Estatísticas da Wikipédia ndonga
Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Articles per size range / Records per namespace / Most edited articles / Zeitgeist
 
Monthly counts & Quarterly rankings
 
DataWikipedistasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia		médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P____Q____R____S__
mar 20113   2511 34,910652816 82 kb3,2 k111,8 k(1)4 
fev 20113   2511 34,910652816 82 kb3,2 k111,8 k(1)4 
jan 20113   2511 34,910652816 82 kb3,2 k111,8 k(1)4 
dez 20103   2511 34,910652816 82 kb3,2 k111,8 k(1)4 
nov 20103   2511 34,910652816 82 kb3,2 k111,8 k(1)4 
out 20103   2511 34,910652816 82 kb3,2 k111,8 k(1)4 
set 20103   2511 34,910652816 82 kb3,2 k111,8 k(1)4 
ago 20103   2511 34,910652816 82 kb3,2 k111,8 k(1)4 
jul 20103   2511 34,910652816 82 kb3,2 k111,8 k(1)4 
jun 20103   2511 34,910652816 82 kb3,2 k111,8 k(1)4 
mai 20103   2511 34,910652816 82 kb3,2 k111,8 k(1)4 
abr 20103   2511 34,910652816 82 kb3,2 k111,8 k(1)4 
mar 20103   2511 34,910652816 82 kb3,2 k111,8 k(1)4 
fev 20103   2511 34,9106528162082 kb3,2 k111,8 k(1)4 
jan 20103   2411 35,5110529171781 kb3,2 k111,8 k(1)4 
dez 20093   2411 34,8110329174681 kb3,2 k111,8 k(2)4 
nov 20093   2410 32,966021123069 kb1,7 k111,8 k(2)4 
out 20093   249 31,664921125068 kb1,6 k81,8 k(2)4 
set 20093   229 32,270423142565 kb1,6 k81,7 k(3)4 
ago 20093   229 31,170423143665 kb1,6 k81,7 k(3)4 
jul 20093   229 29,570423142164 kb1,6 k81,7 k(5)4 
jun 20093   229 28,570423143764 kb1,6 k81,7 k(5)4 
mai 20093   229 26,870423142863 kb1,6 k81,6 k(5)4 
abr 20093   219 26,873524143162 kb1,6 k81,6 k(5)4 
mar 20093   207 26,668120152657 kb1,5 k61,5 k(5)3 
fev 20093   207 25,268120152056 kb1,5 k61,4 k(5)3 
jan 20093   207 24,268120153556 kb1,5 k61,4 k(5)2 
dez 20083   207 22,568120152456 kb1,5 k61,4 k(5)2 
nov 20083   207 21,373325152157 kb1,6 k61,4 k(5)2 
out 2008311 207 20,273325155852 kb1,6 k61,3 k(5)2 
set 20082   92 38,628311 1626 kb3372778(3)3 
ago 20082   62 55,244017171322 kb3395647(3)3 
jul 20082 1 62 5340917 2721 kb3271645(3)3 
jun 20082   62 48,539717 1521 kb316 644(3)1 
mai 20082   62 4639017 1221 kb309 641(3)1 
abr 20082 1 62 4439017 3620 kb309 634(3)1 
mar 20082   62 3839017 920 kb309 632(3)1 
fev 20082   62 36,539017 920 kb309 628(3)1 
jan 20082 2 62 3539017 4420 kb309 625(3)1 
dez 20072   62 27,739017 1420 kb309 621(3)1 
nov 20072   63 25,350233 1316 kb406 548(3)1 
out 20072 1 63 23,250233 2716 kb406 548(3)1 
set 20072   63 18,750233 1516 kb406 546(3)1 
ago 20072   63 16,250233 115 kb406 539(2)1 
jul 20072   63 1650233 215 kb406 539(2)1 
jun 20072   63 15,750233 515 kb406 539(2)1 
mai 20072   52 17,846120 1214 kb305 534(1)1 
abr 200721  52 15,446120 614 kb305 530(1)1 
mar 20071   52 14,246120 1314 kb305 530(1)1 
fev 20071   42 14,556625 711 kb299 406(1)1 
jan 20071 1 42 12,856625 1111 kb299 406(1)1 
dez 20061   42 1056525 69,5 kb297 339(1)1 
nov 20061   42 8,556325 19,4 kb297 334(1)1 
out 20061   42 8,256325 29,3 kb297 330(1)1 
set 20061   42 7,8628252539,9 kb332 328(1)18 
ago 20061   42 754625 29,2 kb286 328(1)1 
jul 20061   42 6,554625 78,8 kb286 312(1)1 
jun 20061   42 4,854625 16,8 kb286 203(1)1 
mai 20061   42 4,554625 46,4 kb286 186(1)1 
abr 20061   2  767  52,5 kb17 99( )  
mar 20061   3  352   2,2 kb19 99( )  
fev 20061   3  352   2,2 kb19 99( )  
jan 20061   3  352  42,2 kb19 99( )  
dez 20051   2  2,562  1224 16 3( )  
nov 200511  2  262  4187 16 3( )  
 totalnovosediçõescontagemnovos
por dia		médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
 WikipedistasArtigosBase de dadosLigações

