 201811--
Idioma-botUC21366out 30, 20093134fev 10, 20131935--
KamikazeBotUC22361jul 04, 20102887jan 24, 20131952--
AvocatoBotUC23349out 20, 20112414fev 27, 20131918--
JackieBotUC24289jan 15, 20112692mar 07, 20131910--
JAnDbotUC25285ago 14, 20093211jul 03, 20131792--
AlexbotUC26281ago 17, 20093208ago 14, 20112481--
Thijs!botUC27272mai 04, 20102948jul 30, 20122130--
LaaknorBotUC28269out 02, 20093162fev 16, 20131929--
RobbotUC29252set 23, 20093171jan 02, 20131974--
MjbmrbotUC30234out 15, 20102784mar 28, 20112620--
Movses-botUC31226dez 22, 20102716mar 18, 20122264--
RubinbotUC32203set 13, 20093181mar 02, 20131915--
Dinamik-botUC33179fev 14, 20103027dez 18, 20121989--
DexbotUC34179out 17, 20122051mai 25, 20151101--
MastiBotUC35178dez 10, 20093093mar 01, 20131916--
GerakibotUC36171jan 11, 20103061mar 04, 20131913--
AvicBotUC37169jun 18, 20112538dez 09, 20121998--
JotterbotUC38159out 05, 20093159jan 24, 20131952--
VagobotUC39158out 18, 20112416set 19, 20122079--
AmirobotUC40131mai 04, 20102948nov 19, 20112384--
MystBotUC41122jan 23, 20103049fev 05, 20122306--
Makecat-botUC42120out 28, 20122040mar 04, 20131913--
YFdyh-botUC43109jun 18, 20122172fev 13, 20131932--
JhsBotUC44103mai 18, 20102934mar 29, 20122253--
CocuBotUC45100jun 09, 20112547dez 26, 20121981--
HerculeBotUC4699ago 30, 20093195jul 13, 20122147--
CarsracBotUC4795ago 16, 20093209fev 12, 20131933--
HiW-BotUC4891set 18, 20112446out 19, 20122049--
SilvonenBotUC4986set 08, 20093186dez 19, 20121988--
DSisyphBotUC5085nov 22, 20093111ago 27, 20122102--


Artigos que contêm pelo menos uma ligação interna e .. caracteres de texto legível, não contando códigos wiki e html,
ligações ocultas, etc.; títulos também não contam  (excluindo páginas de redirecionamento)

