Estatísticas da Wikipédia mirandese

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Articles per size range / Records per namespace / Most edited articles / Zeitgeist
 
  May 2016: The major overhaul of Wikistats reports has entered a new phase.  

  First phase focused on migrating the traffic analysis reports to our new infrastructure. Those are operational now.  
  The Analytics Team will now proceed to also migrate data collection and reporting about wiki content and contributors.  
  First results are expected later this year.  

  More info at this announcement
  You can see the first wireframes for Wikistats 2.0 and comment on the design here.
  

  

Most metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.

Some metrics have been collected from the full archive dump which runs on lower frequency than the usual monthly cycle.
These metrics are columns F,I,J,K,M,N,O,P,Q,R from the first table.


See also metrics definitions


 
Monthly counts & Quarterly rankings: maio 2017
 
DataWikipedistasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
mai 2017+5%   +22%      +2576%      0%
abr 2017+2%   0%             +1%
fev 20170%   0%      -85%      0%
jan 2017+2%   +1%      +608%      +3%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P____Q____R____S__
mai 2017693523,6 k 2113,9   883      401
abr 20176611 2,9 k  16,7   33      400
mar 201765   2,9 k  16,7   13      396
fev 201765 1 2,9 k  16,7   27      396
jan 2017651212,9 k 116,8   177      396
dez 201664   2,9 k  16,9   25      384
nov 201664   2,9 k  16,9   8      384
out 201664   2,9 k  16,9   16      384
set 201664 1 2,9 k  16,9   71      384
ago 20166422 2,9 k 116,8   147      384
jul 20166211 2,8 k 117   39      376
jun 201661   2,8 k  17,2   10      376
mai 201661   2,8 k  17,1   16      376
abr 201661   2,8 k  17,1   13      376
mar 20166112 2,8 k  17,1   45      376
fev 201660   2,8 k  17,2   16      376
jan 201660   2,8 k  17,2   15      376
dez 201560   2,8 k  17,1   15      376
nov 201560   2,8 k  17,1   18      376
out 20156011 2,8 k  17,1   30      376
set 201559   2,8 k  17,2   21      374
ago 20155911 2,8 k  17,2   40      374
jul 201558   2,8 k  17,2   24      374
jun 201558   2,8 k  17,2   23      374
mai 20155811 2,8 k  17,2   227      374
abr 201557   2,8 k  17,1   22      373
mar 201557   2,8 k  17,1   20      373
fev 201557   2,8 k  17,1   10      373
jan 201557 1 2,8 k  17,1   37      373
dez 201457   2,8 k  17,1   20      371
nov 201457   2,8 k  17,1   39      371
out 2014571  2,8 k  17,1   19      369
set 20145612 2,8 k  17,1   31      367
ago 201455 1 2,8 k  17,1   30      367
jul 201455   2,8 k  17,1   15      367
jun 201455   2,8 k  17,1   30      367
mai 201455   2,8 k  17,1   36      367
abr 201455 1 2,8 k 117,2   36      367
mar 20145512 2,7 k  17,3   45      366
fev 201454   2,7 k2,6 k 17,3685484%50%4622 Mb3,1 M148 k4472099,8 k366
jan 201454 1 2,7 k2,5 k 17,3687484%51%3622 Mb3,1 M148 k4462019,8 k360
dez 20135412 2,7 k2,5 k 17,3687684%51%5722 Mb3,1 M148 k5001919,8 k359
nov 20135312 2,7 k2,5 k 17,3688984%51%5522 Mb3,1 M148 k5001919,8 k355
out 20135223 2,7 k2,5 k 17,4691684%51%4322 Mb3,1 M147 k5001919,8 k350
set 2013502222,7 k2,5 k3217,4692584%51%97022 Mb3,1 M147 k4661899,8 k349
ago 20134812 1,7 k1,6 k126,4811981%57%6317 Mb2,4 M115 k3941876,5 k349
jul 201347 1 1,7 k1,6 k 26,9812083%58%3317 Mb2,4 M115 k6551856,4 k349
jun 201347 1 1,7 k1,6 k126,9813383%58%10517 Mb2,4 M115 k6771826,4 k347
mai 201347 311,7 k1,6 k427,4828083%59%32617 Mb2,4 M115 k7061826,4 k338
abr 20134723 1,6 k1,4 k129,3822382%58%17015 Mb2,2 M109 k6981816,0 k311
mar 201345 111,5 k1,4 k129,5828682%58%2,0 k15 Mb2,2 M109 k2,9 k1795,9 k311
fev 201345 2 1,5 k1,4 k 29844083%59%74118 Mb2,2 M108 k90 k1495,8 k310
jan 2013451411,5 k1,4 k128,5844583%59%1,2 k18 Mb2,2 M108 k90 k1495,8 k307
dez 2012441311,5 k1,4 k428,1850684%60%1,0 k18 Mb2,2 M108 k88 k1495,8 k306
nov 20124311 1,3 k1,3 k230,1860384%58%86816 Mb2,0 M99 k83 k1374,8 k291
out 20124212 1,3 k1,2 k 30,6854883%57%81015 Mb1,9 M95 k79 k904,4 k283
set 201241 1 1,3 k1,2 k 30,2856683%57%65315 Mb1,9 M95 k79 k934,4 k283
ago 201241   1,3 k1,2 k 29,9861683%57%65715 Mb1,9 M95 k78 k944,3 k283
jul 20124123 1,3 k1,2 k 29,4862184%57%83315 Mb1,9 M95 k78 k954,3 k283
jun 201239 1 1,3 k1,2 k 29867883%57%80915 Mb1,9 M95 k77 k974,3 k283
mai 201239   1,3 k1,2 k 28,4869684%58%77215 Mb1,9 M95 k76 k924,3 k282
abr 201239 2 1,3 k1,2 k 27,9870684%58%86115 Mb1,9 M95 k76 k914,3 k282
mar 201239 3 1,2 k1,2 k127,4899384%58%95016 Mb2,0 M95 k75 k924,3 k282
fev 20123912 1,2 k1,1 k127,2916185%59%82815 Mb2,0 M95 k73 k954,3 k281
jan 201238   1,2 k1,1 k 27,5943288%61%61215 Mb2,0 M95 k71 k934,2 k280
dez 20113812 1,2 k1,1 k 27,1945988%61%85015 Mb2,0 M95 k71 k914,2 k280
nov 20113714 1,2 k1,1 k126,6951288%61%92215 Mb2,0 M94 k70 k914,2 k280
out 20113614 1,1 k1,1 k 26,2958989%62%80515 Mb1,9 M94 k69 k884,2 k275
set 201135   1,1 k1,1 k 25,8967189%62%58815 Mb1,9 M94 k68 k854,1 k273
ago 201135 4 1,1 k1,1 k 25,3968889%62%71515 Mb1,9 M93 k68 k874,1 k271
jul 20113523 1,1 k1,1 k124,8972189%62%88915 Mb1,9 M93 k68 k874,1 k271
jun 2011331  1,1 k1,1 k 24,7994490%64%89915 Mb1,9 M93 k66 k864,0 k270
mai 201132 2 1,1 k1,0 k 24,1995390%64%76715 Mb1,9 M93 k65 k944,0 k269
abr 20113217 1,1 k1,0 k123,4996190%64%82715 Mb1,9 M93 k65 k923,9 k268
mar 201131 2 1,1 k1,0 k 23,1996991%64%96215 Mb1,9 M91 k63 k923,8 k267
fev 201131 1 1,1 k1,0 k 22,31001191%64%69814 Mb1,9 M91 k62 k883,8 k267
