Estatísticas da Wikipédia português

Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Articles per size range / Records per namespace / Most edited articles / Zeitgeist
  Dec 2017: WMF Analytics Team is happy to announce the first release of Wikistats 2

  Wikistats has been redesigned for architectural simplicity, faster data processing, and a more dynamic and interactive user experience. The data used in the reports will also be made available for external processing.  

  First goal is to match the numbers of the current system, and to provide the most important reports, as decided by the Wikistats community (see survey).  
  Over time, we will continue to migrate reports and add new ones that you find useful. We can also analyze the data in new and interesting ways, and look forward to hearing your feedback and suggestions.  

  You can go directly to Wikipedia português


Most metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.

Some metrics have been collected from the full archive dump which runs on lower frequency than the usual monthly cycle.
These metrics are columns F,I,J,K,M,N,O,P,Q,R from the first table.

See also metrics definitions

Monthly counts & Quarterly rankings: junho 2018
DataWikipedistasArtigosBase de dadosLigações
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
jun 20180% 0%-8%0% +62%    +3%      0%
mai 20180% -3%-1%0% +24%    +17%      +2%
abr 2018+1% +2%-5%0% -37%    -8%      0%
mar 2018+1% +6%+18%0% +15%    +28%      0%
fev 20180% -13%-13%0% -27%    -21%      0%
jan 2018+1% +5%+2%0% +47%    +1%      0%
jun 20185308023814661981000 k 16035,6   219 k      792 k
mai 2018528422371461215995 k 9935,6   212 k      789 k
abr 2018526052851511218992 k 8035,5   181 k      771 k
mar 2018523202721482229989 k 12735,4   198 k      768 k
fev 2018520482441404194986 k 11035,3   154 k      765 k
jan 2018518043041608222982 k 15035,3   196 k      764 k
dez 2017515002881527218978 k 10235,3   194 k      760 k
nov 2017512122771453218975 k 10935,2   216 k      756 k
out 2017509352171421218971 k 9835,1   230 k      752 k
set 2017507183311463209968 k 7834,9   184 k      749 k
ago 2017503872481381203966 k 8734,8   196 k      747 k
jul 2017501392741487208963 k 9534,7   203 k      745 k
jun 2017498652591404200960 k 9234,6   165 k      742 k
mai 2017496062771497201958 k 9134,5   164 k      740 k
abr 2017493293601557212955 k 11934,5   186 k      738 k
mar 2017489693031530208951 k 18334,4   198 k      736 k
fev 2017486663061439199946 k 13134,4   172 k      733 k
jan 2017483603701681215942 k 12134,4   194 k      730 k
dez 2016479903151524201938 k 13034,3   168 k      727 k
nov 2016476753081488206934 k 18834,3   181 k      724 k
out 2016473672931494190928 k 12234,3   174 k      721 k
set 2016470743011440179925 k 12734,2   183 k      718 k
ago 2016467732801361203921 k 14434,2   190 k      716 k
jul 2016464933441530204916 k 14134,1   192 k      713 k
jun 2016461493301464186912 k 16734,1   203 k      710 k
mai 2016458192811460191907 k 10634   197 k      708 k
abr 2016455382521347184904 k 12434   187 k      704 k
mar 2016452863011416172900 k 16733,9   199 k      701 k
fev 2016449852601368186895 k 12533,9   224 k      698 k
jan 2016447253281506206891 k 22933,7   207 k      694 k
dez 2015443972771410182884 k 19033,8   199 k      688 k
nov 2015441202871346176878 k 10833,8   218 k      684 k
out 2015438333051411169875 k 11433,7   188 k      681 k
set 2015435282511310174871 k 13833,6   205 k      678 k
ago 2015432773101452182867 k 12133,5   189 k      675 k
jul 2015429673801556186863 k 12733,4   190 k      672 k
jun 2015425873571517172860 k 11133,4   185 k      668 k
mai 2015422303041470180856 k 11233,3   188 k      666 k
abr 2015419263021471201853 k 10833,2   189 k      662 k
mar 2015416243121520189850 k 8133,1   172 k      660 k
fev 2015413123661571175847 k 11233   163 k      658 k
jan 2015409464071644200844 k 12432,9   173 k      655 k
dez 2014405392891487173840 k 25832,9   167 k      653 k
nov 2014402503251497162832 k 17533   236 k      650 k
out 2014399252931364162827 k 11832,9   175 k      638 k
set 2014396323031420154823 k 20232,8   160 k      631 k
ago 2014393293901591157817 k 12732,9   180 k      628 k
jul 2014389393081506154813 k 10032,8   147 k      626 k
jun 2014386313231441146810 k 11632,8   192 k      623 k