 < 32 ch< 64 ch< 128 ch< 256 ch< 512 ch< 1 k ch< 2 k ch< 4 k ch< 8 k ch< 16 k ch< 32 k ch< 64 k ch
out 20107.5%11.1%12.9%15.4%19.6%28.7%41.8%56.0%69.1%81.6%91.0%97.4%
set 20107.6%11.1%13.1%15.4%19.4%28.5%41.6%55.7%68.7%81.2%90.9%97.4%
ago 20107.6%11.2%12.7%15.0%19.0%28.0%41.2%55.4%68.5%81.2%90.9%97.5%
jul 20107.6%11.1%12.6%15.0%19.0%27.6%40.9%55.1%68.3%81.0%90.8%97.4%
jun 20107.8%11.2%12.9%15.2%19.1%27.3%40.3%54.4%67.8%80.7%90.7%97.4%
mai 20107.8%11.2%13.0%15.3%19.2%27.3%40.5%54.6%67.9%80.9%90.7%97.4%
abr 20107.8%11.3%13.0%15.3%19.2%27.3%40.2%54.3%67.4%80.5%90.5%97.3%
mar 20107.1%10.5%12.3%14.7%18.5%26.2%39.4%53.0%66.5%80.1%90.4%97.2%
fev 20106.8%9.8%10.7%13.3%16.9%24.6%38.2%51.3%65.1%78.8%89.7%97.1%
jan 20106.6%9.1%10.1%12.7%16.1%23.5%37.3%50.6%64.5%78.1%89.2%96.9%
dez 20095.7%7.4%8.5%11.4%14.9%22.9%35.8%48.4%62.4%76.6%88.5%96.6%
nov 20095.5%7.2%8.3%11.2%14.8%23.1%36.0%48.6%62.4%76.6%88.5%96.6%
out 20093.9%4.9%5.4%8.2%11.7%19.9%33.3%46.5%61.0%75.9%88.2%96.5%
set 20092.2%2.7%3.2%5.9%9.4%17.3%30.5%44.0%59.0%74.9%87.8%96.2%
ago 20090.3%0.6%1.0%4.0%7.4%15.2%28.5%42.1%57.4%74.0%87.3%96.1%
jul 20090.1%0.5%0.8%3.9%6.7%14.1%26.3%38.8%54.9%72.4%86.2%95.6%
jun 20090.1%0.5%0.8%3.9%6.6%14.0%26.2%38.7%54.8%72.4%86.3%95.7%
mai 20090.2%1.2%1.6%5.1%8.4%17.0%29.9%42.2%56.6%74.3%87.5%97.5%
abr 20090.2%1.2%1.6%5.2%8.8%17.4%29.7%41.6%55.6%74.0%88.2%98.0%
mar 20090.4%2.3%3.1%8.8%15.2%27.3%40.1%52.9%62.3%77.4%90.6%98.9%
fev 20090.4%2.2%3.5%10.7%17.4%30.9%44.4%58.3%66.8%82.0%91.9%99.5%
jan 20090.7%4.1%6.2%17.2%26.9%44.8%61.4%73.1%78.6%88.3%95.9%100.0%
dez 20081.0%8.6%11.5%25.8%38.2%61.1%79.2%88.7%91.6%96.4%100.0%100.0%
nov 20081.8%18.2%23.7%38.2%49.1%76.4%96.4%100.0%100.0%100.0%100.0%100.0%
out 20083.8%18.9%24.6%39.7%51.0%79.3%96.3%100.0%100.0%100.0%100.0%100.0%
set 20083.8%19.2%25.0%38.5%50.0%78.8%96.1%99.9%99.9%99.9%99.9%99.9%
ago 20083.8%19.2%25.0%38.5%50.0%78.8%96.1%99.9%99.9%99.9%99.9%99.9%
jul 20083.8%19.2%25.0%38.5%50.0%78.8%96.1%99.9%99.9%99.9%99.9%99.9%
jun 20083.9%19.6%25.5%37.3%51.0%80.4%98.0%100.0%100.0%100.0%100.0%100.0%
mai 20084.1%20.4%26.5%38.7%53.0%81.6%97.9%99.9%99.9%99.9%99.9%99.9%
abr 20080.0%11.5%15.3%34.5%53.7%84.5%99.9%99.9%99.9%99.9%99.9%99.9%
mar 20080.0%5.6%11.2%33.4%50.1%89.0%100.0%100.0%100.0%100.0%100.0%100.0%
fev 20080.0%7.7%15.4%38.5%46.2%84.7%100.0%100.0%100.0%100.0%100.0%100.0%


Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.