jan 2011311511,0 k1,0 k121,81008491%64%1,3 k14 Mb1,9 M91 k61 k913,8 k265
dez 201030 1 1,0 k987 211033391%65%75314 Mb1,9 M91 k60 k903,8 k241
nov 201030 1 1,0 k978 20,51039191%66%64514 Mb1,9 M90 k59 k913,8 k240
out 20103016 1,0 k975119,91042491%66%70214 Mb1,9 M90 k59 k963,8 k238
set 20102924 992959 19,51055791%66%71914 Mb1,9 M90 k57 k973,8 k236
ago 201027 2 977951 19,11061592%67%98014 Mb1,9 M89 k56 k973,7 k233
jul 20102713 967941 18,31068492%67%70914 Mb1,9 M89 k55 k1023,7 k232
jun 20102611 952925 17,81083692%68%73014 Mb1,8 M89 k54 k1083,7 k230
mai 201025 3 947918 17,11079891%67%72814 Mb1,8 M88 k53 k1093,6 k230
abr 201025 52935908116,61091191%68%1,1 k14 Mb1,8 M88 k52 k1083,6 k229
mar 201025281907880315,81121692%68%1,3 k14 Mb1,8 M87 k51 k1463,6 k217
fev 201023 9 8178011161188393%69%85213 Mb1,7 M81 k46 k1573,4 k185
jan 201023363791775115,51211193%70%2,3 k13 Mb1,7 M79 k45 k1663,3 k168
dez 200920251754737 13,21275892%70%83812 Mb1,7 M77 k42 k2763,3 k119
nov 200918241750733 12,11275892%69%1,2 k12 Mb1,6 M76 k41 k6173,3 k116
out 200916 42742723110,71329992%70%1,1 k12 Mb1,6 M76 k40 k1,3 k3,2 k96
set 200916571716699 9,51383292%71%99312 Mb1,6 M75 k32 k1,6 k3,1 k80
ago 20091115170668618,31446292%71%2,3 k12 Mb1,6 M75 k25 k2,8 k3,1 k62
jul 200910 1 678662 5,21532593%73%4112 Mb1,6 M74 k13 k2,8 k3,1 k60
jun 200910 2167566155,11533793%74%51412 Mb1,6 M74 k13 k2,8 k3,1 k60
mai 200910 2152250615,61384891%70%1538,1 Mb1,1 M52 k12 k2,2 k2,0 k51
abr 20091026247946475,81286891%70%5836,9 Mb945 k47 k12 k2,0 k1,6 k47
mar 2009813126725218,31050284%59%2913,3 Mb428 k21 k11 k91284633
fev 2009735222520938,5870981%55%7252,4 Mb295 k16 k10 k72462729
jan 20094 2114213018,4528274%39%305972 kb118 k5,7 k5,0 k27316018
dez 20084 511058828,5229962%21%452316 kb38 k1,7 k1,8 k1267414
nov 20084 2 5740 7,769249%4%4353 kb6,3 k20120715294
out 20084   5438 7,365448%4%749 kb5,8 k15919216264
set 20084   5338 7,366349%4%149 kb5,7 k15719216254
ago 20084   5338 7,366349%4% 49 kb5,7 k15719216254
jul 2008422 5338 7,366349%4%3749 kb5,7 k15719216254
jun 20082   5137 6,963649%2%1441 kb5,5 k1246510244
mai 20082 1 493516,962047%2%9839 kb5,1 k1156110174
abr 20082   2620 9,259446% 8321 kb2,6 k73261092
mar 20082   1813 8,656650% 2814 kb1,7 k6410912
fev 2008222 149 9,158250% 12711 kb1,3 k563912
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
The following table ranks this project in relation to projects in other languages with 1000+ articles
abr 2017176132196 205  160   200      276
jan 2017177141169138201 149159   157      276
out 2016175   202  156   232      276
jul 2016176137203 201 140158   192      276
abr 2016175   201  158   232      276
jan 2016175   196  159   235      276
out 2015174135203 195  163   211      276
jul 2015175   193  166   209      276
abr 2015172   192  165   233      276
jan 2015171 194 189  162   200      276
out 2014169145  188  164   217      276
jul 2014172   186  163   232      276
abr 2014165 205 181 153163   214      276
jan 20141651741931481801591591641539206114105107190235116276
out 20131641121581301791591501672529193115104107194234117276
jul 2013170144191138201182160911543200121107110183234124276
abr 2013168101157152205184154711563187124108111187235125276
jan 2013173137137144203181151701502179133107111193241125276
out 2012172140172140207182152601442196139108113196250132276
jul 2012172100157146205183156661422196135108113196248131276
abr 2012171141174150202180153721381196133105111194250124276
jan 2012169160232145206180152711241201130105109194247122276
out 2011168138140151205179164771181199127102107192247120276
jul 2011168113153145202175159841161193122102106189245119276
abr 201117213410413620217014893111118811897102188239117276
jan 2011169142129131200164151101110118311996101185242116276
out 201016814411213519416314511319118811795101182234110276
jul 201017014416314419016116019018918818619011692100180232110276
abr 20101701571191021871611461871861851841671139198176232110276
jan 201017181121851881641441841841831821181149199175217110276
out 2009195149125971891621521821821811801601139098174122105276
jul 2009225197193137186164153175175174173248109889721594105276
abr 20092199911410619617283172172171170175128100105212105120276
jan 2009257136163128228212140167167166165204201168170229189190275
out 2008253142210137244234147161161160159262261243246263256232273
jul 2008248103168135240228150155155154152248256239243262252224272
abr 2008262153219133252237154150150148146222260248250263255240272
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
 WikipedistasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikipedistas (usuários registrados)
A = Wikipedistas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikipedistas que editaram pelo menos dez vezes desde que chegaram
C = Wikipedistas que contribuíram cinco vezes ou mais este mês
D = Wikipedistas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Artigos que contêm pelo menos uma ligação interna e 200 caracteres de texto legível, não contando códigos wiki e html,
      ligações ocultas, etc.; títulos também não contam (outras colunas são baseadas no método oficial de contagem)
G = Novos artigos por dia no mês passado
H = Número médio de revisões por artigo
I = Tamanho médio dos artigos em bytes
J = Porcentagem de artigos com pelo menos 0,5 kb de texto legível (veja F)
K = Porcentagem de artigos com pelo menos 2 kb de texto legível (veja F)

