Estatísticas da Wikipédia mirandese

Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Articles per size range / Records per namespace / Most edited articles / Zeitgeist
  May 2016: The major overhaul of Wikistats reports has entered a new phase.  

  First phase focused on migrating the traffic analysis reports to our new infrastructure. Those are operational now.  
  The Analytics Team will now proceed to also migrate data collection and reporting about wiki content and contributors.  
  First results are expected later this year.  

  More info at this announcement
  You can still tell us which reports you want to see preserved, in this survey.


Most metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.

Some metrics have been collected from the full archive dump which runs on lower frequency than the usual monthly cycle.
These metrics are columns F,I,J,K,M,N,O,P,Q,R from the first table.

See also metrics definitions

Monthly counts & Quarterly rankings: julho 2016
DataWikipedistasArtigosBase de dadosLigações
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
jul 2016+2%   +1%             0%
mar 2016+2%   0%             0%
jul 20166011 2,8 k 117   39      378
jun 201659   2,8 k  17,1   12      378
mai 201659   2,8 k  17,1   16      378
abr 201659   2,8 k  17,1   13      378
mar 20165912 2,8 k  17,1   45      378
fev 201658   2,8 k  17,1   16      378
jan 201658   2,8 k  17,1   15      378
dez 201558   2,8 k  17,1   15      378
nov 201558   2,8 k  17,1   18      378
out 20155811 2,8 k  17,1   30      378
set 201557   2,8 k  17,1   21      376
ago 20155711 2,8 k  17,1   40      376
jul 201556   2,8 k  17,2   24      376
jun 201556   2,8 k  17,2   23      376
mai 20155611 2,8 k  17,2   227      376
abr 201555   2,8 k  17,1   22      375
mar 201555   2,8 k  17,1   20      375
fev 201555   2,8 k  17,1   10      375
jan 201555 1 2,8 k  17,1   37      375
dez 201455   2,8 k  17,1   20      373
nov 201455   2,8 k  17,1   39      373
out 2014551  2,8 k  17,1   19      371
set 20145412 2,8 k  17,1   31      369
ago 201453 1 2,8 k  17,1   30      369
jul 201453   2,8 k  17,1   15      369
jun 201453   2,8 k  17,1   30      369
mai 201453   2,8 k  17,1   37      369
abr 201453 1 2,8 k 117,1   36      369
mar 201453 2 2,7 k  17,2   45      368
fev 201453   2,7 k2,6 k 17,3685484%50%4622 Mb3,1 M148 k4472099,8 k368
jan 201453 1 2,7 k2,5 k 17,3687484%51%3622 Mb3,1 M148 k4462019,8 k362
dez 20135312 2,7 k2,5 k 17,3687684%51%5722 Mb3,1 M148 k5001919,8 k361
nov 20135212 2,7 k2,5 k 17,3688984%51%5522 Mb3,1 M148 k5001919,8 k357
out 20135123 2,7 k2,5 k 17,4691684%50%4322 Mb3,1 M147 k5001919,8 k352
set 2013492222,7 k2,5 k3217,4692584%51%97122 Mb3,1 M147 k4661899,8 k351
ago 20134712 1,7 k1,6 k126,4811981%57%6317 Mb2,4 M115 k3941876,5 k351
jul 201346 1 1,7 k1,6 k 26,9812083%58%3317 Mb2,4 M115 k6551856,4 k351
jun 201346 1 1,7 k1,6 k126,9813383%58%10517 Mb2,4 M115 k6771826,4 k349
mai 201346 311,7 k1,6 k427,4828083%59%32617 Mb2,4 M115 k7061826,4 k340
abr 20134623 1,6 k1,4 k129,3822382%58%17015 Mb2,2 M109 k6981816,0 k313
mar 201344 111,5 k1,4 k129,5828682%58%2,0 k15 Mb2,2 M109 k2,9 k1795,9 k313
fev 201344 2 1,5 k1,4 k 29844083%59%74118 Mb2,2 M108 k90 k1495,8 k312
jan 2013442411,5 k1,4 k128,5844583%59%1,2 k18 Mb2,2 M108 k90 k1495,8 k309
dez 2012421311,5 k1,4 k428,1850684%60%1,0 k18 Mb2,2 M108 k88 k1495,8 k308
nov 20124111 1,3 k1,3 k230,1860384%58%86816 Mb2,0 M99 k83 k1374,8 k293
out 201240 2 1,3 k1,2 k 30,6854883%57%81015 Mb1,9 M95 k79 k904,4 k285
set 201240 1 1,3 k1,2 k 30,2856683%57%65315 Mb1,9 M95 k79 k934,4 k285
ago 201240   1,3 k1,2 k 29,9861683%57%65715 Mb1,9 M95 k78 k944,3 k285
jul 20124023 1,3 k1,2 k 29,4862184%57%83315 Mb1,9 M95 k78 k954,3 k285
jun 201238 1 1,3 k1,2 k 29867883%57%80915 Mb1,9 M95 k77 k974,3 k285
mai 201238   1,3 k1,2 k 28,4869684%58%77215 Mb1,9 M95 k76 k924,3 k284
abr 201238 2 1,3 k1,2 k 27,9870684%58%86115 Mb1,9 M95 k76 k914,3 k284
mar 201238 3 1,2 k1,2 k127,4899384%58%95016 Mb2,0 M95 k75 k924,3 k284
fev 20123812 1,2 k1,1 k127,2916185%59%82815 Mb2,0 M95 k73 k954,3 k283
jan 201237   1,2 k1,1 k 27,5943288%61%61215 Mb2,0 M95 k71 k934,2 k282
dez 20113712 1,2 k1,1 k 27,1945988%61%85015 Mb2,0 M95 k71 k914,2 k282
nov 20113614 1,2 k1,1 k126,6951288%61%92215 Mb2,0 M94 k70 k914,2 k282
out 20113514 1,1 k1,1 k 26,2958989%62%80515 Mb1,9 M94 k69 k884,2 k277
set 201134   1,1 k1,1 k 25,8967189%62%58815 Mb1,9 M94 k68 k854,1 k275
ago 201134 4 1,1 k1,1 k 25,3968889%62%71515 Mb1,9 M93 k68 k874,1 k273
jul 20113423 1,1 k1,1 k124,8972189%62%88915 Mb1,9 M93 k68 k874,1 k273
jun 2011321  1,1 k1,1 k 24,7994490%64%89915 Mb1,9 M93 k66 k864,0 k272
mai 201131 2 1,1 k1,0 k 24,1995390%64%76715 Mb1,9 M93 k65 k944,0 k271
abr 20113116 1,1 k1,0 k123,4996190%64%82715 Mb1,9 M93 k65 k923,9 k270
mar 201130 2 1,1 k1,0 k 23,1996991%64%96215 Mb1,9 M91 k63 k923,8 k269
fev 201130 1 1,1 k1,0 k 22,31001191%64%69814 Mb1,9 M91 k62 k883,8 k269
jan 2011301511,0 k1,0 k121,81008491%64%1,3 k14 Mb1,9 M91 k61 k913,8 k267
dez 201029 1 1,0 k987 211033391%65%75314 Mb1,9 M91 k60 k903,8 k243
nov 201029 1 1,0 k978 20,51039191%66%64514 Mb1,9 M90 k59 k913,8 k242
out 20102915 1,0 k975119,91042491%66%70214 Mb1,9 M90 k59 k963,8 k240
set 20102824 992959 19,51055791%66%71914 Mb1,9 M90 k57 k973,8 k238
ago 201026 1 977951 19,11061592%67%98014 Mb1,9 M89 k56 k973,7 k235
jul 20102613 967941 18,31068492%67%70914 Mb1,9 M89 k55 k1023,7 k234
jun 20102511 952925 17,81083692%68%73014 Mb1,8 M89 k54 k1083,7 k232
mai 201024 3 947918 17,11079891%67%72814 Mb1,8 M88 k53 k1093,6 k232
abr 201024 52935908116,61091191%68%1,1 k14 Mb1,8 M88 k52 k1083,6 k231
mar 201024281907880315,81121692%68%1,3 k14 Mb1,8 M87 k51 k1463,6 k219
fev 201022 9 8178011161188393%69%85213 Mb1,7 M81 k46 k1573,4 k187
jan 201022362791775115,51211193%70%2,3 k13 Mb1,7 M79 k45 k1663,3 k170
dez 200919241754737 13,21275892%70%83812 Mb1,7 M77 k42 k2763,3 k119
nov 200917141750733 12,11275892%69%1,2 k12 Mb1,6 M76 k41 k6173,3 k116
out 200916 42742723110,71329992%70%1,1 k12 Mb1,6 M76 k40 k1,3 k3,2 k96
set 200916571716699 9,51383292%71%99312 Mb1,6 M75 k32 k1,6 k3,1 k80
ago 20091115170668618,31446292%71%2,3 k12 Mb1,6 M75 k25 k2,8 k3,1 k62
jul 200910 1 678662 5,21532593%73%4112 Mb1,6 M74 k13 k2,8 k3,1 k60
jun 200910 2167566155,11533793%74%51412 Mb1,6 M74 k13 k2,8 k3,1 k60
mai 200910 2152250615,61384891%70%1538,1 Mb1,1 M52 k12 k2,2 k2,0 k51
abr 20091026247946475,81286891%70%5836,9 Mb945 k47 k12 k2,0 k1,6 k47
mar 2009813126725218,31050284%59%2913,3 Mb428 k21 k11 k91284633
fev 2009735222520938,5870981%55%7252,4 Mb295 k16 k10 k72462729
jan 20094 2114213018,4528274%39%305972 kb118 k5,7 k5,0 k27316018
dez 20084 511058828,5229962%21%452316 kb38 k1,7 k1,8 k1267414
nov 20084 2 5740 7,769249%4%4353 kb6,3 k20120715294
out 20084   5438 7,365448%4%749 kb5,8 k15919216264
set 20084   5338 7,366349%4%149 kb5,7 k15719216254
ago 20084   5338 7,366349%4% 49 kb5,7 k15719216254
jul 2008422 5338 7,366349%4%3749 kb5,7 k15719216254
jun 20082   5137 6,963649%2%1441 kb5,5 k1246510244
mai 20082 1 493516,962047%2%9839 kb5,1 k1156110174
abr 20082   2620 9,259446% 8321 kb2,6 k73261092
mar 20082   1813 8,656650% 2814 kb1,7 k6410912
fev 2008222 149 9,158250% 12711 kb1,3 k563912
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternas

> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
The following table ranks this project in relation to projects in other languages with 1000+ articles
abr 2016177   196  148   226      245
jan 2016177   193  151   221      245
out 2015174133201 191  153   207      245
jul 2015176   188  155   203      245
abr 2015174   187  156   219      245
jan 2015171 198 183  152   200      245
out 2014169136  183  154   209      245
jul 2014170   181  154   220      245
abr 2014167 204 176 153156   208      245
jan 20141631721941461761571591571539204114105107183216116245
out 201316410815712817415714815825210192115104107186215117245
jul 2013170140192135195180160871533196121107110176215124245
abr 2013169100158148198180153691563181124108111179216125245
jan 2013171104136143195178153681492178133107111188221125245
out 2012174143172140198179151571432192138108113191228132245
jul 2012173100156144196179154641412192134108113191226131245
abr 2012172133171146194177148701391190132105111189227124245
jan 2012171156216140196177150681231194129105109188225122245
out 2011171141140141195175160731171193126102107186225120245
jul 2011168109153140193172155821151184121102106183222119245
abr 201117113511213119316715190111118211897102182218117245
jan 201116814612912919216215197110117711896101180222116245
out 201016714212012718716114411018118311695101177214110245
jul 201017014116114018315915718318218218018511592100175212110245
abr 2010167148118991801591461801791791781651139198171213110245
jan 201016983118971811621461791791791781181139199171201110245
out 2009190143125961811601521761761761751591139098170121105245
jul 2009210189190131178162149171171171170227109889720394105245
abr 20092039511210518816883168168168167171127100105200105119245
jan 2009237132163127212201143163163163162195191164164211180181245
out 2008233136196129224218146157157157156236235224226235232212244
jul 2008228102165133220212148151151151149226231220223234228204243
abr 2008236147201125231220145146146145143205233226229235231218243
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
 WikipedistasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikipedistas (usuários registrados)
A = Wikipedistas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikipedistas que editaram pelo menos dez vezes desde que chegaram
C = Wikipedistas que contribuíram cinco vezes ou mais este mês
D = Wikipedistas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Artigos que contêm pelo menos uma ligação interna e 200 caracteres de texto legível, não contando códigos wiki e html,
      ligações ocultas, etc.; títulos também não contam (outras colunas são baseadas no método oficial de contagem)
G = Novos artigos por dia no mês passado
H = Número médio de revisões por artigo
I = Tamanho médio dos artigos em bytes
J = Porcentagem de artigos com pelo menos 0,5 kb de texto legível (veja F)
K = Porcentagem de artigos com pelo menos 2 kb de texto legível (veja F)