categorizados 1
mai 20184,3 k738160 611,1 k102,7 k8      
abr 20184,3 k738157 611,1 k102,7 k8      
mar 20184,2 k735157 611,1 k102,7 k8      
fev 20184,2 k732157 611,1 k102,7 k6      
jan 20184,1 k726156 571,0 k102,7 k6      
dez 20174,1 k726156 571,0 k102,7 k6      
nov 20174,1 k724156 571,0 k102,7 k6      
out 20174,1 k723150 531,0 k102,7 k6      
set 20174,1 k721148 4398892,7 k6      
ago 20174,0 k710146 1895982,7 k6      
jul 20174,0 k706141 1882382,7 k6      
jun 20174,0 k704141 1882282,7 k6      
mai 20173,8 k703141 1882282,6 k6      
abr 20173,1 k702141 1881882,6 k6      
mar 20173,1 k701141 1881482,6 k6      
fev 20173,1 k701141 1881482,6 k6      
jan 20173,1 k699141 1881482,6 k6      
dez 20163,1 k69776 1881072,2 k6      
nov 20163,1 k69776 1881072,2 k6      
out 20163,1 k69776 1881072,2 k6      
set 20163,1 k69776 1880972,2 k6      
ago 20163,1 k69676 1880972,2 k6      
jul 20163,0 k69576 1880972,2 k6      
jun 20163,0 k69476 1880172,2 k6      
mai 20163,0 k69476 1880172,2 k6      
abr 20163,0 k69376 1880172,2 k6      
mar 20163,0 k69176 1880172,2 k6      
fev 20163,0 k69176 1880172,2 k6      
jan 20163,0 k69176 1880172,2 k6      
dez 20153,0 k69076 1880172,2 k6      
nov 20153,0 k68376 1880172,2 k6      
out 20153,0 k68274 1880172,2 k6      
set 20153,0 k68274 1879472,2 k6      
ago 20153,0 k68074 1879472,2 k6      
jul 20153,0 k67973 1879272,2 k6      
jun 20153,0 k67873 1879272,2 k6      
mai 20153,0 k67873 1879272,2 k6      
abr 20153,0 k67873 1879272,2 k6      
mar 20153,0 k67673 1879272,2 k6      
fev 20153,0 k67473 1877972,2 k6      
jan 20153,0 k67073 1877972,2 k6      
dez 20143,0 k66673 1877972,2 k6      
nov 20143,0 k66673 1877972,2 k6      
out 20143,0 k66373 1877972,2 k6      
set 20143,0 k66173 1877972,2 k6      
ago 20143,0 k65673 1877972,2 k6      
jul 20143,0 k65173 1877972,2 k6      
jun 20143,0 k65073 1875772,2 k6      
mai 20142,9 k65073 1875562,2 k6      
abr 20142,9 k64673 1875562,2 k6      
mar 20142,9 k64373 1875562,2 k6      
fev 20142,9 k63973 1875562,2 k6     8
jan 20142,9 k63573 1875532,2 k6     17
dez 20132,9 k63173 1875532,2 k6     44
nov 20132,9 k62973 1875532,2 k6     30
out 20132,9 k62472 1875532,2 k6     33
set 20132,9 k62072 1875532,2 k6     906
ago 20132,0 k60572 1875532,2 k6     46
jul 20131,9 k60272 1875532,2 k6     20
jun 20131,9 k59972 1875532,2 k6     87
mai 20131,9 k59772 1869432,2 k6     300
abr 20131,8 k58972 1845732,2 k6     46
mar 20131,8 k57772 1844932,2 k6     310
fev 20131,7 k46366 1844932,1 k6     51
jan 20131,7 k44457 1844622,1 k6     231
dez 20121,7 k43052 1644622,1 k6     251
nov 20121,6 k41552 1642222,1 k6     110
out 20121,5 k41452 1640722,1 k6     24
set 20121,5 k40952 1540712,1 k6     17
ago 20121,5 k40352 1540712,1 k6     6
jul 20121,5 k39852 1540712,1 k6     45
jun 20121,5 k39152 1540612,1 k6     26
mai 20121,5 k38052 1540612,1 k6     24
abr 20121,5 k37252 1540612,1 k6     37
mar 20121,4 k36052 1540612,1 k6     106
fev 20121,4 k35752 1540512,1 k6     94
jan 20121,4 k34352 1540512,1 k6     18
dez 20111,4 k33552 1540512,1 k6     68
nov 20111,4 k32952 1440212,1 k6     66
out 20111,3 k31252 1440212,1 k6     45
set 20111,3 k30252 1340112,1 k6     10
ago 20111,3 k29252 1340012,1 k6     45
jul 20111,3 k28852 1340012,0 k6     60
jun 20111,3 k28052 1139912,0 k6     15
mai 20111,3 k27652 1139812,0 k6     34
abr 20111,3 k27052 1139712,0 k6     77
mar 20111,2 k26252 1139612,0 k6     55
fev 20111,2 k25452 1037012,0 k6     30
jan 20111,2 k24752 737012,0 k6     262
dez 20101,2 k23950 336612,0 k6     17
nov 20101,2 k23450 336612,0 k6     16
out 20101,2 k22550 236612,0 k6     88
set 20101,2 k21249 233412,0 k6     57
ago 20101,1 k20149 233412,0 k6     22
jul 20101,1 k18349 233312,0 k6     36
jun 20101,1 k17949 233112,0 k6     42
mai 20101,1 k16349 232912,0 k6     83
abr 20101,1 k16049 232511,9 k6     485
mar 20101,1 k14849 229311,9 k6     455
fev 201093913445 223111,9 k6     262
jan 201090112430 220511,9 k6     1758
dez 200981910027 219417946     199
nov 20098129027 219417786     574
out 20097978225 218511736     344
set 20097617524 218211646     454
ago 20097384823 118111636     926
jul 2009709116  14411476     37
jun 2009706116  14411466     470
mai 200955314  94 126      128
abr 200950814  91 113      564
mar 200928814  83 76      263
fev 200924414  68 75      658
jan 200914913  57 65      267
dez 200810913  44 26      340
nov 200855 1  21 6      36
out 200851 1  18 4       
set 200850 1  18 4       
ago 200850 1  18 4       
jul 200850 1  18 4      26
jun 200848 1  18 3       
mai 200846 1  18 3      22
abr 200825 1  18 1      1
mar 200817 1  15 1      3
fev 200814 1  15         


Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons



For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

fev 2008: 1 2 Picuote , 2 1 Bumioso

mar 2008: 1 1 Lhéngua Mirandesa

abr 2008: 1 1 Abusejo

mai 2008: 1 1 Sociadade

jul 2008: 1 1 Cumputador

nov 2008: 1 2 Pertual , 2 2 Lhéngua Mirandesa , 3 1 Spanha

dez 2008: 1 4 Declaraçon Ounibersal de ls Dreitos Houmanos , 2 3 Ágreda , 3 3 Zenízio , 4 2 Spanha , 5 2 Quim Barreiros , 6 2 Cumputador , 7 2 Cebadeiros , 8 2 Bumioso , 9 2 Braga , 10 2 Bernardo Fernandes Monteiro , 11 2 Auga , 12 2 António Lobo Antunes , 13 2 Almazán , 14 2 Agallas , 15 2 Abusejo , 16 2 Abejar , 17 2 La Lhéngua Mirandesa , 18 2 Nuossa Alma i Nuossa Tierra , 19 2 Manuel Sardinha , 20 2 Lhéngua Mirandesa , 21 2 La Pertuesa , 22 2 João Penha , 23 2 Joaquim de Araújo

jan 2009: 1 2 Stória de Roma , 2 2 Stados Ounidos de la América , 3 2 Relegion , 4 2 Ciéncia , 5 2 Bíblia , 6 2 Berlin , 7 2 Bandeira de Pertual , 8 2 Anternete , 9 2 Angenharie , 10 2 Andústria , 11 2 Agricultura , 12 2 Ouropa , 13 2 Nuoba Iorque , 14 2 Medio Ouriente

fev 2009: 1 3 Sociadade , 2 3 Die de ls namorados , 3 3 Çporto , 4 2 Stória de l Crestianismo , 5 2 San Balantin , 6 2 Salude , 7 2 Rússia , 8 2 Quemido , 9 2 Cristandade , 10 2 Crestianismo , 11 2 Clima , 12 2 Ciéncias sociales , 13 2 Cidade , 14 2 Charles Darwin , 15 2 Catolicismo , 16 2 Biologie , 17 2 Astronomie , 18 2 Artes bisuales , 19 2 Arquitetura , 20 2 Antártica , 21 2 Anternete , 22 2 Amílcar Cabral , 23 2 América de l Norte , 24 2 Portestantismo , 25 2 Política

mar 2009: 1 3 Sendin , 2 2 Riu , 3 2 Cuntinente , 4 2 Assemblé de Dius , 5 2 Arma , 6 2 Almairo , 7 2 Paíç , 8 2 Miranda de l Douro , 9 2 Ls Lusíadas , 10 2 Lhéngua Mirandesa , 11 1 Sun Tzu

abr 2009: 1 3 Sismo , 2 3 Ampério Romano , 3 3 Ampério Bizantino , 4 3 Ouclides , 5 3 Max Ernst , 6 3 Luna , 7 3 Houlocausto , 8 3 Eidade de la Piedra , 9 2 Suméria , 10 2 Stendhal , 11 2 Sploraçon spacial , 12 2 Sociologie , 13 2 Siddhartha Gautama , 14 2 Sexismo , 15 2 Segunda Guerra Mundial , 16 2 Saturno , 17 2 Roald Amundsen , 18 2 Renacimiento , 19 2 Reboluçon Francesa , 20 2 Cordilheira de ls Andes , 21 2 Cleópatra , 22 2 Claude Monet , 23 2 Carl Friedrich Gauss , 24 2 Capitalismo , 25 2 Blaise Pascal

mai 2009: 1 2 Batailha de Aljubarrota , 2 2 Paç , 3 2 Oucránia , 4 1 Stória de la Rússia

jun 2009: 1 3 Guerra de la Andependéncia de ls Stados Ounidos , 2 3 Antoine Lavoisier , 3 2 Stória de Pertual , 4 2 Stados Cunfederados de la América , 5 2 Caçareilhos , 6 2 Campo de Bíboras , 7 2 Bal de Frailes , 8 2 Apartheid , 9 2 Albert Einstein , 10 2 Planeta , 11 2 Pinelo , 12 2 Matela (Bumioso) , 13 2 Fiódor Dostoiévski , 14 2 Eça de Queirós , 15 1 Sílex