mai 2014383082851380152807 k 9032,7   181 k      621 k
abr 2014380232711330167804 k 9032,6   179 k      618 k
mar 2014377523191478176801 k 9632,4   192 k      616 k
fev 2014374332491360176798 k797 k11932,3239689%32%162 k2,9 Gb350 M18,3 M79 k65 k2,2 M613 k
jan 2014371843241487187795 k794 k27432,3239289%32%171 k2,9 Gb347 M18,2 M79 k64 k2,2 M610 k
dez 2013368602431349165786 k785 k22332,4238889%32%227 k2,8 Gb342 M18,0 M77 k63 k2,2 M606 k
nov 2013366172151306148779 k778 k7132,4237689%32%156 k2,8 Gb337 M17,8 M76 k62 k2,0 M603 k
out 2013364022311314149777 k776 k8632,3237489%32%141 k2,8 Gb334 M17,7 M76 k61 k2,0 M600 k
set 2013361712161334158775 k774 k12532,2236689%32%154 k2,7 Gb331 M17,6 M76 k61 k2,0 M597 k
ago 2013359552341388190771 k770 k20032,2235989%32%161 k2,7 Gb328 M17,5 M74 k60 k2,0 M594 k
jul 2013357213101518205765 k764 k14632,2235589%32%198 k2,7 Gb325 M17,4 M79 k59 k1,9 M592 k
jun 2013354113181552193760 k759 k9932,1234789%31%218 k2,6 Gb321 M17,2 M82 k57 k1,9 M589 k
mai 2013350933951664215757 k756 k16232234189%31%250 k2,6 Gb318 M17,1 M87 k56 k1,9 M586 k
abr 2013346983221601200752 k751 k13531,9234089%31%263 k2,6 Gb315 M17,0 M93 k54 k1,8 M582 k
mar 2013343763081555187748 k747 k11831,7233389%31%742 k2,6 Gb311 M16,9 M206 k53 k1,8 M579 k
fev 2013340682721500198744 k743 k11530,8232988%31%270 k2,7 Gb308 M16,8 M7,4 M52 k1,8 M576 k
jan 2013337963191746214741 k740 k14130,6232288%31%305 k2,7 Gb305 M16,7 M7,3 M51 k1,8 M573 k
dez 2012334773121527210737 k736 k13830,4231588%30%281 k2,7 Gb301 M16,5 M7,2 M50 k1,7 M569 k
nov 2012331652541494183733 k731 k10930,2231088%30%238 k2,6 Gb298 M16,4 M7,1 M48 k1,7 M566 k
out 2012329112711462181729 k728 k11430230688%30%281 k2,6 Gb295 M16,3 M7,0 M47 k1,7 M563 k
set 2012326402931493187726 k725 k13929,7230088%30%249 k2,6 Gb292 M16,2 M6,9 M47 k1,7 M561 k
ago 2012323472721547199722 k722 k17829,6229588%30%307 k2,5 Gb289 M16,1 M6,8 M46 k1,6 M559 k
jul 2012320753331688223716 k714 k18829,4228888%30%301 k2,5 Gb285 M15,9 M6,7 M45 k1,6 M556 k
jun 2012317423241641206710 k708 k12529,2228088%29%248 k2,5 Gb281 M15,7 M6,6 M43 k1,6 M551 k
mai 2012314183341614220707 k705 k13229227388%29%267 k2,4 Gb278 M15,6 M6,5 M42 k1,5 M548 k
abr 2012310842921569198702 k700 k10128,8226588%29%256 k2,4 Gb275 M15,4 M6,4 M42 k1,5 M546 k
mar 2012307922851544214699 k698 k10528,5225688%29%248 k2,4 Gb272 M15,3 M6,3 M41 k1,5 M543 k
fev 2012305073101599214696 k694 k12628,3224787%29%304 k2,4 Gb269 M15,2 M6,2 M40 k1,5 M541 k
jan 2012301973351699254693 k690 k12328223387%28%300 k2,3 Gb266 M15,1 M6,2 M38 k1,4 M538 k
dez 2011298623241615214689 k686 k12927,7221987%28%256 k2,3 Gb262 M14,9 M6,1 M38 k1,4 M536 k
nov 2011295382751451186685 k682 k10727,5220887%28%245 k2,3 Gb258 M14,8 M6,0 M37 k1,4 M533 k
out 2011292632721527211682 k679 k12927,3220187%28%248 k2,3 Gb256 M14,7 M5,9 M35 k1,4 M530 k
set 2011289912841584211678 k675 k12127,1219487%27%248 k2,2 Gb252 M14,5 M5,9 M34 k1,3 M527 k
ago 2011287073181603234674 k672 k12326,9218387%27%277 k2,2 Gb249 M14,4 M5,8 M33 k1,3 M525 k
jul 2011283893361689242670 k668 k12826,6217287%27%305 k2,2 Gb246 M14,3 M5,8 M31 k1,3 M522 k
jun 2011280533381647201666 k664 k10426,3215887%27%269 k2,1 Gb243 M14,1 M5,7 M30 k1,3 M519 k
mai 2011277153161563209663 k661 k11726214487%27%299 k2,1 Gb240 M14,0 M5,6 M29 k1,3 M517 k
abr 2011273993061587214659 k657 k12725,7213386%26%311 k2,1 Gb237 M13,9 M5,5 M28 k1,2 M514 k
mar 2011270933341629209656 k653 k15825,4212386%26%288 k2,1 Gb234 M13,7 M5,4 M27 k1,2 M512 k
fev 2011267593781675229651 k648 k16625,1211586%26%258 k2,0 Gb230 M13,6 M5,3 M26 k1,2 M509 k
jan 2011263813981912262646 k643 k21524,9210786%26%323 k2,0 Gb227 M13,5 M5,2 M25 k1,2 M506 k
dez 2010259834031717239639 k636 k80024,7209886%26%308 k2,0 Gb223 M13,3 M5,2 M24 k1,1 M502 k
nov 2010255803271614208615 k610 k55825,2212385%26%277 k1,9 Gb217 M13,0 M5,1 M23 k1,1 M496 k
out 2010252533351583200598 k592 k16425,4212485%26%243 k1,9 Gb211 M12,7 M5,0 M22 k1,0 M493 k
set 2010249183551597226593 k587 k19325,2211785%25%256 k1,8 Gb208 M12,5 M4,9 M21 k1,0 M490 k
ago 2010245633631649217587 k581 k40425211285%25%301 k1,8 Gb205 M12,4 M4,8 M21 k981 k487 k
jul 2010242004071718226574 k568 k23425,1211285%25%273 k1,8 Gb200 M12,1 M4,7 M19 k933 k484 k
jun 2010237933621642202567 k561 k19724,9210484%25%291 k1,7 Gb196 M11,9 M4,6 M17 k908 k481 k