Counts for image links are based on keyword(s) found in the message file for this language: (Image).
Note that image links based on default keyword 'Image' and/or 'File' have been missed. This will be repaired on the next run.

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

Wikipedistas (usuários registrados)
A = Wikipedistas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikipedistas que editaram pelo menos dez vezes desde que chegaram
C = Wikipedistas que contribuíram cinco vezes ou mais este mês
D = Wikipedistas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Artigos que contêm pelo menos uma ligação interna e 200 caracteres de texto legível, não contando códigos wiki e html,
      ligações ocultas, etc.; títulos também não contam (outras colunas são baseadas no método oficial de contagem)
G = Novos artigos por dia no mês passado
H = Número médio de revisões por artigo
I = Tamanho médio dos artigos em bytes
J = Porcentagem de artigos com pelo menos 0,5 kb de texto legível (veja F)
K = Porcentagem de artigos com pelo menos 2 kb de texto legível (veja F)

Base de dados
L = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
M = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
N = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
O = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
P = Total de ligações para outras wikipédias
Q = Total de imagens apresentadas
R = Total de ligações para outros sítios
S = Total de páginas de redirecionamento
 

Edit activity levels of registered users and bots per group of namespaces

Namespaces: Articles = 0   Talk = 1,3,5,7,9,..   Other = 2,4,6,8,..

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 5  10  5  10  5  5  5  10  5  10 
mar 2011          
fev 2011          
jan 2011          
dez 2010          
nov 2010          
out 2010          
set 2010          
ago 2010          
jul 2010          
jun 2010          
mai 2010          
abr 2010          
mar 2010          
fev 2010  1   1   
jan 2010      11  
dez 2009  3   112 
nov 2009  2     1 
out 2009  52    1 
set 2009  21  1 1 
ago 2009  11    2 
jul 2009  1     1 
jun 2009  21    1 
mai 2009  3   1   
abr 2009  2   2   
mar 2009  2   2 31
fev 2009  2   2 3 
jan 2009  31  1111
dez 2008  11  1 1 
nov 2008  11  221 
out 20081121  3 1 
set 2008  1     1 
ago 2008      1   
jul 20081       1 
jun 2008  1     1 
mai 2008          
abr 20081 2       
mar 2008          
fev 2008      1111
jan 20082 1     2 
dez 2007          
nov 2007  2   1 1 
out 20071 2       
set 2007  11      
ago 2007          
jul 2007          
jun 2007          
mai 2007  1     1 
abr 2007      2   
mar 2007  1     11
fev 2007      1   
jan 20071         
dez 2006          
nov 2006          
out 2006          
set 2006          
ago 2006          
jul 2006          
jun 2006          
mai 2006          
abr 2006          
mar 2006          
fev 2006          
jan 2006          
dez 2005          
nov 2005    1     

 

Distribuição de edições de artigos por wikipedistas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikipedistasEdições total
141100.0%131100.0%
31229.3%9270.2%
1024.9%3426.0%

 