Base de dados
L = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
M = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
N = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
O = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
P = Total de ligações para outras wikipédias
Q = Total de imagens apresentadas
R = Total de ligações para outros sítios
S = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  5  10  100  1000  1  3  5  10  25  100  250  5  10  1  3  5  10  25  100  250  1000  5  10  100  1000 
mai 201711655222 1   1        3111        
abr 20171111    1   1        111         
mar 201751                 2           
fev 20177111       1        421         
jan 20171122111      311      5222211     
dez 20163                  21          
nov 20166                  1           
out 201652                 211         
set 20165111   11           1           
ago 2016102222      11       431         
jul 201633111  1   2        2111        
jun 20167                  1           
mai 201673        1        2           
abr 20166         2        21          
mar 20166321                1           
fev 20167     1                        
jan 20168     1   5        6           
dez 2015101                 621         
nov 201541    1   2        911         
out 20154111                3       1   
set 201510     1   4        2           
ago 2015511    21  2        72      11  
jul 201581        1        1           
jun 20157     1            1           
mai 201581111  211          1           
abr 201510     1   2      223           
mar 201512         5      113           
fev 20153         31       51          
jan 2015811    11  52       31          
abr 20171111    1   1        111         
jan 20171122111      311      5222211     
out 201652                 211         
jul 201633111  1   2        2111        
abr 20166         2        21          
jan 20168     1   5        6           
out 20154111                3       1   
jul 201581        1        1           
abr 201510     1   2      223           
jan 2015811    11  52       31          
out 201410                  3           
jul 20145         1        2           
abr 20147111       1        5           
jan 2014921    11  1        61          
out 20131843        1        51          
jul 20131021        1        3           
abr 201313332   43  1        11211    552 
jan 20131264211  18123 62111    12532111 11113 
out 2012942    1493 1        1121     11103 
jul 201213431   1883 1        12111    12102 
abr 201214321   16153 31       911     1292 
jan 201292    15111 1        101      12111 
out 20111764    23161          1132     15123 
jul 2011123321  22132 3        84311   1191 
abr 201114773   14124 1        12531    121121
jan 20111055321  20143 41       163221   16144 
out 2010147631  17111 3        162211   1392 
jul 201011531   18121 3        93111   1182 
abr 201010654421 1581 1042      137433   1092 
jan 20101276663111592 9332     159975211431 
out 20091464422  16121 84211    11532    43  
jul 200921111               1111        
abr 20096666421     3111     33322       
jan 2009422221      3111     54221       
out 2008                               
jul 20082222       1        41          
abr 20081                  21          

 

Distribuição de edições de artigos por wikipedistas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikipedistasEdições total
1549100.0%14,500100.0%
313424.4%13,90795.9%
106812.4%13,53493.3%
32376.7%12,98889.6%
100224.0%12,25084.5%
316122.2%10,24970.7%
100030.5%5,88540.6%

 

10 wikipedistas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdições 
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
 agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
CatrapimbaUC8...441441--mai 17, 201713308308--
Bitus15UC12...361361--mai 01, 201729316316--
AlchimistaUC15-229623297-ago 13, 20092847149--
DARIO SEVERIUC20 013221801mar 16, 2016440284--
BillinghurstUC50+17519175-jul 03, 2012179232--
Poco a pocoUC173+8731--mai 08, 2016387----
JijinhaUC178...33--mai 22, 2017811--
YahadzijaUC268...22--mai 01, 201729----
SobejaUC548...11--mai 10, 20172011--
NickKUC549...1111mai 17, 201713----

 

20 wikipedistas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
  Primeira ediçãoúltima edição
 posiçãototaldatadias
atrás
datadias
atrás
PisonesUC12,091dez 06, 20092732mai 03, 20131488
CecílioUC22,070jul 29, 20083227fev 09, 20102667
ChabiUC31,724fev 24, 20083383jul 05, 20121790
SPQRobinUC4755fev 23, 20093018jun 03, 20112188
ZeEstevesUC5565set 14, 20131354set 16, 20131352
Manuel de SousaUC6553jan 24, 20102683mar 08, 20131544
GarsdUC7531jan 15, 20131596mar 24, 20131528
AmaralUC9394set 18, 20131350set 18, 20131350
HexadecimalUC10385abr 15, 20131506jun 03, 20131457
NaviaTVUC11379jan 25, 20102682mai 14, 20102573
El estremeñuUC13307set 20, 20092809jan 04, 20102703
CarnelianSuthUC14307nov 18, 20121654dez 12, 20121630
EspadeiroUC16234set 08, 20092821out 27, 2016215
Gato PretoUC17173set 25, 2015613mar 22, 201769
Midnight GreenUC18159nov 16, 20112022ago 11, 20121753
MiguelcrUC19137fev 15, 20083392dez 30, 20111978
IshiaiUC21129mai 29, 20102558jun 08, 20141087
Isaac MansurUC22127nov 05, 20092763jan 16, 20102691
Luigi Salvatore VadacchinoUC2375nov 10, 20102393set 05, 2015633
VargenauUC2471fev 05, 20112306set 07, 2016265

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 1.556 edições foram feitas por usuários anônimos, de um total de 49.546 edições ( 3e %)
  