Base de dados
L = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
M = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
N = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

O = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
P = Total de ligações para outras wikipédias
Q = Total de imagens apresentadas
R = Total de ligações para outros sítios
S = Total de páginas de redirecionamento

Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  5  10  100  1000  1  3  5  10  25  100  250  5  10  1  3  5  10  25  100  250  1000  5  10  100  1000 
jul 201633111  1   2        2111        
jun 20168                  1           
mai 201673        1        2           
abr 20166         2        21          
mar 20166321                1           
fev 20167     1                        
jan 20168     1   5        6           
dez 2015101                 621         
nov 201541    1   2        911         
out 20154111                3       1   
set 201510     1   4        2           
ago 2015511    21  2        72      11  
jul 201581        1        1           
jun 20157     1            1           
mai 201581111  211          1           
abr 201510     1   2      223           
mar 201512         5      113           
fev 20153         31       51          
jan 2015811    11  52       31          
dez 201410     1   1        1           
nov 2014131    1   21       3           
out 201410                  3           
set 20148221       31       621         
ago 20146111       1        411         
jul 20145         1        2           
jun 2014113    11           511         
mai 2014111    11           21          
abr 20147111       1        5           
mar 201411221       2        6           
fev 20147         2        711         
jan 2014921    11  1        61          
jul 201633111  1   2        2111        
abr 20166         2        21          
jan 20168     1   5        6           
out 20154111                3       1   
jul 201581        1        1           
abr 201510     1   2      223           
jan 2015811    11  52       31          
out 201410                  3           
jul 20145         1        2           
abr 20147111       1        5           
jan 2014921    11  1        61          
out 20131833        1        51          
jul 20131021        1        4           
abr 201313332   43  1        11211    552 
jan 20131254211  18123 62111    12532111 11113 
out 2012942    1483 1        1121     11103 
jul 201213431   1783 1        12111    12102 
abr 201214321   16153 31       911     1292 
jan 201292    15111 1        101      12111 
out 20111764    23161          1132     15123 
jul 2011123321  22132 3        84311   1191 
abr 201114763   14124 1        12541    121121
jan 20111055321  20143 41       163221   16144 
out 2010136531  17111 3        162211   1392 
jul 20101153    18121 3        103111   1182 
abr 20101065442  1581 1042      137433   1092 
jan 20101276652111592 9332     159975211431 
out 20091244422  16121 84211    11532    43  
jul 200921111               1111        
abr 20096666421     3111     33322       
jan 2009322221      3111     54221       
out 2008                               
jul 20082222       1        41          
abr 20081                  21          


Distribuição de edições de artigos por wikipedistas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...

Edições >=WikipedistasEdições total


3 wikipedistas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias

 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
30 dias
30 dias
30 dias
30 dias
VenancioChapimUC37...2727--jul 08, 2016222727--
Je7roiUC66+38941111jun 17, 20147743---
KatxisUC126+37543--fev 12, 2016169----


20 wikipedistas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

  Primeira ediçãoúltima edição
PisonesUC12,092dez 06, 20092428mai 03, 20131184
CecílioUC22,070jul 29, 20082923fev 09, 20102363
ChabiUC31,724fev 24, 20083079jul 05, 20121486
SPQRobinUC4755fev 23, 20092714jun 03, 20111884
ZeEstevesUC5565set 14, 20131050set 16, 20131048
Manuel de SousaUC6553jan 24, 20102379mar 08, 20131240
GarsdUC7531jan 15, 20131292mar 24, 20131224
AmaralUC8395set 18, 20131046set 18, 20131046
HexadecimalUC9385abr 15, 20131202jun 03, 20131153
NaviaTVUC10379jan 25, 20102378mai 14, 20102269
El estremeñuUC11307set 20, 20092505jan 04, 20102399
CarnelianSuthUC12307nov 18, 20121350dez 12, 20121326
AlchimistaUC13273ago 13, 20092543mar 01, 2015517
EspadeiroUC14231set 08, 20092517abr 12, 20121570
Midnight GreenUC15159nov 16, 20111718ago 11, 20121449
MiguelcrUC16137fev 15, 20083088dez 30, 20111674
IshiaiUC17129mai 29, 20102254jun 08, 2014783
Isaac MansurUC18128nov 05, 20092459jan 16, 20102387
Luigi Salvatore VadacchinoUC1975nov 10, 20102089set 05, 2015329
D'ohBotUC2059set 07, 20092518set 06, 20102154


Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 1.499 edições foram feitas por usuários anônimos, de um total de 48.152 edições ( 3e %)