20 wikipedistas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesPrimeira ediçãoúltima edição
 posiçãototaldatadias
atrás		datadias
atrás
Johnson40213119jul 17, 2008986out 30, 2008881
Johannes_Rohr215jan 27, 20071523jan 25, 20081160
Jorunn39out 22, 20071255set 06, 2008935
Spacebirdy49jan 23, 20081162set 10, 2008931
Budelberger57jun 17, 20081016out 08, 2008903
Korg66abr 16, 20081078abr 16, 20081078
Brenda_Xiong_Hmong_fucks_Drini!75out 08, 20071269out 08, 20071269
DerHexer85abr 27, 20081067jun 17, 20081016
Reder95out 16, 2009530fev 07, 2010416
Shambuli104nov 16, 20051960jan 04, 20061911
Willy_on_Wheels114abr 27, 20081067abr 27, 20081067
Wutsje124nov 05, 2009510fev 10, 2010413
Drini133jul 30, 2008973jul 30, 2008973
Pickbothmanlol143dez 06, 2009479dez 06, 2009479
Microchip08153dez 07, 2009478dez 07, 2009478
Chamdarae162nov 17, 20051959nov 17, 20051959
Pill172out 14, 20061628dez 10, 20061571
Jeneme182set 24, 20071283set 24, 20071283
D'ohBot192out 16, 2009530out 17, 2009529
Hégésippe_Cormier201jan 07, 20061908jan 07, 20061908

  

27 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesPrimeira ediçãoúltima edição
 posiçãototaldatadias
atrás		datadias
atrás
SieBot1143set 17, 20071290fev 22, 2010401
JAnDbot297mar 28, 20071463jan 18, 2010436
TXiKiBoT374jan 23, 20071527fev 21, 2010402
Xqbot454mai 20, 2009679fev 16, 2010407
MelancholieBot539mai 31, 20081033nov 18, 2009497
PipepBot627set 02, 20071305mar 14, 20081111
AlleborgoBot727jan 08, 20081177nov 29, 2008851
Thijs!bot826jan 18, 20071532jan 28, 2010426
Synthebot926jan 19, 2009800dez 02, 2009483
ArthurBot1026fev 03, 2009785fev 21, 2010402
Escarbot1120jul 09, 20061725jan 27, 2009792
BotMultichill1212out 09, 20071268jan 01, 20081184
Robbot1311ago 13, 20061690out 05, 2009541
Ptbotgourou1410out 17, 2008894jan 10, 2010444
Purbo_T155mar 08, 20081117mar 27, 2009733
Alexbot164jul 17, 2008986fev 20, 2010403
Almabot174jun 27, 2009641nov 15, 2009500
LaaknorBot184ago 04, 2009603dez 05, 2009480
Rubinbot193jun 23, 2009645jan 12, 2010442
Jotterbot203jul 26, 2009612dez 29, 2009456
HerculeBot213set 01, 2009575nov 11, 2009504
FoxBot223out 16, 2009530nov 18, 2009497
Darkicebot232mar 06, 2009754mar 07, 2009753
CarsracBot242ago 14, 2009593out 14, 2009532
YurikBot251jan 07, 20061908jan 07, 20061908
Muro_Bot261abr 03, 2009726abr 03, 2009726
GhalyBot271ago 14, 2009593ago 14, 2009593

 

Artigos que contêm pelo menos uma ligação interna e .. caracteres de texto legível, não contando códigos wiki e html,
ligações ocultas, etc.; títulos também não contam  (excluindo páginas de redirecionamento)