50 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições 
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
 datadias
atrás
datadias
atrás
XqbotUC14,538set 01, 20092828jan 18, 201713216-
EmausBotUC23,877jun 26, 20102530abr 18, 20174216-
Luckas-botUC33,421set 03, 20092826mai 20, 201218363-
MerlIwBotUC41,847mai 07, 20112215ago 08, 201313919-
WikitanvirBotUC51,545nov 07, 20102396abr 21, 20121865--
SieBotUC61,522ago 14, 20092846jan 25, 20112317--
ZéroBotUC71,409nov 03, 20102400mar 06, 2013154617-
MelancholieBotUC81,362ago 13, 20092847nov 28, 20092740--
TXiKiBoTUC91,252set 21, 20092808jan 08, 20131603--
LegobotUC10839mar 11, 20131541abr 02, 2013151950-
VolkovBotUC11833ago 16, 20092844fev 28, 20131552--
AddbotUC12752mar 07, 20131545ago 16, 201313832-
EscarbotUC13664mar 07, 20102641set 07, 20162655-
FoxBotUC14660out 03, 20092796fev 05, 20121941--
TjBotUC15544nov 17, 20102386mar 06, 201315465-
ArthurBotUC16482ago 24, 20092836nov 17, 20112021--
RedBotUC17391set 08, 20102456ago 21, 201217434-
Ripchip BotUC18380mar 06, 20112277fev 18, 20121928--
HRoestBotUC19376jun 19, 20102537fev 14, 201315661-
Idioma-botUC20366out 30, 20092769fev 10, 201315702-
KamikazeBotUC21361jul 04, 20102522jan 24, 20131587--
AvocatoBotUC22349out 20, 20112049fev 27, 20131553--
CommonsDelinkerUC23336dez 25, 20083078mai 30, 2017-91
JackieBotUC24289jan 15, 20112327mar 07, 201315454-
JAnDbotUC25285ago 14, 20092846jul 03, 20131427--
AlexbotUC26281ago 17, 20092843ago 14, 20112116--
Thijs!botUC27272mai 04, 20102583jul 30, 201217651-
LaaknorBotUC28269out 02, 20092797fev 16, 201315642-
RobbotUC29252set 23, 20092806jan 02, 20131609--
MjbmrbotUC30234out 15, 20102419mar 28, 20112255--
Movses-botUC31226dez 22, 20102351mar 18, 20121899--
RubinbotUC32203set 13, 20092816mar 02, 201315501-
DexbotUC33180out 17, 20121686mai 25, 201573621-
Dinamik-botUC34179fev 14, 20102662dez 18, 20121624--
MastiBotUC35178dez 10, 20092728mar 01, 20131551--
GerakibotUC36171jan 11, 20102696mar 04, 201315481-
AvicBotUC37169jun 18, 20112173dez 09, 20121633--
JotterbotUC38159out 05, 20092794jan 24, 20131587--
VagobotUC39158out 18, 20112051set 19, 20121714--
AmirobotUC40131mai 04, 20102583nov 19, 20112019--
MystBotUC41122jan 23, 20102684fev 05, 20121941--
Makecat-botUC42120out 28, 20121675mar 04, 201315483-
YFdyh-botUC43109jun 18, 20121807fev 13, 201315672-
JhsBotUC44103mai 18, 20102569mar 29, 20121888--
HerculeBotUC45100ago 28, 20092832jul 13, 20121782--
CocuBotUC46100jun 09, 20112182dez 26, 20121616--
CarsracBotUC4795ago 16, 20092844fev 12, 20131568--
HiW-BotUC4891set 18, 20112081out 19, 201216841-
SilvonenBotUC4986set 08, 20092821dez 19, 20121623--
DSisyphBotUC5085nov 22, 20092746ago 27, 20121737--

 

Artigos que contêm pelo menos uma ligação interna e .. caracteres de texto legível, não contando códigos wiki e html,
ligações ocultas, etc.; títulos também não contam  (excluindo páginas de redirecionamento)

DataArtigos
 < 32 ch< 64 ch< 128 ch< 256 ch< 512 ch< 1 k ch< 2 k ch< 4 k ch< 8 k ch< 16 k ch< 32 k ch< 64 k ch
out 20107.5%11.1%12.9%15.4%19.6%28.7%41.8%56.0%69.1%81.6%91.0%97.4%
set 20107.6%11.1%13.1%15.4%19.4%28.5%41.6%55.7%68.7%81.2%90.9%97.4%
ago 20107.6%11.2%12.7%15.0%19.0%28.0%41.2%55.4%68.5%81.2%90.9%97.5%
jul 20107.6%11.1%12.6%15.0%19.0%27.6%40.9%55.1%68.3%81.0%90.8%97.4%
jun 20107.8%11.2%12.9%15.2%19.1%27.3%40.3%54.4%67.8%80.7%90.7%97.4%
mai 20107.8%11.2%13.0%15.3%19.2%27.3%40.5%54.6%67.9%80.9%90.7%97.4%
abr 20107.8%11.3%13.0%15.3%19.2%27.3%40.2%54.3%67.4%80.5%90.5%97.3%
mar 20107.1%10.5%12.3%14.7%18.5%26.2%39.4%53.0%66.5%80.1%90.4%97.2%
fev 20106.8%9.8%10.7%13.3%16.9%24.6%38.2%51.3%65.1%78.8%89.7%97.1%
jan 20106.6%9.1%10.1%12.7%16.1%23.5%37.3%50.6%64.5%78.1%89.2%96.9%
dez 20095.7%7.4%8.5%11.4%14.9%22.9%35.8%48.4%62.4%76.6%88.5%96.6%
nov 20095.5%7.2%8.3%11.2%14.8%23.1%36.0%48.6%62.4%76.6%88.5%96.6%
out 20093.9%4.9%5.4%8.2%11.7%19.9%33.3%46.5%61.0%75.9%88.2%96.5%
set 20092.2%2.7%3.2%5.9%9.4%17.3%30.5%44.0%59.0%74.9%87.8%96.2%
ago 20090.3%0.6%1.0%4.0%7.4%15.2%28.5%42.1%57.4%74.0%87.3%96.1%
jul 20090.1%0.5%0.8%3.9%6.7%14.1%26.3%38.8%54.9%72.4%86.2%95.6%
jun 20090.1%0.5%0.8%3.9%6.6%14.0%26.2%38.7%54.8%72.4%86.3%95.7%
mai 20090.2%1.2%1.6%5.1%8.4%17.0%29.9%42.2%56.6%74.3%87.5%97.5%
abr 20090.2%1.2%1.6%5.2%8.8%17.4%29.7%41.6%55.6%74.0%88.2%98.0%
mar 20090.4%2.3%3.1%8.8%15.2%27.3%40.1%52.9%62.3%77.4%90.6%98.9%
fev 20090.4%2.2%3.5%10.7%17.4%30.9%44.4%58.3%66.8%82.0%91.9%99.5%
jan 20090.7%4.1%6.2%17.2%26.9%44.8%61.4%73.1%78.6%88.3%95.9%100.0%
dez 20081.0%8.6%11.5%25.8%38.2%61.1%79.2%88.7%91.6%96.4%100.0%100.0%
nov 20081.8%18.2%23.7%38.2%49.1%76.4%96.4%100.0%100.0%100.0%100.0%100.0%
out 20083.8%18.9%24.6%39.7%51.0%79.3%96.3%100.0%100.0%100.0%100.0%100.0%
set 20083.8%19.2%25.0%38.5%50.0%78.8%96.1%99.9%99.9%99.9%99.9%99.9%
ago 20083.8%19.2%25.0%38.5%50.0%78.8%96.1%99.9%99.9%99.9%99.9%99.9%
jul 20083.8%19.2%25.0%38.5%50.0%78.8%96.1%99.9%99.9%99.9%99.9%99.9%
jun 20083.9%19.6%25.5%37.3%51.0%80.4%98.0%100.0%100.0%100.0%100.0%100.0%
mai 20084.1%20.4%26.5%38.7%53.0%81.6%97.9%99.9%99.9%99.9%99.9%99.9%
abr 20080.0%11.5%15.3%34.5%53.7%84.5%99.9%99.9%99.9%99.9%99.9%99.9%
mar 20080.0%5.6%11.2%33.4%50.1%89.0%100.0%100.0%100.0%100.0%100.0%100.0%
fev 20080.0%7.7%15.4%38.5%46.2%84.7%100.0%100.0%100.0%100.0%100.0%100.0%