jul 2009: 1 1 Sikhismo

ago 2009: 1 4 Lhéngua mirandesa , 2 3 Wikipedia , 3 3 Brigham Young , 4 3 Antigos macedónios , 5 3 Pertual , 6 3 Eisrael , 7 2 Nefita , 8 2 Templo de Curitiba , 9 2 Stória de la Oustrália , 10 2 Stória de Cabo Berde , 11 2 Storiografie , 12 2 Stados Ounidos de la América , 13 2 Santos de ls Redadeiros Dies , 14 2 Rússia , 15 2 Roma Antiga , 16 2 Riu Missouri , 17 2 Custantino I , 18 2 Crestianismo , 19 2 Cordilheira de ls Andes , 20 2 Che Guevara , 21 2 Charles de Gaulle , 22 2 Carlos I de Spanha , 23 2 Blaise Pascal , 24 2 Bernhard Riemann , 25 2 Ateísmo

set 2009: 1 9 Lhéngua lhionesa , 2 3 Monarquie , 3 3 Lhéngua mirandesa , 4 2 Lhéngua almana , 5 2 Mórmones fundamentalistas , 6 2 Casa de Lhion , 7 2 Anielho de l CTR , 8 2 Lhista de reis de Pertual , 9 2 Stória de Eisrael , 10 2 Stados Ounidos de la América , 11 2 Cunfucionismo , 12 2 Cleópatra , 13 2 Claude Monet , 14 2 Che Guevara , 15 2 Charles de Gaulle , 16 2 Charles Darwin , 17 2 Cao Dai , 18 2 Bíblia , 19 2 Budismo , 20 2 Berlin , 21 2 Bandeira de Pertual , 22 2 Análeze matemática , 23 2 Andependéncia de l Brasil , 24 2 América de l Sul , 25 2 Albrecht Dürer

out 2009: 1 3 Frente Nacional para la Lhibertaçon de l Bietname , 2 2 Terça , 3 2 Cultura pertuesa , 4 2 Quarta , 5 2 Cannibal Corpse , 6 2 Abc Fonético Anternacional , 7 2 Lheite , 8 2 Alman , 9 2 Causo genitibo , 10 2 Aníbal Barca , 11 2 Biseu , 12 2 Lhéngua stremenha , 13 2 Lhéngua sturiana , 14 2 Rede Manchete , 15 2 Stória de la quelonizaçon de las Américas , 16 2 Speranto

nov 2009: 1 3 Lhéngua rapa nui , 2 3 Machado de Assis , 3 3 Lhéngua mirandesa , 4 2 Piotr Tchaikovski , 5 2 Templo de Nauvoo , 6 2 Ludwig van Beethoven , 7 2 Moai , 8 2 Terça , 9 2 Quarta , 10 2 Cannibal Corpse , 11 2 Leonel Brizola , 12 2 Saturno , 13 2 Roma , 14 2 Racismo , 15 2 Cristandade , 16 2 Crestianismo , 17 2 Chamamientos crestianos , 18 2 Bikings , 19 2 Auga , 20 2 Animal , 21 2 Planta , 22 2 Paç , 23 2 Ounion Africana , 24 2 Ouniberso , 25 2 Ouceano Pacífico

dez 2009: 1 2 Cannibal Corpse , 2 2 Pertual , 3 2 Paris , 4 1 Ls Santos de ls Redadeiros Dies

jan 2010: 1 4 Brasil Quelónia , 2 4 Bergança , 3 3 Timor-Leste , 4 3 San Tomé i Príncepe , 5 3 Moçambique , 6 3 Guiné-Bissau , 7 3 Bila Nuoba de Gaia , 8 3 Cristobo Colombo , 9 3 Dreito público , 10 3 Casa de Lhion , 11 3 Cuntinente , 12 3 Cuba , 13 3 Capitalismo , 14 3 Cachones de l Niágara , 15 3 Bumioso , 16 3 Bodun , 17 3 Carril de Santiago , 18 3 Bahamas , 19 3 Baca , 20 3 Abicena , 21 3 Andependéncia de l Kosobo , 22 3 América , 23 3 Fé bahá'í , 24 3 Fonso I de Pertual , 25 3 Eiboluçon