DataArtigos
 < 32 ch< 64 ch< 128 ch< 256 ch< 512 ch< 1 k ch< 2 k ch< 4 k ch< 8 k ch< 16 k ch< 32 k ch< 64 k ch
mar 201124.0%44.0%52.0%60.0%72.0%72.0%84.0%96.0%96.0%100.0%100.0%100.0%
fev 201124.0%44.0%52.0%60.0%72.0%72.0%84.0%96.0%96.0%100.0%100.0%100.0%
jan 201124.0%44.0%52.0%60.0%72.0%72.0%84.0%96.0%96.0%100.0%100.0%100.0%
dez 201024.0%44.0%52.0%60.0%72.0%72.0%84.0%96.0%96.0%100.0%100.0%100.0%
nov 201024.0%44.0%52.0%60.0%72.0%72.0%84.0%96.0%96.0%100.0%100.0%100.0%
out 201024.0%44.0%52.0%60.0%72.0%72.0%84.0%96.0%96.0%100.0%100.0%100.0%
set 201024.0%44.0%52.0%60.0%72.0%72.0%84.0%96.0%96.0%100.0%100.0%100.0%
ago 201024.0%44.0%52.0%60.0%72.0%72.0%84.0%96.0%96.0%100.0%100.0%100.0%
jul 201024.0%44.0%52.0%60.0%72.0%72.0%84.0%96.0%96.0%100.0%100.0%100.0%
jun 201024.0%44.0%52.0%60.0%72.0%72.0%84.0%96.0%96.0%100.0%100.0%100.0%
mai 201024.0%44.0%52.0%60.0%72.0%72.0%84.0%96.0%96.0%100.0%100.0%100.0%
abr 201024.0%44.0%52.0%60.0%72.0%72.0%84.0%96.0%96.0%100.0%100.0%100.0%
mar 201024.0%44.0%52.0%60.0%72.0%72.0%84.0%96.0%96.0%100.0%100.0%100.0%
fev 201024.0%44.0%52.0%60.0%72.0%72.0%84.0%96.0%96.0%100.0%100.0%100.0%
jan 201025.0%45.8%50.0%58.3%70.8%70.8%83.3%95.8%95.8%100.0%100.0%100.0%
dez 200925.0%45.8%50.0%58.3%70.8%70.8%83.3%95.8%95.8%100.0%100.0%100.0%
nov 200925.0%54.2%58.4%62.6%79.3%79.3%87.6%100.0%100.0%100.0%100.0%100.0%
out 200925.0%54.2%62.5%66.7%79.2%79.2%87.5%100.0%100.0%100.0%100.0%100.0%
set 200922.7%50.0%59.1%63.6%77.2%77.2%86.3%99.9%99.9%99.9%99.9%99.9%
ago 200922.7%50.0%59.1%63.6%77.2%77.2%86.3%99.9%99.9%99.9%99.9%99.9%
jul 200922.7%50.0%59.1%63.6%77.2%77.2%86.3%99.9%99.9%99.9%99.9%99.9%
jun 200922.7%50.0%59.1%63.6%77.2%77.2%86.3%99.9%99.9%99.9%99.9%99.9%
mai 200922.7%50.0%59.1%63.6%77.2%77.2%86.3%99.9%99.9%99.9%99.9%99.9%
abr 200923.8%47.6%57.1%61.9%76.2%76.2%85.7%100.0%100.0%100.0%100.0%100.0%
mar 200925.0%50.0%60.0%65.0%80.0%80.0%85.0%100.0%100.0%100.0%100.0%100.0%
fev 200925.0%50.0%60.0%65.0%80.0%80.0%85.0%100.0%100.0%100.0%100.0%100.0%
jan 200925.0%50.0%60.0%65.0%80.0%80.0%85.0%100.0%100.0%100.0%100.0%100.0%
dez 200825.0%50.0%60.0%65.0%80.0%80.0%85.0%100.0%100.0%100.0%100.0%100.0%
nov 200825.0%50.0%60.0%65.0%75.0%75.0%85.0%100.0%100.0%100.0%100.0%100.0%
out 200825.0%50.0%60.0%65.0%75.0%75.0%85.0%100.0%100.0%100.0%100.0%100.0%
set 200822.2%55.5%66.6%77.7%88.8%88.8%99.9%99.9%99.9%99.9%99.9%99.9%
ago 200816.7%50.0%50.0%66.7%83.4%83.4%83.4%100.0%100.0%100.0%100.0%100.0%
jul 200816.7%50.0%50.0%66.7%83.4%83.4%100.0%100.0%100.0%100.0%100.0%100.0%
jun 200816.7%50.0%66.7%66.7%83.4%83.4%100.0%100.0%100.0%100.0%100.0%100.0%
mai 200816.7%50.0%66.7%66.7%83.4%83.4%100.0%100.0%100.0%100.0%100.0%100.0%
abr 200816.7%50.0%66.7%66.7%83.4%83.4%100.0%100.0%100.0%100.0%100.0%100.0%
mar 200816.7%50.0%66.7%66.7%83.4%83.4%100.0%100.0%100.0%100.0%100.0%100.0%
fev 200816.7%50.0%66.7%66.7%83.4%83.4%100.0%100.0%100.0%100.0%100.0%100.0%
jan 200816.7%50.0%66.7%66.7%83.4%83.4%100.0%100.0%100.0%100.0%100.0%100.0%
dez 200716.7%50.0%66.7%66.7%83.4%83.4%100.0%100.0%100.0%100.0%100.0%100.0%
nov 200716.7%33.4%50.1%50.1%66.8%83.5%100.0%100.0%100.0%100.0%100.0%100.0%
out 200716.7%33.4%50.1%50.1%66.8%83.5%100.0%100.0%100.0%100.0%100.0%100.0%
set 200716.7%33.4%50.1%50.1%66.8%83.5%100.0%100.0%100.0%100.0%100.0%100.0%
ago 200716.7%33.4%50.1%50.1%66.8%83.5%100.0%100.0%100.0%100.0%100.0%100.0%
jul 200716.7%33.4%50.1%50.1%66.8%83.5%100.0%100.0%100.0%100.0%100.0%100.0%