mai 2010234314011797216561 k555 k59524,6209884%25%402 k1,7 Gb193 M11,8 M4,5 M16 k887 k478 k
abr 2010230304441825236543 k536 k26624,7212484%25%325 k1,6 Gb188 M11,4 M4,4 M15 k848 k473 k
mar 2010225864301749234535 k528 k27124,5212484%25%302 k1,6 Gb184 M11,2 M4,3 M14 k824 k468 k
fev 2010221564261762224526 k519 k23024,3212083%25%278 k1,6 Gb180 M11,0 M4,2 M14 k799 k464 k
jan 2010217304341863238520 k512 k23924,1211683%24%286 k1,5 Gb176 M10,8 M4,2 M14 k777 k459 k
dez 2009212964221653201513 k504 k24623,9211483%24%277 k1,5 Gb172 M10,6 M4,1 M13 k755 k455 k
nov 2009208743761600192505 k496 k28923,7211183%24%257 k1,5 Gb168 M10,4 M4,0 M13 k734 k451 k
out 2009204983881718186496 k487 k18623,6211683%24%311 k1,4 Gb165 M10,2 M3,9 M12 k711 k446 k
set 2009201104191749212491 k481 k17423,2211082%24%265 k1,4 Gb161 M10,0 M3,9 M12 k692 k443 k
ago 2009196914321861227485 k476 k25422,9209882%23%287 k1,4 Gb159 M9,9 M3,8 M12 k676 k439 k
jul 2009192594711845228477 k468 k23022,7208382%23%258 k1,4 Gb155 M9,7 M3,7 M12 k655 k433 k
jun 2009187884031685222470 k461 k22422,5206582%23%260 k1,3 Gb151 M9,5 M3,6 M11 k634 k428 k
mai 2009183854191762214464 k454 k21522,3204682%23%266 k1,3 Gb148 M9,3 M3,6 M10 k615 k424 k
abr 2009179664041634206457 k448 k20022203082%23%246 k1,3 Gb144 M9,1 M3,5 M8,9 k597 k419 k
mar 2009175624111666217451 k442 k21621,7201082%22%241 k1,2 Gb141 M8,9 M3,4 M7,5 k581 k414 k
fev 2009171513801627205444 k435 k24821,5199582%22%248 k1,2 Gb138 M8,8 M3,4 M5,6 k564 k410 k
jan 2009167714771785236437 k428 k23321,3197882%22%259 k1,2 Gb135 M8,6 M3,3 M4,6 k544 k406 k
dez 2008162943781560221430 k421 k20621,1195781%22%243 k1,2 Gb131 M8,4 M3,2 M2,8 k521 k400 k
nov 2008159163921566207424 k415 k20220,8193781%21%254 k1,1 Gb128 M8,2 M3,1 M1,1 k504 k394 k
out 2008155243731582191418 k409 k23520,5192081%21%252 k1,1 Gb125 M8,0 M3,1 M26 k488 k389 k
set 2008151514121637197410 k403 k18220,2190181%20%303 k1,1 Gb122 M7,8 M3,0 M24 k461 k385 k
ago 2008147394291678219405 k397 k23519,8187881%20%269 k1,0 Gb119 M7,7 M2,9 M100 k446 k381 k
jul 2008143104861833234398 k391 k23919,5186281%20%259 k1,0 Gb116 M7,5 M2,8 M97 k430 k376 k
jun 2008138244401699210390 k384 k91719,2184481%20%302 k1016 Mb112 M7,2 M2,7 M95 k413 k370 k
mai 2008133844591788221363 k355 k21719,8188080%20%293 k954 Mb107 M6,8 M2,5 M93 k390 k351 k
abr 2008129254681708216356 k348 k19219,3185980%20%248 k926 Mb103 M6,6 M2,4 M91 k370 k346 k
mar 2008124574121648215350 k342 k20918,9183779%20%258 k900 Mb101 M6,5 M2,3 M89 k357 k342 k
fev 2008120454741649202344 k336 k22718,5182279%20%265 k876 Mb98,0 M6,3 M2,3 M88 k345 k336 k
jan 2008115715201767219337 k329 k22518,1180479%19%253 k853 Mb95,2 M6,2 M2,2 M86 k332 k327 k
dez 2007110514381580202330 k321 k22617,7178478%19%230 k826 Mb92,2 M6,0 M2,1 M86 k319 k321 k
nov 2007106134681654183323 k314 k21917,4177378%19%227 k804 Mb89,5 M5,8 M2,1 M84 k306 k314 k
out 2007101454841684217317 k308 k146517,1174978%18%321 k778 Mb86,5 M5,7 M2,0 M81 k293 k308 k
set 200796614411573196271 k263 k20218,7178975%20%235 k664 Mb75,9 M4,8 M1,8 M78 k204 k301 k
ago 200792204271461187265 k257 k18918,3177075%20%248 k642 Mb73,3 M4,7 M1,7 M75 k193 k296 k
jul 200787934241497185259 k251 k23517,7175075%19%235 k620 Mb70,7 M4,5 M1,7 M77 k184 k262 k
jun 200783694241480187252 k243 k23317,3173074%19%203 k595 Mb67,9 M4,3 M1,6 M75 k174 k235 k
mai 200779454581529184245 k237 k20417171574%19%262 k573 Mb65,4 M4,2 M1,6 M72 k166 k218 k
abr 200774874791508165239 k230 k19716,3171879%18%201 k558 Mb63,2 M4,0 M1,5 M72 k158 k210 k
mar 200770084421476176233 k224 k18115,9169879%18%230 k538 Mb60,9 M3,9 M1,4 M67 k150 k206 k
fev 200765663641253148227 k218 k18315,3167978%18%182 k518 Mb58,6 M3,8 M1,4 M64 k143 k193 k
jan 200762023841291189222 k213 k63014,8166078%17%254 k499 Mb56,4 M3,6 M1,3 M60 k137 k182 k
dez 200658184401290184202 k190 k37715167575%18%323 k456 Mb51,7 M3,2 M1,2 M55 k129 k175 k
nov 200653783741235170191 k178 k25014,2166174%18%219 k423 Mb48,2 M3,0 M1,1 M52 k123 k74 k
out 200650044251239156183 k172 k18413,6163474%17%208 k401 Mb45,5 M2,8 M1,1 M47 k116 k69 k
set 200645793941220154178 k166 k29212,8159973%17%178 k382 Mb43,0 M2,7 M1,0 M44 k107 k64 k
ago 200641854141186160169 k159 k35812,4158274%16%191 k359 Mb40,2 M2,5 M982 k41 k101 k60 k
jul 200637713921108149158 k148 k32212,1152972%15%185 k326 Mb36,3 M2,3 M918 k31 k87 k55 k