fev 2010: 1 3 Louis Pasteur , 2 3 Francis Bacon (filósofo) , 3 3 Vasco da Gama , 4 3 Mobilha , 5 2 Sistema Brasileiro de Televisão , 6 2 Disney Club , 7 2 Mar de Timor , 8 2 Cacau , 9 2 Cundado Portucalense , 10 2 René Descartes , 11 2 Francesco Redi , 12 2 Nicolau Copérnico , 13 2 Miguel Ángelo , 14 1 San Paulo

mar 2010: 1 3 Ampério Pertués , 2 3 Lhista de reis de Lhion , 3 3 Afonso de Albuquerque , 4 3 Pedro Álvares Cabral , 5 3 Bartolomeu Dias , 6 3 Ramiro I de las Astúrias , 7 3 Londres , 8 3 Guerra Cebil Amaricana , 9 2 Region de Turismo de l Nordeste Trasmuntano , 10 2 Banco Ouropeu de Ambestimiento , 11 2 Comité Eiquenómico i Social Ouropeu , 12 2 Tribunal de Cuontas Ouropeu , 13 2 Tribunal de Justícia de la Ounion Ouropeia , 14 2 Comisson Ouropeia , 15 2 Carlos Ferreira , 16 2 Domingos Raposo , 17 2 Tratado de Roma , 18 2 Quemunidade Eiquenómica Ouropeia , 19 2 Quemunidade Ouropeia de l Carbon i de l Aço , 20 2 Asterix l Goulés , 21 2 San Poulo (cidade) , 22 2 Península Eibérica , 23 2 Hip hop , 24 2 Rap , 25 2 José Rodrigues

abr 2010: 1 3 Barbacena , 2 3 Grande Barreira de Coral , 3 3 Montes Urales , 4 3 Jean Monnet , 5 3 Rómulo Ougusto , 6 3 Javier Solana , 7 3 Política de Defesa i de Sigurança Quemun , 8 3 Parlamiento Ouropeu , 9 3 Reino de la Galízia , 10 3 Reboluçon Russa de 1917 , 11 2 Defesa pessonal , 12 2 Hans Christian Andersen , 13 2 Reino de Kent , 14 2 Mar Cáspio , 15 2 São José (Paulínia) , 16 2 Ilhas Británicas , 17 2 Península , 18 2 Riu Ural , 19 2 Capital , 20 2 Tierra Caliente , 21 2 Tierra Frie , 22 2 Gran-ducado de la Toscana , 23 2 Tribunal de Justícia de la Ounion Ouropeia , 24 2 Comisson Ouropeia , 25 2 Ambason muçulmana de la península Eibérica

mai 2010: 1 3 Stória de Sacaben , 2 3 Lhéngua mirandesa , 3 2 Whiteberry , 4 2 Laura Pausini , 5 2 Abade de Baçal , 6 2 Mário Correia , 7 2 Cungregaçon Crestiana an Pertual , 8 1 Riu Teijo

jun 2010: 1 2 Assemblé de Dius , 2 1 Diogo Cão

jul 2010: 1 2 Branco , 2 2 Recén-nacido , 3 1 Bietname

ago 2010: 1 2 Sacaben , 2 1 António Fragoso

set 2010: 1 4 Japon , 2 3 The Beatles , 3 2 Alcoron , 4 1 Tequixquiac

out 2010: 1 3 Mérida (Benezuela) , 2 2 Appert , 3 1 Riu Sado

nov 2010: 1 2 Spanha , 2 1 Vepric

dez 2010: 1 1 ETA

jan 2011: 1 3 Concepción (Chile) , 2 3 Amplantaçon de la República Pertuesa , 3 2 Çtrito de Portalegre , 4 2 Çtrito de Lhisboua , 5 2 Çtrito de Lheirie , 6 2 Çtrito de la Guarda , 7 2 Çtrito de Faro , 8 1 Distrito de Vila Real

fev 2011: 1 3 Aritmética , 2 1 Pertual Cuntinental

mar 2011: 1 2 Stur-lhionés , 2 1 Lech Wałęsa

abr 2011: 1 2 Mimas , 2 2 Homo sapiens , 3 2 Almanha , 4 2 Concepción (Chile) , 5 2 Io , 6 2 Monarquie , 7 1 John Lennon