jun 200716.7%33.4%50.1%50.1%66.8%83.5%100.0%100.0%100.0%100.0%100.0%100.0%
mai 200720.0%40.0%60.0%60.0%80.0%80.0%100.0%100.0%100.0%100.0%100.0%100.0%
abr 200720.0%40.0%60.0%60.0%80.0%80.0%100.0%100.0%100.0%100.0%100.0%100.0%
mar 200720.0%40.0%60.0%60.0%80.0%80.0%100.0%100.0%100.0%100.0%100.0%100.0%
fev 20070.0%25.0%50.0%50.0%75.0%75.0%100.0%100.0%100.0%100.0%100.0%100.0%
jan 20070.0%25.0%50.0%50.0%75.0%75.0%100.0%100.0%100.0%100.0%100.0%100.0%
dez 20060.0%25.0%50.0%50.0%75.0%75.0%100.0%100.0%100.0%100.0%100.0%100.0%
nov 20060.0%25.0%50.0%50.0%75.0%75.0%100.0%100.0%100.0%100.0%100.0%100.0%
out 20060.0%25.0%50.0%50.0%75.0%75.0%100.0%100.0%100.0%100.0%100.0%100.0%
set 20060.0%25.0%50.0%50.0%75.0%75.0%75.0%100.0%100.0%100.0%100.0%100.0%
ago 20060.0%25.0%50.0%50.0%75.0%75.0%100.0%100.0%100.0%100.0%100.0%100.0%
jul 20060.0%25.0%50.0%50.0%75.0%75.0%100.0%100.0%100.0%100.0%100.0%100.0%
jun 20060.0%25.0%50.0%50.0%75.0%75.0%100.0%100.0%100.0%100.0%100.0%100.0%
mai 20060.0%25.0%50.0%50.0%75.0%75.0%100.0%100.0%100.0%100.0%100.0%100.0%
abr 20060.0%50.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
mar 200633.3%66.6%99.9%99.9%99.9%99.9%99.9%99.9%99.9%99.9%99.9%99.9%
fev 200633.3%66.6%99.9%99.9%99.9%99.9%99.9%99.9%99.9%99.9%99.9%99.9%
jan 200633.3%66.6%99.9%99.9%99.9%99.9%99.9%99.9%99.9%99.9%99.9%99.9%
dez 20050.0%50.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
nov 20050.0%50.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1		Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110Png
mar 20112529011112719      60%1
fev 20112529011112719      60%1
jan 20112529011112719      60%1
dez 20102529011112719      60%1
nov 20102529011112719      60%1
out 20102529011112719      60%1
set 20102529011112719      60%1
ago 20102529011112719      60%1
jul 20102529011112719      60%1
jun 20102529011112719      60%1
mai 20102529011112719      60%1
abr 20102529011112719      60%1
mar 20102529011112719      60%1
fev 201025290111 2719      60%1
jan 201024283111 2719      62%1
dez 200924261111 2719      62%1
nov 200924256111 21 9      42%1
out 20092425311  20 9      42% 
set 20092224911  20 9      45% 
ago 20092223711  20 9      45% 
jul 20092223511  20 9      45% 
jun 20092222811  20 9      45% 
mai 20092222311  19 9      45% 
abr 20092121510  18 8      48% 
mar 20092020510  18 8      45% 
fev 20092019610  18 8      45% 
jan 20092018910  18 8      45% 
dez 20082018410  17 7      40% 
nov 20082017610  17 7      40% 
out 20082015810  17 7      40% 
set 200891428  14 4      11% 
ago 200871317  14 4      17% 
jul 200871245  10 4      17% 
jun 200871145  5 4      17% 
mai 200871035  5 4      17% 
abr 200871005  5 4      17% 
mar 20086974  5 4      17% 
fev 20086914  5 4      17% 
jan 20086804  5 3      17% 
dez 20076754  4 3      17% 
nov 20076724  4 3      17% 
out 20076694  3 1      17% 
set 20076633  3 1      17% 
ago 20076613  1 1      17% 
jul 20076573  1 1      17% 
jun 20076543  1 1      17% 
mai 20075533  1 1      20% 
abr 20075523  1 1      20% 
mar 20075472  1          
fev 20075442  1          
jan 20075361  1          
dez 20065331  1          
nov 20065311  1          
out 20065301  1          
set 20065271  1          
ago 20065261             
jul 20065241             
jun 20065241             
mai 20065241             
abr 20064241             
mar 20064231             
fev 20064211             
jan 20064211             
dez 20053151             
nov 20052121             