jun 20063379326964127148 k138 k34811,7149871%15%182 k298 Mb33,3 M2,1 M836 k27 k80 k50 k
mai 20063053312937127137 k127 k32711,2149470%15%150 k276 Mb30,9 M1,9 M758 k25 k74 k46 k
abr 20062741289855123127 k118 k21011147869%14%166 k254 Mb28,4 M1,8 M709 k22 k62 k42 k
mar 20062452297846127121 k110 k18110,1144168%14%132 k236 Mb26,3 M1,7 M628 k20 k56 k39 k
fev 20062155304796114115 k105 k2119,5140067%13%116 k220 Mb24,3 M1,6 M567 k18 k51 k35 k
jan 2006185126468299109 k99 k6158,9136067%12%158 k202 Mb22,3 M1,5 M534 k16 k46 k31 k
dez 200515871634978690 k80 k2029,1141861%13%90 k169 Mb19,2 M1,2 M469 k13 k39 k27 k
nov 200514241434186984 k74 k1268,7139559%13%69 k155 Mb17,6 M1,1 M430 k11 k35 k24 k
out 200512811173976780 k70 k1218,2136558%12%65 k145 Mb16,3 M1,1 M398 k11 k32 k22 k
set 20051164983344876 k67 k1627,8132657%12%52 k134 Mb15,1 M983 k356 k9,3 k29 k20 k
ago 200510661123546172 k62 k4087,6131657%12%70 k125 Mb14,0 M914 k341 k8,6 k27 k19 k
jul 20059541263556559 k50 k1358136153%13%62 k104 Mb12,1 M747 k293 k7,6 k24 k16 k
jun 20058281032956055 k46 k1577,5119052%12%79 k86 Mb9,9 M651 k263 k5,8 k19 k14 k
mai 2005725932665450 k39 k3696,6113252%11%65 k75 Mb8,6 M583 k240 k4,3 k17 k12 k
abr 2005632942565239 k29 k1456,9116941%13%42 k59 Mb7,0 M428 k198 k3,3 k15 k9,4 k
mar 2005538661823634 k25 k786,6114740%13%28 k51 Mb6,1 M370 k176 k2,4 k12 k7,7 k
fev 2005472571692932 k23 k736,2110938%12%26 k45 Mb5,4 M329 k164 k2,0 k10 k6,6 k
jan 2005415491513630 k21 k615,8107535%12%20 k41 Mb4,9 M296 k148 k1,8 k9,1 k5,7 k
dez 2004366641563528 k19 k605,599733%11%23 k37 Mb4,3 M262 k141 k1,5 k7,7 k4,9 k
nov 2004302631453026 k17 k62592930%10%23 k32 Mb3,7 M232 k128 k8796,1 k4,0 k
out 200423931992724 k16 k584,486328%9%17 k28 Mb3,2 M201 k121 k7265,1 k3,3 k
set 200420837972522 k14 k280480425%8%25 k25 Mb2,8 M172 k112 k4734,1 k2,7 k
ago 200417125752214 k8,2 k544,699636%11%14 k17 Mb2,1 M134 k36 k3783,3 k2,2 k
jul 200414640772112 k6,6 k1304,193334%10%16 k14 Mb1,8 M105 k31 k3332,6 k1,8 k
jun 20041061350138,3 k4,8 k504,2103336%10%9,6 k11 Mb1,3 M73 k21 k3052,0 k1,2 k
mai 2004932351106,8 k3,9 k523,798434%10%7,3 k8,6 Mb1,0 M54 k15 k2401,6 k891
abr 200470204285,2 k2,6 k323,497034%10%5,1 k6,4 Mb750 k38 k8,2 k841,2 k688
mar 200450173364,2 k2,0 k58390031%9%5,4 k5,1 Mb559 k28 k5,6 k76763535
fev 20043371432,4 k1,4 k343113738%12%3,8 k3,8 Mb398 k18 k4,0 k26574375
jan 20042641111,4 k86282,4147037%16%9002,5 Mb274 k11 k2,0 k16408257
dez 20032236 1,2 k72712,1177742%18%2602,2 Mb251 k8,9 k65010311153
nov 200319   1,2 k705 1,9179441%18% 2,2 Mb245 k8,6 k19910323147
out 20031911 1,2 k70511,9179441%18%1272,2 Mb245 k8,6 k19910323147
set 200318   1,1 k68021,9179741%18%1182,1 Mb238 k8,4 k15410321140
ago 2003181311,1 k65471,8176741%17%4912,0 Mb224 k7,7 k882278137
jul 20031714 85646231,7193337%18%1911,8 Mb184 k5,9 k733254124
jun 20031627 75840331,7203037%19%1831,6 Mb172 k5,2 k563235116
mai 20031415 66434641,7186936%17%1831,3 Mb140 k4,4 k511203111
abr 20031312 55227221,7189333%16%981,0 Mb114 k3,6 k51 17394
mar 200312 3 49925811,7192634%16%51948 kb112 k3,5 k51 16187
fev 20031215 47624431,7176233%16%127855 kb99 k3,2 k51 15784
jan 20031133 40020231,6186232%17%146765 kb90 k2,9 k51 15076
dez 2002811 31415911,6203934%17%67640 kb78 k2,3 k5 10964
nov 2002711 28213611,6214532%17%35599 kb74 k2,2 k1 10760
out 2002611 25712511,6216333%18%42568 kb69 k2,1 k1 9160
set 2002511 23410911,6218932%19%29521 kb64 k1,9 k1 8257
ago 20024   212107 1,6219335%21%29506 kb63 k1,9 k1 8253
jul 20024   20210411,5226336%21%23495 kb62 k1,9 k1 8247
jun 20024 1 1869911,5227437%23%42476 kb60 k1,8 k1 7146
mai 2002411 15988 1,5257840%26%21463 kb59 k1,8 k1 6943
abr 20023   14584 1,6285843%29%6461 kb58 k1,7 k1 6938
mar 20023   14084 1,6287945%30%16459 kb58 k1,7 k1 6938
fev 20023   13279 1,5270644%30%10419 kb53 k1,6 k  6236
jan 20023   12674 1,5256243%29%6388 kb47 k1,5 k  4536
dez 20013   12372 1,5257242%28%11373 kb46 k1,5 k  4535
nov 20013 1 1187011,5267142%30%35371 kb46 k1,5 k  4532
out 2001312 995621,4230938%26%108270 kb33 k1,2 k  2727
set 200121  2315 1,4108239%26%1346 kb3,9 k94  74
ago 20011 1 1613 1,2105144%31%1226 kb3,0 k75  62
jul 20011   54 1,6103960%60%27,5 kb1,2 k31  21
jun 200111  33 299267%67%65,1 kb79024  21
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternas

> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
The following table ranks this project in relation to projects in other languages with 1000+ articles
abr 201810991015 1729   14      278
jan 2018101091015 1229   14      278
out 20179991014 1531   13      278
jul 201791191014 1932   13      278
abr 20179991014 1732   12      278
jan 20179991114 1532   13      278
out 20169991114 1633   13      278
jul 20169891014 1535   13      278
abr 20169991114 1835   13      278
jan 20169991114 1134   14      278
out 20159991114 2235   10      278
jul 20159991114 1934   10      278
abr 20159991114 1638   12      278
jan 20158991114 1540   12      278
out 20148991114 1541   15      278
jul 20148991114 2148   16      278
abr 20148991114 2248   12      278
jan 20148991114136494432451410111013397278
out 201389911141319504332421410111014397278
jul 20138991112111851463041151091012397278
abr 201389911111019544429431099911397277
jan 2013899111091860412945139997417277
out 2012899111091964432645129997417277
jul 2012899111091766422442109997427277
abr 2012899111091868422242119997427277
jan 2012899101091866422541109997427277
out 201189911109166742253998897437277
jul 2011889111091669432340108887457277
abr 201188910108197443244388887447277
jan 201188891071173422341108887447277
out 201088811108136340244098887457277
jul 2010889109896041214098987478277
abr 20108810109895838224299987518277
jan 2010881099995639244491010107539277
out 200988101199135538214281010107539277
jul 20098810119995235214791010107539277
abr 200988101199104736214610101097569277
jan 200988910891145362044910997729276
out 2008891011881045352144910997369274
jul 2008889118810483520421010997139273
abr 2008879108812423321419109971310273
jan 20089791088104333214210109971310269
out 2007971010881413321427109971310267
jul 2007981111889232923348109971311262
abr 20079791388142530133310109971311257
jan 2007991110882232811349109971311254
out 200697910881019291632910997139251
jul 2006107911987263217379109971410238
abr 200610810129910253019379991071511233
jan 2006109912993383218478991081412215
out 20051010101299103530264710991081511213
jul 200510101011899312426319991081411202
abr 2005111010129107282840271111111171911195
jan 20051110111291011272635221211111082013191
out 20041215131191011352836281111111082613189
jul 20041491210121662820271910151314222815159
abr 2004161114131620102815241413171418293615142
jan 20041818182420252525415926201821353222126
out 20031524342217192918211432161517331918101
jul 200314231821151620151515152414141630171488
abr 200313212014141516131313132313131422211371
jan 20031110131112121299991411111115151059
out 2002111111911129888811889179944
jul 2002109107109788881088865835
abr 200298106109877771177734720
jan 20028912587933331266622618
out 200156525542222433321413
jul 20016442544222254442138
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
 WikipedistasArtigosBase de dadosLigações