50 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
XqbotUC14,535set 01, 20092524mar 06, 2013124210-
EmausBotUC23,875jun 26, 20102226abr 10, 201611111-
Luckas-botUC33,421set 03, 20092522mai 20, 201215324-
MerlIwBotUC41,847mai 07, 20111911ago 08, 201310879-
WikitanvirBotUC51,545nov 07, 20102092abr 21, 20121561--
SieBotUC61,522ago 14, 20092542jan 25, 20112013--
ZéroBotUC71,409nov 03, 20102096mar 06, 201312429-
MelancholieBotUC81,362ago 13, 20092543nov 28, 20092436--
TXiKiBoTUC91,252set 21, 20092504jan 08, 20131299--
LegobotUC10839mar 11, 20131237abr 02, 2013121519-
VolkovBotUC11833ago 16, 20092540fev 28, 201312481-
AddbotUC12752mar 07, 20131241ago 16, 20131079--
FoxBotUC13660out 03, 20092492fev 05, 20121637--
EscarbotUC14619mar 07, 20102337jan 25, 20131282--
TjBotUC15544nov 17, 20102082mar 06, 201312424-
ArthurBotUC16482ago 24, 20092532nov 17, 20111717--
RedBotUC17391set 08, 20102152ago 21, 201214392-
Ripchip BotUC18380mar 06, 20111973fev 18, 20121624--
HRoestBotUC19376jun 19, 20102233fev 14, 20131262--
Idioma-botUC20366out 30, 20092465fev 10, 201312661-
KamikazeBotUC21361jul 04, 20102218jan 24, 20131283--
AvocatoBotUC22349out 20, 20111745fev 27, 20131249--
CommonsDelinkerUC23306dez 25, 20082774jul 16, 2016141-
JackieBotUC24289jan 15, 20112023mar 07, 201312413-
JAnDbotUC25285ago 14, 20092542jul 03, 20131123--
AlexbotUC26281ago 17, 20092539ago 14, 20111812--
Thijs!botUC27272mai 04, 20102279jul 30, 201214613-
LaaknorBotUC28269out 02, 20092493fev 16, 201312606-
RobbotUC29252set 23, 20092502jan 02, 20131305--
MjbmrbotUC30234out 15, 20102115mar 28, 20111951--
Movses-botUC31226dez 22, 20102047mar 18, 20121595--
RubinbotUC32203set 13, 20092512mar 02, 201312461-
DexbotUC33180out 17, 20121382mai 25, 20154326-
Dinamik-botUC34179fev 14, 20102358dez 18, 20121320--
MastiBotUC35178dez 10, 20092424mar 01, 20131247--
GerakibotUC36171jan 11, 20102392mar 04, 20131244--
AvicBotUC37169jun 18, 20111869dez 09, 20121329--
JotterbotUC38159out 05, 20092490jan 24, 20131283--
VagobotUC39158out 18, 20111747set 19, 20121410--
AmirobotUC40131mai 04, 20102279nov 19, 20111715--
MystBotUC41122jan 23, 20102380fev 05, 20121637--
Makecat-botUC42120out 28, 20121371mar 04, 201312442-
YFdyh-botUC43109jun 18, 20121503fev 13, 201312631-
JhsBotUC44103mai 18, 20102265mar 29, 20121584--
HerculeBotUC45100ago 30, 20092526jul 13, 20121478--
CocuBotUC46100jun 09, 20111878dez 26, 20121312--
CarsracBotUC4795ago 16, 20092540fev 12, 20131264--
HiW-BotUC4891set 18, 20111777out 19, 20121380--
SilvonenBotUC4986set 08, 20092517dez 19, 20121319--
DSisyphBotUC5085nov 22, 20092442ago 27, 20121433--


Artigos que contêm pelo menos uma ligação interna e .. caracteres de texto legível, não contando códigos wiki e html,
ligações ocultas, etc.; títulos também não contam  (excluindo páginas de redirecionamento)

 < 32 ch< 64 ch< 128 ch< 256 ch< 512 ch< 1 k ch< 2 k ch< 4 k ch< 8 k ch< 16 k ch< 32 k ch< 64 k ch
out 20107.5%11.1%12.9%15.4%19.6%28.7%41.8%56.0%69.1%81.6%91.0%97.4%
set 20107.6%11.1%13.1%15.4%19.4%28.5%41.6%55.7%68.7%81.2%90.9%97.4%
ago 20107.6%11.2%12.7%15.0%19.0%28.0%41.2%55.4%68.5%81.2%90.9%97.5%
jul 20107.6%11.1%12.6%15.0%19.0%27.6%40.9%55.1%68.3%81.0%90.8%97.4%
jun 20107.8%11.2%12.9%15.2%19.1%27.3%40.3%54.4%67.8%80.7%90.7%97.4%
mai 20107.8%11.2%13.0%15.3%19.2%27.3%40.5%54.6%67.9%80.9%90.7%97.4%
abr 20107.8%11.3%13.0%15.3%19.2%27.3%40.2%54.3%67.4%80.5%90.5%97.3%
mar 20107.1%10.5%12.3%14.7%18.5%26.2%39.4%53.0%66.5%80.1%90.4%97.2%
fev 20106.8%9.8%10.7%13.3%16.9%24.6%38.2%51.3%65.1%78.8%89.7%97.1%
jan 20106.6%9.1%10.1%12.7%16.1%23.5%37.3%50.6%64.5%78.1%89.2%96.9%
dez 20095.7%7.4%8.5%11.4%14.9%22.9%35.8%48.4%62.4%76.6%88.5%96.6%
nov 20095.5%7.2%8.3%11.2%14.8%23.1%36.0%48.6%62.4%76.6%88.5%96.6%
out 20093.9%4.9%5.4%8.2%11.7%19.9%33.3%46.5%61.0%75.9%88.2%96.5%
set 20092.2%2.7%3.2%5.9%9.4%17.3%30.5%44.0%59.0%74.9%87.8%96.2%
ago 20090.3%0.6%1.0%4.0%7.4%15.2%28.5%42.1%57.4%74.0%87.3%96.1%
jul 20090.1%0.5%0.8%3.9%6.7%14.1%26.3%38.8%54.9%72.4%86.2%95.6%
jun 20090.1%0.5%0.8%3.9%6.6%14.0%26.2%38.7%54.8%72.4%86.3%95.7%
mai 20090.2%1.2%1.6%5.1%8.4%17.0%29.9%42.2%56.6%74.3%87.5%97.5%
abr 20090.2%1.2%1.6%5.2%8.8%17.4%29.7%41.6%55.6%74.0%88.2%98.0%
mar 20090.4%2.3%3.1%8.8%15.2%27.3%40.1%52.9%62.3%77.4%90.6%98.9%
fev 20090.4%2.2%3.5%10.7%17.4%30.9%44.4%58.3%66.8%82.0%91.9%99.5%
jan 20090.7%4.1%6.2%17.2%26.9%44.8%61.4%73.1%78.6%88.3%95.9%100.0%
dez 20081.0%8.6%11.5%25.8%38.2%61.1%79.2%88.7%91.6%96.4%100.0%100.0%
nov 20081.8%18.2%23.7%38.2%49.1%76.4%96.4%100.0%100.0%100.0%100.0%100.0%
out 20083.8%18.9%24.6%39.7%51.0%79.3%96.3%100.0%100.0%100.0%100.0%100.0%
set 20083.8%19.2%25.0%38.5%50.0%78.8%96.1%99.9%99.9%99.9%99.9%99.9%
ago 20083.8%19.2%25.0%38.5%50.0%78.8%96.1%99.9%99.9%99.9%99.9%99.9%
jul 20083.8%19.2%25.0%38.5%50.0%78.8%96.1%99.9%99.9%99.9%99.9%99.9%
jun 20083.9%19.6%25.5%37.3%51.0%80.4%98.0%100.0%100.0%100.0%100.0%100.0%
mai 20084.1%20.4%26.5%38.7%53.0%81.6%97.9%99.9%99.9%99.9%99.9%99.9%
abr 20080.0%11.5%15.3%34.5%53.7%84.5%99.9%99.9%99.9%99.9%99.9%99.9%
mar 20080.0%5.6%11.2%33.4%50.1%89.0%100.0%100.0%100.0%100.0%100.0%100.0%
fev 20080.0%7.7%15.4%38.5%46.2%84.7%100.0%100.0%100.0%100.0%100.0%100.0%


Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.

categorizados 1
jul 20163,2 k71075 1882672,2 k       
jun 20163,2 k70975 1881872,2 k       
mai 20163,2 k70975 1881872,2 k       
abr 20163,2 k70875 1881872,2 k       
mar 20163,2 k70475 1881872,2 k       
fev 20163,2 k70475 1881872,2 k       
jan 20163,2 k70475 1881872,2 k       
dez 20153,2 k70375 1881872,2 k       
nov 20153,2 k69675 1881872,2 k       
out 20153,2 k69573 1881872,2 k       
set 20153,2 k69573 1881172,2 k       
ago 20153,2 k69373 1881172,2 k       
jul 20153,2 k69272 1880972,2 k       
jun 20153,2 k69172 1880972,2 k       
mai 20153,2 k69172 1880972,2 k       
abr 20153,2 k69172 1880972,2 k       
mar 20153,2 k68972 1880972,2 k       
fev 20153,1 k68772 1879672,2 k       
jan 20153,1 k68272 1879672,2 k       
dez 20143,1 k67972 1879672,2 k       
nov 20143,1 k67972 1879672,2 k       
out 20143,1 k67672 1879672,2 k       
set 20143,1 k67472 1879672,2 k       
ago 20143,1 k66872 1879672,2 k       
jul 20143,1 k66472 1879672,2 k       
jun 20143,1 k66372 1877272,2 k       
mai 20143,1 k66372 1877062,2 k       
abr 20143,1 k65972 1877062,2 k       
mar 20143,1 k65672 1877062,2 k       
fev 20143,1 k65272 1877062,2 k      9
jan 20143,1 k64872 1877032,2 k      17
dez 20133,1 k64472 1877032,2 k      50
nov 20133,1 k64272 1877032,2 k      35
out 20133,0 k63771 1877032,2 k      38
set 20133,0 k63271 1877032,2 k      966
ago 20132,1 k61771 1877032,2 k      46
jul 20132,1 k61471 1876932,2 k      20
jun 20132,0 k61071 1876932,2 k      95
mai 20132,0 k60871 1870832,2 k      312
abr 20131,9 k60071 1846432,2 k      46
mar 20131,8 k58471 1845632,2 k      318
fev 20131,8 k47363 1845632,2 k      55
jan 20131,8 k45253 1845322,2 k      232
dez 20121,7 k44151 1645322,1 k      252
nov 20121,6 k42751 1642922,1 k      111
out 20121,5 k42651 1641522,1 k      27
set 20121,5 k42151 1541512,1 k      17
ago 20121,5 k41451 1541512,1 k      6
jul 20121,5 k40951 1541512,1 k      45
jun 20121,5 k40251 1541412,1 k      26
mai 20121,5 k39151 1541412,1 k      24
abr 20121,5 k38351 1541412,1 k      37
mar 20121,5 k37151 1541412,1 k      106
fev 20121,5 k36851 1541312,1 k      94
jan 20121,5 k35451 1541312,1 k      18
dez 20111,5 k34651 1541312,1 k      68
nov 20111,4 k34051 1441012,1 k      66
out 20111,4 k32251 1441012,1 k      46
set 20111,4 k31251 1340912,1 k      12
ago 20111,4 k30251 1340812,1 k      45
jul 20111,4 k29851 1340812,1 k      61
jun 20111,4 k28951 1140712,1 k      15
mai 20111,4 k28551 1140612,0 k      35
abr 20111,4 k27851 1140512,0 k      79
mar 20111,3 k26951 1140412,0 k      57
fev 20111,3 k26151 1037812,0 k      30
jan 20111,3 k25451 737812,0 k      263
dez 20101,3 k24649 337412,0 k      17
nov 20101,3 k24149 337412,0 k      16
out 20101,2 k23249 237412,0 k      89
set 20101,2 k21948 234212,0 k      57
ago 20101,2 k20848 234212,0 k      23
jul 20101,2 k19048 234112,0 k      36
jun 20101,2 k18548 233912,0 k      42
mai 20101,2 k16648 233712,0 k      84
abr 20101,2 k16348 233312,0 k      487
mar 20101,1 k15148 230112,0 k      464
fev 20101,0 k13644 223812,0 k      275
jan 201096112629 221011,9 k      1766
dez 200987310026 21991813      199
nov 20098669026 21991797      588
out 20098388224 21901178      349
set 20097967523 21871167      460
ago 20097684822 11861166      976
jul 2009737116  1491150      37
jun 2009734116  1491149      507
mai 200957214  99 127      139
abr 200952514  96 114      570
mar 200929914  88 77      270
fev 200925314  73 76      668
jan 200915513  62 66      268
dez 200811413  49 27      369
nov 200856 1  21 6      42
out 200852 1  18 4       
set 200851 1  18 4       
ago 200851 1  18 4       
jul 200851 1  18 4      31
jun 200849 1  18 3       
mai 200847 1  18 3      26
abr 200825 1  17 1      1
mar 200817 1  14 1      4
fev 200814 1  14         


Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons



For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

fev 2008: 1 3 Páigina Percipal , 2 2 Picuote , 3 1 Bumioso

mar 2008: 1 1 Lhéngua Mirandesa

abr 2008: 1 1 Abusejo

mai 2008: 1 1 Sociadade

jul 2008: 1 1 Cumputador

nov 2008: 1 3 Páigina Percipal , 2 2 Pertual , 3 2 Lhéngua Mirandesa , 4 1 Spanha

dez 2008: 1 4 Declaraçon Ounibersal de ls Dreitos Houmanos , 2 3 Ágreda , 3 3 Zenízio , 4 2 Spanha , 5 2 Quim Barreiros , 6 2 Cumputador , 7 2 Cebadeiros , 8 2 Bumioso , 9 2 Braga , 10 2 Bernardo Fernandes Monteiro , 11 2 Auga , 12 2 António Lobo Antunes , 13 2 Almazán , 14 2 Agallas , 15 2 Abusejo , 16 2 Abejar , 17 2 Poema La Lhéngua Mirandeza , 18 2 Nuossa Alma i Nuossa Tierra , 19 2 Manuel Sardinha , 20 2 Lhéngua Mirandesa , 21 2 La Pertuesa-Hino Nacional , 22 2 João Penha , 23 2 Joaquim Araújo , 24 2 Gaspar Arce

jan 2009: 1 2 Stória de Roma , 2 2 Stados Ounidos de la América , 3 2 Religion , 4 2 Ciéncia , 5 2 Bíblia , 6 2 Berlin , 7 2 Bandeira de Pertual , 8 2 Anternete , 9 2 Angenharie , 10 2 Andústria , 11 2 Agricultura , 12 2 Ouropa , 13 2 Nuoba Iorque , 14 2 Medio Ouriente , 15 2 Londres

fev 2009: 1 3 Sociadade , 2 3 Die de ls namorados , 3 3 Çporto , 4 2 Stória de l Crestianismo , 5 2 San Balantin , 6 2 Salude , 7 2 Rússia , 8 2 Quemido , 9 2 Cristandade , 10 2 Crestianismo , 11 2 Clima , 12 2 Ciéncias Sociales , 13 2 Cidade , 14 2 Charles Darwin , 15 2 Catolicismo , 16 2 Biologie , 17 2 Astronomie , 18 2 Artes Bisuales , 19 2 Arquitetura , 20 2 Antártica , 21 2 Anternete , 22 2 Amílcar Cabral , 23 2 América de l Norte , 24 2 Portestantismo , 25 2 Política

mar 2009: 1 3 Sendin , 2 2 Riu , 3 2 Cuntinente , 4 2 Assemblé de Dius , 5 2 Arma , 6 2 Almairo , 7 2 Paíç , 8 2 Miranda de l Douro , 9 2 Ls Lusíadas , 10 2 Lhéngua Mirandesa , 11 2 Ilha , 12 1 Sun Tzu

abr 2009: 1 3 Sismo , 2 3 Ampério Romano , 3 3 Ampério Bizantino , 4 3 Ouclides , 5 3 Max Ernst , 6 3 Luna , 7 3 Houlocausto , 8 3 Eidade de la Piedra , 9 2 Suméria , 10 2 Stendhal , 11 2 Sploraçon spacial , 12 2 Sociologie , 13 2 Siddhartha Gautama , 14 2 Sexismo , 15 2 Segunda Guerra Mundial , 16 2 Saturno , 17 2 Roald Amundsen , 18 2 Renacimiento , 19 2 Reboluçon Francesa , 20 2 Cordilheira de ls Andes , 21 2 Cleópatra , 22 2 Claude Monet , 23 2 Carl Friedrich Gauss , 24 2 Capitalismo , 25 2 Blaise Pascal

mai 2009: 1 2 Batailha de Aljubarrota , 2 2 Paç , 3 2 Oucránia , 4 2 Páigina Percipal , 5 1 Stória de la Rússia

jun 2009: 1 3 Reboluçon Amaricana de 1776 , 2 3 Antoine Lavoisier , 3 2 Stória de Pertual , 4 2 Stados Cunfederados de la América , 5 2 Caçareilhos , 6 2 Campo de Bíboras , 7 2 Bal de Frailes , 8 2 Apartheid , 9 2 Albert Einstein , 10 2 Planeta , 11 2 Pinelo , 12 2 Matela (Bumioso) , 13 2 Fiódor Dostoiévski , 14 2 Eça de Queirós , 15 1 Sílex

jul 2009: 1 1 Sikhismo

ago 2009: 1 4 Lhéngua mirandesa , 2 4 Páigina Percipal , 3 3 Wikipedia , 4 3 Brigham Young , 5 3 Antigos macedónios , 6 3 Pertual , 7 3 Eisrael , 8 2 Nefita , 9 2 Templo de Curitiba , 10 2 Stória de la Oustrália , 11 2 Stória de Cabo Berde , 12 2 Storiografie , 13 2 Stados Ounidos de la América , 14 2 Santos de ls Redadeiros Dies , 15 2 Rússia , 16 2 Roma Antiga , 17 2 Riu Missouri , 18 2 Custantino I , 19 2 Crestianismo , 20 2 Cordilheira de ls Andes , 21 2 Che Guevara , 22 2 Charles de Gaulle , 23 2 Carlos I de Spanha , 24 2 Blaise Pascal , 25 2 Bernhard Riemann

set 2009: 1 9 Lhéngua lhionesa , 2 3 Monarquie , 3 3 Lhéngua mirandesa , 4 2 Lhéngua almana , 5 2 Mórmones Fundamentalistas , 6 2 Casa de Lhion , 7 2 Anielho de l CTR , 8 2 Lhista de reis de Pertual , 9 2 Stória de Eisrael , 10 2 Stados Ounidos de la América , 11 2 Cunfucionismo , 12 2 Cleópatra , 13 2 Claude Monet , 14 2 Che Guevara , 15 2 Charles de Gaulle , 16 2 Charles Darwin , 17 2 Cao Dai , 18 2 Bíblia , 19 2 Budismo , 20 2 Berlin , 21 2 Bandeira de Pertual , 22 2 Análeze Matemática , 23 2 Andependéncia de l Brasil , 24 2 América de l Sul , 25 2 Albrecht Dürer