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110
mai 20174,0 k709139 1884082,6 k       
abr 20173,3 k708139 1883482,6 k       
mar 20173,3 k707139 1883082,6 k       
fev 20173,3 k707139 1883082,6 k       
jan 20173,3 k705139 1883082,6 k       
dez 20163,2 k70275 1882462,2 k       
nov 20163,2 k70275 1882462,2 k       
out 20163,2 k70275 1882462,2 k       
set 20163,2 k70275 1882362,2 k       
ago 20163,2 k70175 1882362,2 k       
jul 20163,2 k69975 1882362,2 k       
jun 20163,2 k69875 1881562,2 k       
mai 20163,2 k69875 1881562,2 k       
abr 20163,2 k69775 1881562,2 k       
mar 20163,2 k69375 1881562,2 k       
fev 20163,2 k69375 1881562,2 k       
jan 20163,2 k69375 1881562,2 k       
dez 20153,2 k69375 1881462,2 k       
nov 20153,2 k68575 1881362,2 k       
out 20153,2 k68373 1881362,2 k       
set 20153,1 k68373 1880662,2 k       
ago 20153,1 k68173 1880662,2 k       
jul 20153,1 k68072 1880262,2 k       
jun 20153,1 k67972 1880262,2 k       
mai 20153,1 k67972 1880262,2 k       
abr 20153,1 k67972 1880262,2 k       
mar 20153,1 k67772 1880262,2 k       
fev 20153,1 k67572 1878962,2 k       
jan 20153,1 k67172 1878962,2 k       
dez 20143,1 k66772 1878962,2 k       
nov 20143,1 k66772 1878962,2 k       
out 20143,1 k66572 1878962,2 k       
set 20143,1 k66372 1878962,2 k       
ago 20143,1 k65772 1878962,2 k       
jul 20143,1 k65272 1878962,2 k       
jun 20143,1 k65172 1876462,2 k       
mai 20143,1 k65172 1876252,2 k       
abr 20143,1 k64772 1876252,2 k       
mar 20143,0 k64472 1876252,2 k       
fev 20143,0 k64072 1876242,2 k      9
jan 20143,0 k63572 1876222,2 k      17
dez 20133,0 k63172 1876222,2 k      50
nov 20133,0 k62972 1876222,2 k      35
out 20133,0 k62371 1876222,2 k      38
set 20133,0 k61871 1876222,2 k      965
ago 20132,1 k60571 1876222,2 k      46
jul 20132,0 k60171 1875522,2 k      20
jun 20132,0 k59871 1875522,2 k      95
mai 20132,0 k59771 1869022,2 k      312
abr 20131,8 k59071 1846022,2 k      46
mar 20131,8 k57171 1845222,2 k      318
fev 20131,7 k46260 1845112,2 k      55
jan 20131,7 k44051 1844912,2 k      232
dez 20121,7 k43051 1644912,1 k      252
nov 20121,6 k41551 1642512,1 k      111
out 20121,5 k41451 1641512,1 k      27
set 20121,5 k40951 1541512,1 k      17
ago 20121,5 k40251 1541412,1 k      6
jul 20121,5 k39751 1541412,1 k      45
jun 20121,5 k39251 1541412,1 k      26
mai 20121,5 k38251 1541412,1 k      24
abr 20121,5 k37551 1541412,1 k      37
mar 20121,5 k36351 1541412,1 k      106
fev 20121,5 k36051 1541312,1 k      94
jan 20121,5 k34651 1541312,1 k      18
dez 20111,5 k33851 1541312,1 k      68
nov 20111,4 k33251 1441012,1 k      66
out 20111,4 k31451 1441012,1 k      46
set 20111,4 k30451 1340912,1 k      12
ago 20111,4 k29451 1340812,1 k      45
jul 20111,4 k29051 1340812,1 k      61
jun 20111,4 k28151 1140712,1 k      15
mai 20111,4 k27751 1140612,0 k      35
abr 20111,3 k27051 1140512,0 k      79
mar 20111,3 k26251 1140412,0 k      57
fev 20111,3 k25451 1037812,0 k      30
jan 20111,3 k24751 737812,0 k      263
dez 20101,3 k23949 337412,0 k      17
nov 20101,3 k23449 337412,0 k      16
out 20101,2 k22549 237412,0 k      89
set 20101,2 k21248 234212,0 k      57
ago 20101,2 k20148 234212,0 k      23
jul 20101,2 k18348 234112,0 k      36
jun 20101,2 k17948 233912,0 k      42
mai 20101,2 k16348 233712,0 k      84
abr 20101,2 k16048 233312,0 k      487
mar 20101,1 k14848 230112,0 k      464
fev 20101,0 k13444 223811,9 k      275
jan 201095912429 221011,9 k      1764
dez 200987310026 21991811      199
nov 20098669026 21991795      588
out 20098388224 21901176      349
set 20097967523 21871166      460
ago 20097684822 11861165      976
jul 2009737116  1491149      37
jun 2009734116  1491148      507
mai 200957214  99 126      139
abr 200952514  96 113      570
mar 200929914  88 76      270
fev 200925314  73 75      668
jan 200915513  62 65      268
dez 200811413  49 26      369
nov 200856 1  21 6      42
out 200852 1  18 4       
set 200851 1  18 4       
ago 200851 1  18 4       
jul 200851 1  18 4      31
jun 200849 1  18 3       
mai 200847 1  17 3      26
abr 200825 1  17 1      1
mar 200817 1  14 1      4
fev 200814 1  14         