Nota: os valores para os primeiros meses estão muito baixos. O histórico de revisões nem sempre era preservado nos primeiros tempos.

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikipedistas (usuários registrados)
A = Wikipedistas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikipedistas que editaram pelo menos dez vezes desde que chegaram
C = Wikipedistas que contribuíram cinco vezes ou mais este mês
D = Wikipedistas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Artigos que contêm pelo menos uma ligação interna e 200 caracteres de texto legível, não contando códigos wiki e html,
      ligações ocultas, etc.; títulos também não contam (outras colunas são baseadas no método oficial de contagem)
G = Novos artigos por dia no mês passado
H = Número médio de revisões por artigo
I = Tamanho médio dos artigos em bytes
J = Porcentagem de artigos com pelo menos 0,5 kb de texto legível (veja F)
K = Porcentagem de artigos com pelo menos 2 kb de texto legível (veja F)

Base de dados
L = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
M = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
N = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

O = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
P = Total de ligações para outras wikipédias
Q = Total de imagens apresentadas
R = Total de ligações para outros sítios
S = Total de páginas de redirecionamento

Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  2500  10000  25000  5  10  100  1000  10000  100000  1  3  5  10  25  100  250  1000  2500  5  10  100  1000  10000  100000  1  3  5  10  25  100  250  1000  2500  10000  5  10  100  1000  10000 
jun 2018484321321466922526198891131 1212952 8473202191338135163 772   14716344473101755617   15145  
mai 201849522133146191352221586153  1111861 828355234155963818311092   135661745730517156182  141331 
abr 201849842195151194553221886133  111192  831327240155834418418732  140862543527016451172  161553 
mar 2018501421951482934522229991651 8863  871323222147844623337722  149360244827916162242  13134  
fev 201846272078140490048319477111  101072  730286187133784016218641  122554338126015354223  14144  
jan 2018503223041608100354522295154  7652  7713242151328039172 6521  1382583412289173602221 13123  
dez 201747042164152792049221899116  101072  805328218144893715417631  127055539127816958221  14143  
nov 20174788212214539205042181061571 101072  8743492361519142244 7731  148269254037519355234  12124  
out 2017457020451421903510218103154117764  942338240154873617526642  16166794752871716924731121251 
set 20174551208414639585162099114211776   821334220136763315429851  1454576405274159552341 13123  
ago 20174487199113818714932039792117762  81530521113683361442774   1467596439298169632111 12123  
jul 201747102134148793652920811217111111063  7893222311558739234 6531  1395594431299191742621 15134  
jun 20174623203414049045062009381  11104   8493662541699237214 8731  145272456140220866231  15113  
mai 20174959216714979365092019891  985   817329237153964521416631  147963246832017155162  15143  
abr 2017470821971557101555521293153  7642  833369256162954827316631  145159944230416961222  14133  
mar 201751272197153096954320894163  995   1012373255167101432031774   181269446231116662183  15142  
fev 201746272074143994550019983121  111073  10413742501661034619315531  17536224422911545421   151421 
jan 2017535824791681104358321596163  996   106542029518810745213 6531  185269750232219469262  15153  
dez 201647152174152494351220186101  7762  98640327217397441731653   163167848833018673222  14143  
nov 201649602189148891149720697173  10981  10503862641719741174 7532  181575657142124465152  15142  
out 201649032157149492549819082162  876   982339221138933419715532  162863844027714950141  13132  
set 201650702100144086346517992162  7662  10493612281368437186 6631  13305644012751505916   14122  
ago 201649582039136184147520383193  8862  9473392291449543176 7731  1316551411268150501431 131341 
jul 201652112246153091050120493152  8764  9873562251499037175 663   1671596412279172611432 14144  
jun 201650902230146488246718686132  88651 10573722391488736146 6632  169062945932018048153  12122  
mai 201652162230146088847119191194  9863  965387255154984118416631  166956839525514750174  13122  
abr 201650802035134781144418488162  8863  94334724715910147164 7741  158453937524513948143  14144  
mar 201650672141141684045917278136  9873  100739026816310546255 663   159554638025315352142  13122  
fev 201645991968136881243318694165118753  86535325015097461931663   154352137526116253153  1192  
jan 201651212199150694350220694185  9964  10323952581539749204 663   1373580438316184591832 1081  
abr 201849842195151194553221886133  111192  831327240155834418418732  140862543527016451172  161553 
jan 2018503223041608100354522295154  7652  7713242151328039172 6521  1382583412289173602221 13123  
out 2017457020451421903510218103154117764  942338240154873617526642  16166794752871716924731121251 
jul 201747102134148793652920811217111111063  7893222311558739234 6531  1395594431299191742621 15134  
abr 2017470821971557101555521293153  7642  833369256162954827316631  145159944230416961222  14133  
jan 2017535824791681104358321596163  996   106542029518810745213 6531  185269750232219469262  15153  
out 201649032157149492549819082162  876   982339221138933419715532  162863844027714950141  13132  
jul 201652112246153091050120493152  8764  9873562251499037175 663   1671596412279172611432 14144  
abr 201650802035134781144418488162  8863  94334724715910147164 7741  158453937524513948143  14144  