out 2009: 1 3 Frente Nacional para la Lhibertaçon de l Bietname , 2 2 Terça-feira , 3 2 Cultura pertuesa , 4 2 Quarta-feira , 5 2 Cannibal Corpse , 6 2 Alfabeto Fonético Anternacional , 7 2 Lheite , 8 2 Alman , 9 2 Causo genitibo , 10 2 Aníbal Barca , 11 2 Biseu , 12 2 Lhéngua stremenha , 13 2 Lhéngua asturiana , 14 2 Rede Manchete , 15 2 Stória de la quelonizaçon de las Américas , 16 2 Speranto , 17 2 Reboluçon Amaricana de 1776

nov 2009: 1 3 Lhéngua rapa nui , 2 3 Machado de Assis , 3 3 Lhéngua mirandesa , 4 2 Piotr Tchaikovski , 5 2 Templo de Nauvoo , 6 2 Ludwig van Beethoven , 7 2 Moai , 8 2 Terça-feira , 9 2 Quarta-feira , 10 2 Cannibal Corpse , 11 2 Leonel Brizola , 12 2 Saturno , 13 2 Roma , 14 2 Racismo , 15 2 Cristandade , 16 2 Crestianismo , 17 2 Chamamientos crestianos , 18 2 Bikings , 19 2 Auga , 20 2 Animal , 21 2 Planta , 22 2 Paç , 23 2 Ounion Africana , 24 2 Ouniberso , 25 2 Ouceano Pacífico

dez 2009: 1 2 Cannibal Corpse , 2 2 Pertual , 3 2 Paris , 4 1 Ls Santos de ls Redadeiros Dies

jan 2010: 1 4 Brasil Quelónia , 2 4 Bergança , 3 3 Timor-Leste , 4 3 San Tomé i Príncepe , 5 3 Moçambique , 6 3 Guiné-Bissau , 7 3 Bila Nuoba de Gaia , 8 3 Cristobo Colombo , 9 3 Dreito público , 10 3 Casa de Lhion , 11 3 Cuntinente , 12 3 Cuba , 13 3 Capitalismo , 14 3 Cachones de l Niágara , 15 3 Bumioso , 16 3 Bodun , 17 3 Bie Látea , 18 3 Bahamas , 19 3 Baca , 20 3 Abicena , 21 3 Andependéncia de l Kosobo , 22 3 América , 23 3 Fé Bahá'í , 24 3 Fonso I de Pertual , 25 3 Eiboluçon

fev 2010: 1 3 Louis Pasteur , 2 3 Francis Bacon (filósofo) , 3 3 Vasco da Gama , 4 3 Mobilha , 5 2 Sistema Brasileiro de Televisão , 6 2 Disney Club , 7 2 Mar de Timor , 8 2 Cacau , 9 2 Cundado Portucalense , 10 2 René Descartes , 11 2 Francesco Redi , 12 2 Nicolau Copérnico , 13 2 René Çcartes , 14 2 Miguel Ángelo , 15 1 San Paulo

mar 2010: 1 3 Ampério pertués , 2 3 Lhista de reis de Lhion , 3 3 Afonso de Albuquerque , 4 3 Pedro Álvares Cabral , 5 3 Bartolomeu Dias , 6 3 Ramiro I de las Astúrias , 7 3 Londres , 8 3 Guerra Cebil Amaricana , 9 2 Region de Turismo de l Nordeste Trasmuntano , 10 2 Banco Ouropeu de Ambestimiento , 11 2 Comité Eiquenómico i Social Ouropeu , 12 2 Tribunal de Cuontas Ouropeu , 13 2 Tribunal de Justícia de la Ounion Ouropeia , 14 2 Comisson Ouropeia , 15 2 Carlos Ferreira , 16 2 Domingos Raposo , 17 2 Tratado de Roma , 18 2 Quemunidade Eiquenómica Ouropeia , 19 2 Quemunidade Ouropeia de l Carbon i de l Aço , 20 2 Asterix l Goulés , 21 2 San Poulo , 22 2 Península Eibérica , 23 2 Hip hop , 24 2 Rap , 25 2 José Rodrigues

abr 2010: 1 3 Barbacena , 2 3 Grande Barreira de Coral , 3 3 Montes Urales , 4 3 Jean Monnet , 5 3 Rómulo Ougusto , 6 3 Javier Solana , 7 3 Política de Defesa i de Sigurança Quemun , 8 3 Parlamiento Ouropeu , 9 3 Reino de la Galiza , 10 3 Reboluçon Russa de 1917 , 11 2 Defesa pessonal , 12 2 Hans Christian Andersen , 13 2 Reino de Kent , 14 2 Mar Cáspio , 15 2 San José (Paulínia) , 16 2 Ilhas Británicas , 17 2 Península , 18 2 Riu Ural , 19 2 Capital , 20 2 Tierra Caliente , 21 2 Tierra Frie , 22 2 Gran-ducado de la Toscana , 23 2 Tribunal de Justícia de la Ounion Ouropeia , 24 2 Comisson Ouropeia , 25 2 Ambason muçulmana de la península Eibérica

mai 2010: 1 3 Stória de Sacaben , 2 3 Lhéngua mirandesa , 3 2 Whiteberry , 4 2 Laura Pausini , 5 2 Abade de Baçal , 6 2 Mário Correia , 7 2 Cungregaçon Crestiana an Pertual , 8 1 Riu Teijo

jun 2010: 1 2 Assemblé de Dius , 2 1 Diogo Cão

jul 2010: 1 2 Branco , 2 2 Recén-nacido , 3 1 Bietname

ago 2010: 1 2 Sacaben , 2 1 António Fragoso

set 2010: 1 4 Japon , 2 3 The Beatles , 3 2 Alcoron , 4 1 Tequixquiac

out 2010: 1 3 Mérida (Benezuela) , 2 2 Appert , 3 1 Riu Sado

nov 2010: 1 2 Spanha , 2 1 Vepric

dez 2010: 1 1 ETA

jan 2011: 1 3 Concepción , 2 3 Amplantaçon de la República Pertuesa , 3 2 Çtrito de Portalegre , 4 2 Çtrito de Lhisboua , 5 2 Çtrito de Lheirie , 6 2 Çtrito de la Guarda , 7 2 Çtrito de Faro , 8 1 `Abdu'l-Bahá