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

fev 2008: 1 3 Páigina Percipal , 2 2 Picuote , 3 1 Bumioso

mar 2008: 1 1 Lhéngua Mirandesa

abr 2008: 1 1 Abusejo

mai 2008: 1 1 Sociadade

jul 2008: 1 1 Cumputador

nov 2008: 1 3 Páigina Percipal , 2 2 Pertual , 3 2 Lhéngua Mirandesa , 4 1 Spanha

dez 2008: 1 4 Declaraçon Ounibersal de ls Dreitos Houmanos , 2 3 Ágreda , 3 3 Zenízio , 4 2 Spanha , 5 2 Quim Barreiros , 6 2 Cumputador , 7 2 Cebadeiros , 8 2 Bumioso , 9 2 Braga , 10 2 Bernardo Fernandes Monteiro , 11 2 Auga , 12 2 António Lobo Antunes , 13 2 Almazán , 14 2 Agallas , 15 2 Abusejo , 16 2 Abejar , 17 2 Poema La Lhéngua Mirandeza , 18 2 Nuossa Alma i Nuossa Tierra , 19 2 Manuel Sardinha , 20 2 Lhéngua Mirandesa , 21 2 La Pertuesa , 22 2 João Penha , 23 2 Joaquim Araújo , 24 2 Gaspar Arce

jan 2009: 1 2 Stória de Roma , 2 2 Stados Ounidos de la América , 3 2 Religion , 4 2 Ciéncia , 5 2 Bíblia , 6 2 Berlin , 7 2 Bandeira de Pertual , 8 2 Anternete , 9 2 Angenharie , 10 2 Andústria , 11 2 Agricultura , 12 2 Ouropa , 13 2 Nuoba Iorque , 14 2 Medio Ouriente , 15 2 Londres

fev 2009: 1 3 Sociadade , 2 3 Die de ls namorados , 3 3 Çporto , 4 2 Stória de l Crestianismo , 5 2 San Balantin , 6 2 Salude , 7 2 Rússia , 8 2 Quemido , 9 2 Cristandade , 10 2 Crestianismo , 11 2 Clima , 12 2 Ciéncias Sociales , 13 2 Cidade , 14 2 Charles Darwin , 15 2 Catolicismo , 16 2 Biologie , 17 2 Astronomie , 18 2 Artes Bisuales , 19 2 Arquitetura , 20 2 Antártica , 21 2 Anternete , 22 2 Amílcar Cabral , 23 2 América de l Norte , 24 2 Portestantismo , 25 2 Política

mar 2009: 1 3 Sendin , 2 2 Riu , 3 2 Cuntinente , 4 2 Assemblé de Dius , 5 2 Arma , 6 2 Almairo , 7 2 Paíç , 8 2 Miranda de l Douro , 9 2 Ls Lusíadas , 10 2 Lhéngua Mirandesa , 11 2 Ilha , 12 1 Sun Tzu

abr 2009: 1 3 Sismo , 2 3 Ampério Romano , 3 3 Ampério Bizantino , 4 3 Ouclides , 5 3 Max Ernst , 6 3 Luna , 7 3 Houlocausto , 8 3 Eidade de la Piedra , 9 2 Suméria , 10 2 Stendhal , 11 2 Sploraçon spacial , 12 2 Sociologie , 13 2 Siddhartha Gautama , 14 2 Sexismo , 15 2 Segunda Guerra Mundial , 16 2 Saturno , 17 2 Roald Amundsen , 18 2 Renacimiento , 19 2 Reboluçon Francesa , 20 2 Cordilheira de ls Andes , 21 2 Cleópatra , 22 2 Claude Monet , 23 2 Carl Friedrich Gauss , 24 2 Capitalismo , 25 2 Blaise Pascal

mai 2009: 1 2 Batailha de Aljubarrota , 2 2 Paç , 3 2 Oucránia , 4 2 Páigina Percipal , 5 1 Stória de la Rússia

jun 2009: 1 3 Reboluçon Amaricana de 1776 , 2 3 Antoine Lavoisier , 3 2 Stória de Pertual , 4 2 Stados Cunfederados de la América , 5 2 Caçareilhos , 6 2 Campo de Bíboras , 7 2 Bal de Frailes , 8 2 Apartheid , 9 2 Albert Einstein , 10 2 Planeta , 11 2 Pinelo , 12 2 Matela (Bumioso) , 13 2 Fiódor Dostoiévski , 14 2 Eça de Queirós , 15 1 Sílex

jul 2009: 1 1 Sikhismo

ago 2009: 1 4 Lhéngua mirandesa , 2 4 Páigina Percipal , 3 3 Wikipedia , 4 3 Brigham Young , 5 3 Antigos macedónios , 6 3 Pertual , 7 3 Eisrael , 8 2 Nefita , 9 2 Templo de Curitiba , 10 2 Stória de la Oustrália , 11 2 Stória de Cabo Berde , 12 2 Storiografie , 13 2 Stados Ounidos de la América , 14 2 Santos de ls Redadeiros Dies , 15 2 Rússia , 16 2 Roma Antiga , 17 2 Riu Missouri , 18 2 Custantino I , 19 2 Crestianismo , 20 2 Cordilheira de ls Andes , 21 2 Che Guevara , 22 2 Charles de Gaulle , 23 2 Carlos I de Spanha , 24 2 Blaise Pascal , 25 2 Bernhard Riemann

set 2009: 1 9 Lhéngua lhionesa , 2 3 Monarquie , 3 3 Lhéngua mirandesa , 4 2 Lhéngua almana , 5 2 Mórmones Fundamentalistas , 6 2 Casa de Lhion , 7 2 Anielho de l CTR , 8 2 Lhista de reis de Pertual , 9 2 Stória de Eisrael , 10 2 Stados Ounidos de la América , 11 2 Cunfucionismo , 12 2 Cleópatra , 13 2 Claude Monet , 14 2 Che Guevara , 15 2 Charles de Gaulle , 16 2 Charles Darwin , 17 2 Cao Dai , 18 2 Bíblia , 19 2 Budismo , 20 2 Berlin , 21 2 Bandeira de Pertual , 22 2 Análeze Matemática , 23 2 Andependéncia de l Brasil , 24 2 América de l Sul , 25 2 Albrecht Dürer

out 2009: 1 3 Frente Nacional para la Lhibertaçon de l Bietname , 2 2 Terça-feira , 3 2 Cultura pertuesa , 4 2 Quarta-feira , 5 2 Cannibal Corpse , 6 2 Alfabeto Fonético Anternacional , 7 2 Lheite , 8 2 Alman , 9 2 Causo genitibo , 10 2 Aníbal Barca , 11 2 Biseu , 12 2 Lhéngua stremenha , 13 2 Lhéngua asturiana , 14 2 Rede Manchete , 15 2 Stória de la quelonizaçon de las Américas , 16 2 Speranto , 17 2 Reboluçon Amaricana de 1776