jan 201651212199150694350220694185  9964  10323952581539749204 663   1373580438316184591832 1081  
out 201548362114141185044916975142  9963  10583762571548542175 553   139854837224213639151  872  
jul 201553462298155697848318688162  9862  11063662491469743203 7731  134748734022114746181  973  
abr 2015518022161471900462201103142  9972  94237126116410245236 77442 127450735725313954163  111041 
jan 201552262412164498251720096131  121294  8923622461609638133 6631  125153139527415662203  12102  
out 201449402108136482142516278161  121296  8383192091277035144 8843  12925033322251154213   882  
jul 20145027224515069134621546881  10953  8173322281167135193 1110643 132851133520798375   991  
abr 201446242010133082843116780164  98631 891345226147843016317631  13125103552171082982  981  
jan 201446382170148793949618784152  111183  8813772651639037163 10941  134558740027215254143  1192  
out 201341791933131480741914970102  5541  80330521713475309316641  116348535421712240141  971  
jul 201342162121151894649720592162  121192  92441828318311343194110951  135160144430618056161  131341 
abr 201345762299160196051120085163  16151273 932396282179944720429842  147362947029517260192  1714641
jan 20134778241617461081606214971451 464336133 95944130819110639134 7741  145069051633219565213  3531168 
out 201243072098146290451918178101  504432114 88438326616210238122 76421 12645433732551345111   3330174 
jul 2012467023561688107861722391141  575235153 107449734422012440153 6632111341634465315169632111 3534165 
abr 201246172256156999356319881133  585335103 102743331121110941142198521 120753538326714957262  3832154 
jan 2012484124091699105861625493122  605739164 115252937122012437171 10862  141068652134317257231  3230135 
out 2011447621731527974559211103122  525038112 102745131921310335112 4321  12245443982651505219   3531166 
jul 20114804238516891067594242102101  544637174 10594683342091144013  54221 125661043829516555191  3430123 
abr 2011462922241587997545214931011 585539176 10014513181969946233 7542  138561543728015051182  3836125 
jan 20115276268419121181646262115171  645840184 116651735722913148233 55321 148565547032620379242  3531176 
out 201045782258158398852920096131  615733141 9173842561811124012  4422  133854738126215564211  4035163 
jul 20104834239317181109597226102153  615941152 9344303021901064513  3321  140659544029016253141  3330173 
abr 20105445267118251127610236115182  646041183 110546833321513154201 7743  150661244330919063251  3229154 
jan 20105394269818631150647238110123  635843202 118448733520712046162 7764  155965745629118062193  3531152 
out 2009517224851718105355618695205  575640203 106843631318310344171 2221  15276344242761465814   2623152 
jul 20095222258018451158586228114134  55503718  11255053402141235121  4321  160464445329517672231  2624132 
abr 2009490723421634102452420696144  55533618  111746630319612450202 3311  161463244728115967241  2724142 
jan 20094891252217851086590236108181  494734181 121753137623413756241 4333  172976552233720183411  2725142 
out 2008485323071582940465191101193  59574417  108247731021212254193 109521 1455614438279175783121 3227163 
jul 20084897253318331150606234105154  55544217  122454538525115156233 74441 157667751134721992301  28231131
abr 20084749247317081050529216102152  40382915  125155035822412749193 55411 154367748832618567273  17131031
jan 20084604244917671076568219111174  393729131 124858941127214661277122221 163974952835521178314  211841 
out 2007461723621684102453021790196  413625113 12605853742311345428426532  1588725518332194743031 20179  
jul 200737752064149793151918585112  33322582 99746934621111539173 22221 125860546130316970241  121173 
abr 200741842127150892346716579121  32312192 121253334819310648243133211 136860541026114659242  1715122 
jan 200731221747129185248818980133  28262172 98947533521112441232 22211 124959444330515771252  141121 
out 20063203175712397844231567691  25241261 9103962721678941238 111   124751736023413447191  7622 
jul 200625371497110873541314965112  19161262 7883852851819339193143211 10975133692511465119   864  
abr 200620561163855551302123666   1010962 6012861921327730164 111   90441828719011737151  4431 
jan 2006158892068245826199541021 14131072 5182611871187030153 1     7343562381579137171  773  
out 2005931538397246146672981  1110831 354157104654122132       4231921377943157   442  
jul 2005773465355253134653361  121284  2901611188041146  11    3591791399255208   651  
abr 200553132825617396522771  7532  1961088153301051       235129955936144   321  
jan 20053372071511046736172   431   14786634626141        15182604735134   322  
out 200419813799694627182   1     874935281741        9152433119102        
jul 200413291776742211341  1     61382823142         783931191141        
abr 2004795142331886    21    261614952         362115821         
jan 20042215116311    11    611            8433           
out 200362111                          2              
jul 2003175421           1              1              
abr 20037321                           21             
jan 200373333           2              3              
out 20026211                           1              
jul 200231                            1              
abr 2002                                             
jan 200222                                           
out 200163222                          211            
jul 20011                                            


Distribuição de edições de artigos por wikipedistas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...