fev 2011: 1 3 Aritmética , 2 1 Pertual Cuntinental

mar 2011: 1 2 Asturo-lheonés , 2 1 Lech Wałęsa

abr 2011: 1 2 Mimas , 2 2 Homo sapiens , 3 2 Almanha , 4 2 Concepción , 5 2 Io , 6 2 Monarquie , 7 1 Jonh Lennon

mai 2011: 1 2 Rede Globo , 2 1 Polónia

jun 2011: 1 2 Ounibersidade de l Bío-Bío , 2 1 Talcahuano

jul 2011: 1 2 Galandum Galundaina , 2 1 KrioRus

ago 2011: 1 2 Polónia , 2 2 Maomé , 3 1 Sergey Bryukhonenko

set 2011: 1 1 Anterlhéngua

out 2011: 1 2 Paltoga , 2 2 Stória de l Brasil , 3 2 Brasil República , 4 2 Ancunfidéncia Mineira , 5 1 Ludmilla Radchenko

nov 2011: 1 2 Ouceano Atlántico , 2 1 Marie-George Buffet

dez 2011: 1 2 Riu Danúbio , 2 2 Mobelizaçon studantil ne l Chile an 2011 , 3 1 Riu Reno

jan 2012: 1 2 Frances Ruffelle , 2 2 Miro Šmajda , 3 1 Slobáquia

fev 2012: 1 3 Anastacia , 2 2 Sofia Vitória , 3 2 Tejeira , 4 2 Eva Gonzalès , 5 2 Armando Gama , 6 2 Eduardo Nascimento , 7 2 Madalena Iglésias , 8 2 Festibal Ourobison de la Cançon , 9 1 Voyage Voyage

mar 2012: 1 3 Paranaguá , 2 2 Bulgária , 3 2 Eislándia , 4 2 Grécia , 5 2 Coca-Cola , 6 2 Adelaide Ferreira , 7 2 Flor-de-Lis (banda) , 8 1 2B (duo)

abr 2012: 1 2 Buranovskiye Babushki , 2 2 Catona , 3 2 Riu Bolga , 4 1 Bomba atómica

mai 2012: 1 3 Rei Momo , 2 2 François Hollande , 3 1 Rafael Correa

jun 2012: 1 3 Avril Lavigne , 2 2 Wikipedia , 3 1 Should've Known Better

jul 2012: 1 2 Anielho de tucun

ago 2012: 1 1 Pussy Riot

set 2012: 1 2 Riu Biobío , 2 1 Guilin

out 2012: 1 2 Caselle Landi , 2 2 Semitério de Pistoia , 3 1 Lu Xun

nov 2012: 1 1 Staçon Spacial Anternacional

dez 2012: 1 2 Orlando Drummond , 2 1 Frei Betto

jan 2013: 1 2 Maccastorna , 2 2 Meleti , 3 1 Zhuang(etnia)

fev 2013: 1 2 Lhéngua mirandesa , 2 1 WP:BF

mar 2013: 1 2 Pardo de Cela , 2 2 Eislándia , 3 1 Xuxa

abr 2013: 1 1 Atentado na maratora de Boston

mai 2013: 1 1 Midlands Oucidentales

jun 2013: 1 1 Ilha de Wight

jul 2013: 1 1 Paramore

ago 2013: 1 1 Souto de Aguiar de la Beira i Balberde

set 2013: 1 2 Mobeliário , 2 1 Copa de la Ásia de 2007

out 2013: 1 1 Sung Jae-ki

nov 2013: 1 1 Paróquia de Bienville\\

dez 2013: 1 2 Coreca

jan 2014: 1 1 Monçon (Pertual)

fev 2014: 1 1 Guapo Hourizonte

mar 2014: 1 2 Taurino Araújo , 2 1 Yun Hyon-seok

abr 2014: 1 2 Vladimir Putin , 2 1 Club Social y Deportivo Colo-Colo

mai 2014: 1 1 Iksu

jun 2014: 1 2 Lila Tretikov , 2 2 Ronald Reagan , 3 1 Riu Andalién

jul 2014: 1 1 Srinivasa Ramanujan

ago 2014: 1 1 Andonésia

set 2014: 1 1 Papa Francisco

out 2014: 1 1 Maurício Malvestiti

nov 2014: 1 1 Region de l Bío-Bío

dez 2014: 1 1 Mimória

jan 2015: 1 1 Taurino Araújo

fev 2015: 1 2 Família

mar 2015: 1 1 Begetarianismo

abr 2015: 1 2 Triton (satélite) , 2 1 Murasaki Shikibu

mai 2015: 1 1 CapitanJack Sparrow

jun 2015: 1 2 Lhéngua castelhana , 2 1 Valery Leontiev

jul 2015: 1 2 Caronte (satélite) , 2 1 Adam Smith

ago 2015: 1 1 Arquidiocese de Saurimo

set 2015: 1 2 Eigreija de San José Ouperário (Macau) , 2 1 Maçana

out 2015: 1 1 Anquanto la Lhéngua fur Cantada

nov 2015: 1 1 Riu de Janeiro

dez 2015: 1 2 Sol negro (símbolo) , 2 1 Łobez

jan 2016: 1 1 The Jerusalem Post

fev 2016: 1 3 Mickey Mouse

mar 2016: 1 2 Valery Leontiev , 2 1 Apaxco

abr 2016: 1 1 Lagos

mai 2016: 1 1 Amor

jun 2016: 1 1 Marco Polo

jul 2016: 1 1 Áurea

Wikipedias are initially ordered by number of speakers of the language

Speakers: Number of speakers of a language is the estimated total of primary and secondary speakers, is in many cases a very rough estimation (based on the page on the English Wikipedia about that language)
Regions are parts of the world where the language is spoken in substantial amounts (compared to total number of speakers). Regions where a language gained presence only by a recent diaspora are generally not included.
Region codes: AF:Africa, AS:Asia, EU:Europe, NA:North America, OC:Oceania, SA:South America, W:World Wide, CL:Constructed Language

Estatísticas geradas em Sexta-feira, 19 de agosto 2016 17:04

Dump file mwlwiki-20160801-stub-meta-history.xml.gz (edits only), size 6.3 Mb as gz -> 40 Mb
Dump processed till Jul 31, 2016, on server stat1002, ready at Mon-08/08/2016-19:48 after 35 sec.

Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### =
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.