nov 2009: 1 3 Lhéngua rapa nui , 2 3 Machado de Assis , 3 3 Lhéngua mirandesa , 4 2 Piotr Tchaikovski , 5 2 Templo de Nauvoo , 6 2 Ludwig van Beethoven , 7 2 Moai , 8 2 Terça-feira , 9 2 Quarta-feira , 10 2 Cannibal Corpse , 11 2 Leonel Brizola , 12 2 Saturno , 13 2 Roma , 14 2 Racismo , 15 2 Cristandade , 16 2 Crestianismo , 17 2 Chamamientos crestianos , 18 2 Bikings , 19 2 Auga , 20 2 Animal , 21 2 Planta , 22 2 Paç , 23 2 Ounion Africana , 24 2 Ouniberso , 25 2 Ouceano Pacífico

dez 2009: 1 2 Cannibal Corpse , 2 2 Pertual , 3 2 Paris , 4 1 Ls Santos de ls Redadeiros Dies

jan 2010: 1 4 Brasil Quelónia , 2 4 Bergança , 3 3 Timor-Leste , 4 3 San Tomé i Príncepe , 5 3 Moçambique , 6 3 Guiné-Bissau , 7 3 Bila Nuoba de Gaia , 8 3 Cristobo Colombo , 9 3 Dreito público , 10 3 Casa de Lhion , 11 3 Cuntinente , 12 3 Cuba , 13 3 Capitalismo , 14 3 Cachones de l Niágara , 15 3 Bumioso , 16 3 Bodun , 17 3 Bie Látea , 18 3 Bahamas , 19 3 Baca , 20 3 Abicena , 21 3 Andependéncia de l Kosobo , 22 3 América , 23 3 Fé Bahá'í , 24 3 Fonso I de Pertual , 25 3 Eiboluçon

fev 2010: 1 3 Louis Pasteur , 2 3 Francis Bacon (filósofo) , 3 3 Vasco da Gama , 4 3 Mobilha , 5 2 Sistema Brasileiro de Televisão , 6 2 Disney Club , 7 2 Mar de Timor , 8 2 Cacau , 9 2 Cundado Portucalense , 10 2 René Descartes , 11 2 Francesco Redi , 12 2 Nicolau Copérnico , 13 2 René Çcartes , 14 2 Miguel Ángelo , 15 1 San Paulo

mar 2010: 1 3 Ampério pertués , 2 3 Lhista de reis de Lhion , 3 3 Afonso de Albuquerque , 4 3 Pedro Álvares Cabral , 5 3 Bartolomeu Dias , 6 3 Ramiro I de las Astúrias , 7 3 Londres , 8 3 Guerra Cebil Amaricana , 9 2 Region de Turismo de l Nordeste Trasmuntano , 10 2 Banco Ouropeu de Ambestimiento , 11 2 Comité Eiquenómico i Social Ouropeu , 12 2 Tribunal de Cuontas Ouropeu , 13 2 Tribunal de Justícia de la Ounion Ouropeia , 14 2 Comisson Ouropeia , 15 2 Carlos Ferreira , 16 2 Domingos Raposo , 17 2 Tratado de Roma , 18 2 Quemunidade Eiquenómica Ouropeia , 19 2 Quemunidade Ouropeia de l Carbon i de l Aço , 20 2 Asterix l Goulés , 21 2 San Poulo (cidade) , 22 2 Península Eibérica , 23 2 Hip hop , 24 2 Rap , 25 2 José Rodrigues

abr 2010: 1 3 Barbacena , 2 3 Grande Barreira de Coral , 3 3 Montes Urales , 4 3 Jean Monnet , 5 3 Rómulo Ougusto , 6 3 Javier Solana , 7 3 Política de Defesa i de Sigurança Quemun , 8 3 Parlamiento Ouropeu , 9 3 Reino de la Galiza , 10 3 Reboluçon Russa de 1917 , 11 2 Defesa pessonal , 12 2 Hans Christian Andersen , 13 2 Reino de Kent , 14 2 Mar Cáspio , 15 2 San José (Paulínia) , 16 2 Ilhas Británicas , 17 2 Península , 18 2 Riu Ural , 19 2 Capital , 20 2 Tierra Caliente , 21 2 Tierra Frie , 22 2 Gran-ducado de la Toscana , 23 2 Tribunal de Justícia de la Ounion Ouropeia , 24 2 Comisson Ouropeia , 25 2 Ambason muçulmana de la península Eibérica

mai 2010: 1 3 Stória de Sacaben , 2 3 Lhéngua mirandesa , 3 2 Whiteberry , 4 2 Laura Pausini , 5 2 Abade de Baçal , 6 2 Mário Correia , 7 2 Cungregaçon Crestiana an Pertual , 8 1 Riu Teijo

jun 2010: 1 2 Assemblé de Dius , 2 1 Diogo Cão

jul 2010: 1 2 Branco , 2 2 Recén-nacido , 3 1 Bietname

ago 2010: 1 2 Sacaben , 2 1 António Fragoso

set 2010: 1 4 Japon , 2 3 The Beatles , 3 2 Alcoron , 4 1 Tequixquiac

out 2010: 1 3 Mérida (Benezuela) , 2 2 Appert , 3 1 Riu Sado

nov 2010: 1 2 Spanha , 2 1 Vepric

dez 2010: 1 1 ETA

jan 2011: 1 3 Concepción (Chile) , 2 3 Amplantaçon de la República Pertuesa , 3 2 Çtrito de Portalegre , 4 2 Çtrito de Lhisboua , 5 2 Çtrito de Lheirie , 6 2 Çtrito de la Guarda , 7 2 Çtrito de Faro , 8 1 `Abdu'l-Bahá

fev 2011: 1 3 Aritmética , 2 1 Pertual Cuntinental

mar 2011: 1 2 Asturo-lheonés , 2 1 Lech Wałęsa

abr 2011: 1 2 Mimas , 2 2 Homo sapiens , 3 2 Almanha , 4 2 Concepción (Chile) , 5 2 Io , 6 2 Monarquie , 7 1 Jonh Lennon

mai 2011: 1 2 Rede Globo , 2 1 Polónia

jun 2011: 1 2 Ounibersidade de l Bío-Bío , 2 1 Talcahuano

jul 2011: 1 2 Galandum Galundaina , 2 1 KrioRus

ago 2011: 1 2 Polónia , 2 2 Maomé , 3 1 Sergey Bryukhonenko

set 2011: 1 1 Anterlhéngua

out 2011: 1 2 Paltoga , 2 2 Stória de l Brasil , 3 2 Brasil República , 4 2 Ancunfidéncia Mineira , 5 1 Ludmilla Radchenko