 

19 most edited articles (> 25 edits)
 

EdiçõesUnique usersArtigosArchived
TotalReg.Reg.Unreg.
13587%3115Wikipedia< 1 Mb  
9092%277Hastangi< 1 Mb  
8988%2010Ombimbeli< 1 Mb  
8488%219Geografi< 1 Mb  
6676%2212Omushangwa Gwaayehe Guuthemba Womuntu< 1 Mb  
60100%1 User:WikimediaNotifier/notifications< 1 Mb  
56100%15 English< 1 Mb  
52100%13 Category:Candidates for speedy deletion< 1 Mb  
4593%132Turkey< 1 Mb  
3990%122Asia< 1 Mb  
3759%914Main Page< 1 Mb  
3583%115Taiwan< 1 Mb  
29100%2 User:Vargenau< 1 Mb  
29100%1 User:Purbo T< 1 Mb  
2896%121Pigazzano< 1 Mb  
2789%183Wikipedia:Community Portal2.5 Mb  
2796%101Genesis< 1 Mb  
2796%91Category:Geografi< 1 Mb  
2673%136Hambili Tarkerazu2.3 Mb  

 

ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

nov 2005: 1 2 Wikipedia

dez 2005: 1 1 Geografi

jan 2006: 1 2 Main Page

abr 2006: 1 1 Main Page

out 2006: 1 1 Main Page

dez 2006: 1 1 Main Page

jan 2007: 1 1 Main Page

fev 2007: 1 1 Main Page

mar 2007: 1 1 Main Page

abr 2007: 1 2 Hastangi , 2 1 Wikipedia

set 2007: 1 1 Wikipedia

out 2007: 1 2 Wikipedia , 2 1 Omushangwa Gwaayehe Guuthemba Womuntu

dez 2007: 1 1 Omushangwa Gwaayehe Guuthemba Womuntu

jan 2008: 1 4 Hastangi , 2 3 Omushangwa Gwaayehe Guuthemba Womuntu , 3 3 Geografi

fev 2008: 1 1 Wikipedia

abr 2008: 1 4 Ndonga , 2 3 Ombimbeli , 3 3 Wikipedia

jun 2008: 1 1 Main Page

jul 2008: 1 2 Omushangwa Gwaayehe Guuthemba Womuntu , 2 2 Geografi , 3 1 Ndonga

ago 2008: 1 1 Main Page

set 2008: 1 2 Omushangwa Gwaayehe Guuthemba Womuntu , 2 1 English

out 2008: 1 2 Eksodus , 2 1 Mateus

dez 2008: 1 1 Hambili Tarkerazu

jan 2009: 1 2 Hambili Tarkerazu

fev 2009: 1 1 Hambili Tarkerazu

abr 2009: 1 1 Hambili Tarkerazu

mai 2009: 1 1 Duisburg

jul 2009: 1 1 Hambili Tarkerazu

ago 2009: 1 1 Omushangwa Gwaayehe Guuthemba Womuntu

out 2009: 1 1 Pigazzano

nov 2009: 1 2 Hambili Tarkerazu

dez 2009: 1 3 Hambili Tarkerazu , 2 2 Ndonga , 3 1 Pigazzano

jan 2010: 1 1 Omushangwa Gwaayehe Guuthemba Womuntu

fev 2010: 1 1 Nowy Dwór Królewski

Wikipedias are initially ordered by number of speakers of the language

Speakers: Number of speakers of a language is the estimated total of primary and secondary speakers, is in many cases a very rough estimation (based on the page on the English Wikipedia about that language)
Regions are parts of the world where the language is spoken in substantial amounts (compared to total number of speakers). Regions where a language gained presence only by a recent diaspora are generally not included.
Region codes: AF:Africa, AS:Asia, EU:Europe, NA:North America, OC:Oceania, SA:South America, W:World Wide, CL:Constructed Language

Estatísticas geradas em Segunda-feira, 4 de abril 2011 a partir de cópias do banco de dados SQL de Quinta-feira, 31 de março 2011
Versão do script:2.6
Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.