mai 2011: 1 2 Rede Globo , 2 1 Polónia

jun 2011: 1 2 Ounibersidade de l Bío-Bío , 2 1 Talcahuano

jul 2011: 1 2 Galandum Galundaina , 2 1 KrioRus

ago 2011: 1 2 Polónia , 2 2 Maomé , 3 1 Sergei Brukhonenko

set 2011: 1 1 Danila Medvedev

out 2011: 1 2 Paltoga , 2 2 Stória de l Brasil , 3 2 Brasil República , 4 2 Ancunfidéncia Mineira , 5 1 Ludmilla Radchenko

nov 2011: 1 2 Ouceano Atlántico , 2 1 Marie-George Buffet

dez 2011: 1 2 Riu Danúbio , 2 2 Mobelizaçon studantil ne l Chile an 2011 , 3 1 Riu Reno

jan 2012: 1 2 Frances Ruffelle , 2 2 Miro Šmajda , 3 1 Slobáquia

fev 2012: 1 3 Anastacia , 2 2 Sofia Vitória , 3 2 Tejeira , 4 2 Eva Gonzalès , 5 2 Armando Gama , 6 2 Eduardo Nascimento , 7 2 Madalena Iglésias , 8 2 Festibal Ourobison de la Cançon , 9 1 Voyage, Voyage

mar 2012: 1 3 Paranaguá , 2 2 Bulgária , 3 2 Eislándia , 4 2 Grécia , 5 2 Coca-Cola , 6 2 Adelaide Ferreira , 7 2 Flor-de-Lis (banda) , 8 1 2B

abr 2012: 1 2 Buranovskiye Babushki , 2 2 Catona , 3 2 Riu Volga , 4 1 Bomba atómica

mai 2012: 1 3 Rei Momo , 2 2 François Hollande , 3 1 Rafael Correa

jun 2012: 1 3 Avril Lavigne , 2 2 Wikipedia , 3 1 Should've Known Better

jul 2012: 1 2 Anielho de tucun

ago 2012: 1 1 Pussy Riot

set 2012: 1 2 Riu Biobío , 2 1 Guilin

out 2012: 1 2 Caselle Landi , 2 2 Semitério de Pistoia , 3 1 Lu Xun

nov 2012: 1 1 Staçon Spacial Anternacional

dez 2012: 1 2 Orlando Drummond , 2 1 Frei Betto

jan 2013: 1 2 Maccastorna , 2 2 Meleti , 3 1 Semitério Municipal de Condera

fev 2013: 1 2 Lhéngua mirandesa , 2 1 A:RL

mar 2013: 1 2 Pardo de Cela , 2 2 Eislándia , 3 1 Xuxa

abr 2013: 1 1 Atentado na maratora de Boston

mai 2013: 1 1 Midlands Oucidentales

jun 2013: 1 1 Ilha de Wight

jul 2013: 1 1 Paramore

ago 2013: 1 1 Souto de Aguiar da Beira i Valverde

set 2013: 1 2 Mobeliário , 2 1 Zinco

out 2013: 1 1 Putin

nov 2013: 1 1 Cungregaçon Crestiana ne l Brasil

dez 2013: 1 2 Coreca

jan 2014: 1 1 Monção

fev 2014: 1 1 Praça Diogo de Vasconcelos

mar 2014: 1 1 Yun Hyon-seok

abr 2014: 1 2 Vladimir Putin , 2 1 Club Social y Deportivo Colo-Colo

mai 2014: 1 1 Iksu

jun 2014: 1 2 Lila Tretikov , 2 2 Ronald Reagan , 3 1 Riu Andalién

jul 2014: 1 1 Srinivasa Ramanujan

ago 2014: 1 1 Andonésia

set 2014: 1 1 Papa Fracisco

out 2014: 1 1 Maurizio Malvestiti

nov 2014: 1 1 Biobío (region)