nov 2011: 1 2 Ouceano Atlántico , 2 1 Marie-George Buffet

dez 2011: 1 2 Riu Danúbio , 2 2 Mobelizaçon studantil ne l Chile an 2011 , 3 1 Riu Reno

jan 2012: 1 2 Frances Ruffelle , 2 2 Miro Šmajda , 3 1 Slobáquia

fev 2012: 1 3 Anastacia , 2 2 Sofia Vitória , 3 2 Tejeira , 4 2 Eva Gonzalès , 5 2 Armando Gama , 6 2 Eduardo Nascimento , 7 2 Madalena Iglésias , 8 2 Festibal Ourobison de la Cançon , 9 1 Voyage Voyage

mar 2012: 1 3 Paranaguá , 2 2 Bulgária , 3 2 Eislándia , 4 2 Grécia , 5 2 Coca-Cola , 6 2 Adelaide Ferreira , 7 2 Flor-de-Lis (banda) , 8 1 2B (duo)

abr 2012: 1 2 Buranovskiye Babushki , 2 2 Catona , 3 2 Riu Bolga , 4 1 Bomba atómica

mai 2012: 1 3 Rei Momo , 2 2 François Hollande , 3 1 Rafael Correa

jun 2012: 1 3 Avril Lavigne , 2 2 Wikipedia , 3 1 Should've Known Better

jul 2012: 1 2 Anielho de tucun

ago 2012: 1 1 Pussy Riot

set 2012: 1 2 Riu Biobío , 2 1 Guilin

out 2012: 1 2 Caselle Landi , 2 2 Semitério de Pistoia , 3 1 Lu Xun

nov 2012: 1 1 Staçon Spacial Anternacional

dez 2012: 1 2 Orlando Drummond , 2 1 Frei Betto

jan 2013: 1 2 Maccastorna , 2 2 Meleti , 3 1 Zhuang(etnia)

fev 2013: 1 2 Lhéngua mirandesa , 2 1 WP:BF

mar 2013: 1 2 Pardo de Cela , 2 2 Eislándia , 3 1 Xuxa

abr 2013: 1 1 Atentado na maratora de Boston

mai 2013: 1 1 Midlands Oucidentales

jun 2013: 1 1 Ilha de Wight

jul 2013: 1 1 Paramore

ago 2013: 1 1 Souto de Aguiar de la Beira i Balberde

set 2013: 1 2 Mobeliário , 2 1 Copa de la Ásia de 2007

out 2013: 1 1 Sung Jae-ki

nov 2013: 1 1 Paróquia de Bienville\\

dez 2013: 1 2 Coreca

jan 2014: 1 1 Monçon (Pertual)

fev 2014: 1 1 Guapo Hourizonte

mar 2014: 1 2 Taurino Araújo , 2 1 Yun Hyon-seok

abr 2014: 1 2 Vladimir Putin , 2 1 Club Social y Deportivo Colo-Colo

mai 2014: 1 1 Iksu

jun 2014: 1 2 Lila Tretikov , 2 2 Ronald Reagan , 3 1 Riu Andalién

jul 2014: 1 1 Srinivasa Ramanujan

ago 2014: 1 1 Andonésia

set 2014: 1 1 Papa Francisco

out 2014: 1 1 Maurício Malvestiti

nov 2014: 1 1 Region de l Bío-Bío

dez 2014: 1 1 Mimória

jan 2015: 1 1 Taurino Araújo

fev 2015: 1 2 Família

mar 2015: 1 1 Begetarianismo

abr 2015: 1 2 Triton (satélite) , 2 1 Murasaki Shikibu

mai 2015: 1 1 CapitanJack Sparrow

jun 2015: 1 2 Lhéngua castelhana , 2 1 Valery Leontiev

jul 2015: 1 2 Caronte (satélite) , 2 1 Adam Smith

ago 2015: 1 1 Arquidiocese de Saurimo

set 2015: 1 2 Eigreija de San José Ouperário (Macau) , 2 1 Maçana

out 2015: 1 1 Anquanto la Lhéngua fur Cantada

nov 2015: 1 1 Riu de Janeiro

dez 2015: 1 2 Sol negro (símbolo) , 2 1 Łobez

jan 2016: 1 1 The Jerusalem Post

fev 2016: 1 3 Mickey Mouse

mar 2016: 1 2 Valery Leontiev , 2 1 Apaxco

abr 2016: 1 1 Lagos

mai 2016: 1 1 Amor

jun 2016: 1 1 Marco Polo

jul 2016: 1 1 Áurea

ago 2016: 1 2 Silybum , 2 1 Finlándia

set 2016: 1 1 Trindade

out 2016: 1 1 Lhéngua japonesa

nov 2016: 1 2 Campinas , 2 1 Fidel Castro Ruz

dez 2016: 1 1 Reino de la Mércia

jan 2017: 1 2 Ferdinand Marcos , 2 2 Spanha , 3 1 Papua-Nuoba Guiné

fev 2017: 1 1 Familia de gonçalves zarco

mar 2017: 1 1 Tabela periódica

abr 2017: 1 2 Cristiano Ronaldo , 2 1 Kim Il-sung

mai 2017: 1 3 Kamo no Chomei , 2 3 Calímaco , 3 3 Beroso , 4 3 Ateneu , 5 3 Artemidoro , 6 3 Aristóbulo de Cassandreia , 7 3 Apolónio Díscolo , 8 2 Pampa Energía , 9 2 Sunan , 10 2 Sanshan , 11 2 Yaohai , 12 2 Luyang , 13 2 Baohe , 14 2 Yamamoto Tsunetomo , 15 2 Hiroyuki Owaku , 16 2 Lafcádio Hearn , 17 2 Tomioka Makoto , 18 2 Masahiro Ito , 19 2 Mikiyo Tsuda , 20 2 Yukio Mishima , 21 2 Yoshida Kenkō , 22 1 Moustapha Alassane

Wikipedias are initially ordered by number of speakers of the language

Speakers: Number of speakers of a language is the estimated total of primary and secondary speakers, is in many cases a very rough estimation (based on the page on the English Wikipedia about that language)
Regions are parts of the world where the language is spoken in substantial amounts (compared to total number of speakers). Regions where a language gained presence only by a recent diaspora are generally not included.
Region codes: AF:Africa, AS:Asia, EU:Europe, NA:North America, OC:Oceania, SA:South America, W:World Wide, CL:Constructed Language

Estatísticas geradas em Segunda-feira, 19 de junho 2017 14:02

Dump file mwlwiki-20170601-stub-meta-history.xml.gz (edits only), size 6.4 Mb as gz -> 41 Mb
Dump processed till May 31, 2017, on server stat1002, ready at Sat-17/06/2017-11:32 after 37 sec.

Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.