dez 2014: 1 1 Mimória

jan 2015: 1 1 Thomas Edison

fev 2015: 1 2 Família

mar 2015: 1 1 Begetarianismo

abr 2015: 1 2 Triton (satélite) , 2 1 Murasaki Shikibu

mai 2015: 1 1 Pan

jun 2015: 1 2 Lhéngua spanhola , 2 1 Valery Leontiev

jul 2015: 1 2 Caronte (satélite) , 2 1 Adam Smith

ago 2015: 1 1 Arquidiocese de Saurimo

set 2015: 1 2 Eigreija de San José Ouperário (Macau) , 2 1 Maçana

out 2015: 1 1 Anquanto la Lhéngua fur Cantada

nov 2015: 1 1 Riu de Janeiro

dez 2015: 1 2 Sol negro (símbolo) , 2 1 Łobez

jan 2016: 1 1 The Jerusalem Post

fev 2016: 1 3 Mickey Mouse

mar 2016: 1 2 Valery Leontiev , 2 1 Apaxco

abr 2016: 1 1 Lagos

mai 2016: 1 1 Amor

jun 2016: 1 1 Marco Polo

jul 2016: 1 1 Áurea

ago 2016: 1 2 Silybum , 2 1 Finlándia

set 2016: 1 1 Trindade (Goiás)

out 2016: 1 1 Lhéngua japonesa

nov 2016: 1 2 Campinas , 2 1 Fidel Castro

dez 2016: 1 1 Reino de la Mércia

jan 2017: 1 2 Ferdinand Marcos , 2 2 Spanha , 3 1 Papua-Nuoba Guiné

fev 2017: 1 1 FreeBSD

mar 2017: 1 1 Tabela periódica

abr 2017: 1 2 Cristiano Ronaldo , 2 1 Kim Il-sung

mai 2017: 1 3 Kamo no Chomei , 2 3 Calímaco , 3 3 Beroso , 4 3 Ateneu , 5 3 Artemidoro , 6 3 Aristóbulo de Cassandreia , 7 3 Apolónio Díscolo , 8 2 Pampa Energía , 9 2 Sunan , 10 2 Sanshan , 11 2 Yaohai , 12 2 Luyang , 13 2 Baohe , 14 2 Yamamoto Tsunetomo , 15 2 Hiroyuki Owaku , 16 2 Lafcádio Hearn , 17 2 Tomioka Makoto , 18 2 Masahiro Ito , 19 2 Mikiyo Tsuda , 20 2 Yukio Mishima , 21 2 Yoshida Kenkō , 22 1 Moustapha Alassane

jun 2017: 1 2 Brian Yuzna , 2 2 Carlos Peña Rómulo , 3 2 José Rizal , 4 2 Anand Pillay , 5 2 Marcelo Hilario del Pilar , 6 2 Bertrand Russell , 7 2 Olgierd Zienkiewicz , 8 2 Cecil Edgar Tilley , 9 2 Giovanni Arrighi

jul 2017: 1 2 Bahá'u'lláh , 2 1 Mediterráneo

ago 2017: 1 2 Cidade redonda de Bagdade , 2 1 Naan

set 2017: 1 1 Páigina Percipal

out 2017: 1 1 Noruega

nov 2017: 1 1 Stónia

dez 2017: 1 2 África de l Sul , 2 2 Eiboluçon , 3 1 Deniç de Pertual

jan 2018: 1 1 Euskal Herria

fev 2018: 1 3 Festa da Palabra Silenciada , 2 2 Solhapa de Chaves , 3 2 Cumbento de Santa Bárbela de la Corunha , 4 2 Cadena de la Relaçon , 5 2 Políptico de l Cumbento de San Fracisco de Ébora , 6 2 Doutrina de la Eigreija Católica , 7 1 Grupo Desportivo de Sendim

mar 2018: 1 2 Panteon de Galhegos Eilustres , 2 2 Caça de balenas na Galízia , 3 2 Takekazu Asaka , 4 2 Houmano

abr 2018: 1 2 Doze Apóstelos de la Eirlanda , 2 2 Mobhí Clárainech , 3 1 Sesta

mai 2018: 1 1 Carocho

Wikipedias are initially ordered by number of speakers of the language

Speakers: Number of speakers of a language is the estimated total of primary and secondary speakers, is in many cases a very rough estimation (based on the page on the English Wikipedia about that language)
Regions are parts of the world where the language is spoken in substantial amounts (compared to total number of speakers). Regions where a language gained presence only by a recent diaspora are generally not included.
Region codes: AF:Africa, AS:Asia, EU:Europe, NA:North America, OC:Oceania, SA:South America, W:World Wide, CL:Constructed Language

Estatísticas geradas em Sábado, 9 de junho 2018 14:47

Dump file mwlwiki-20180601-stub-meta-history.xml.gz (edits only), size 6.6 Mb as gz -> 42 Mb
Dump processed till May 31, 2018, on server stat1005, ready at Fri-01/06/2018-15:38 after 24 sec.

Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### =
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.