Edições >=WikipedistasEdições total


50 wikipedistas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias

 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
30 dias
30 dias
30 dias
30 dias
YanguasUC1 0285,2751,613196,8321,052mai 31, 2006441215,39493--
Nice poaUC2 0199,5032671,3474abr 04, 200644696,3641--
LuizdlUC3 0191,099716,4194abr 21, 2007408714,697---
Renato de carvalho ferreiraUC4 0172,6463,49626,544423abr 08, 201030044,651360--
Kaktus KidUC7 0139,61648322,389158mai 31, 200740477,77172--
Jbribeiro1UC8 0125,9903747,77377jun 13, 201029381,8382--
Eric DuffUC9 0118,91352849,729233nov 14, 200642457,27525--
LeoslsUC11 0116,6899026,448192ago 26, 201028644,00611--
Umberto BotturaUC12+2112,2452,48710,996406jun 08, 20112578913--
RafaAzevedoUC13-1110,836440,891-nov 06, 20073888457---
VanthornUC15 0106,77744729,08173set 04, 200835855351--
DantaddUC16 0102,40516023,26811dez 04, 200545901,91213--
HVLUC17 086,08526131,026169out 17, 200931774381--
ChronusUC18 083,07680843,685683ago 05, 2007398184833--
Marcos Elias de Oliveira JúniorUC19+181,74563027,927145out 08, 2009318666---
LijealsoUC21 080,700649,069-jul 17, 2005473012,141---
GRS73UC22 080,46434984,676331mai 22, 200644213153--
HyjuUC23 079,04548218,747112fev 23, 2009341345533--
ColtsfanUC25 076,29289610,89278dez 19, 200834794668--
SturmUC26+173,1182,83014,54267fev 12, 2005488511,9161,058--
DarwInUC27-172,37823992,826113fev 07, 2009342958020--
ZdtrlikUC28 067,6421,06639,278184abr 21, 200740875,168115--
StegopUC29 065,90655142,758256out 29, 200931651,10211--
Tuga1143UC30+3265,53325,11318,16384mar 20, 200933883,6261,275--
JotaCartasUC31-165,4492237,27122abr 21, 200740874301--
ZoldyickUC32-164,3098345,69560set 30, 20112464312---
AngrenseUC34-161,3485502,37724mar 29, 200548403,44922--
StuckkeyUC35-160,47366768,7751,319set 23, 20102836442--
Hermógenes Teixeira Pinto FilhoUC36-159,76523350,375127abr 27, 200740812,93225--
O revolucionário aliadoUC37 058,2741,24456,7621,264mai 04, 2013188237---
TittlesUC38-258,19739910,36014ago 18, 201317769,95877--
DbastroUC39-158,0031,74647,923466dez 21, 200931124,136453--
Carlos Luis M C da CruzUC40 056,2668147,35447mai 09, 200547992,487222--
Jonas kamUC41-255,95345413,48853jul 12, 200643702,6458--
MschlindweinUC42-153,8523638,1395mai 22, 200451512,9452--
João CarvalhoUC43-153,34413168,84393mar 27, 200548424,57813--
CléééstonUC44-152,5352918,43582mar 30, 2007410970610--
LuanUC47+149,15253141,178469abr 16, 200644572,41820--
JoãofcfUC49-248,7391617,0317mar 21, 200741181,539---
Joao4669UC52-146,4214216,877-jul 19, 200932671,0921--
Nuno TavaresUC53-145,956126,216-dez 26, 200449337,234---
GeanUC54-145,3361810,4732jan 23, 20093444677---
Felipe PUC55 043,82117441,908151mai 27, 200644163,89446--
ChristianHUC56-243,656129,179-mai 11, 20083701765---
JMagalhãesUC57-143,45654735,031635abr 16, 2011263128218--
JoseolgonUC58 042,9491953,0389nov 14, 200546102,40832--
CerestaUC59-242,848222,571-dez 12, 2007385214,512---
FSogumoUC62-141,51229039,600292abr 13, 200644601,165---
Braz LemeUC63 040,252855,7767nov 13, 20064246254---
ÉricoUC64 040,0585252,86674abr 06, 201030063361--


20 wikipedistas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

  Primeira ediçãoúltima edição
Fabiano TatschUC5151,488set 03, 20073952fev 02, 2018147
LeonardoRob0tUC6141,250out 02, 20045018jul 23, 20083628
Vitor MazucoUC10116,961mai 24, 20074054mai 09, 201851
OS2WarpUC14110,282mai 13, 20054795ago 31, 2016667
BisbisUC2081,589set 04, 20064316jun 26, 2017368
VítorUC2478,549fev 17, 20141593mar 16, 2016835
NH~ptwikiUC3363,050ago 04, 20045077fev 23, 2018126
BiantezUC4552,186abr 02, 20083740out 31, 2015972
ReynaldoUC4651,029mar 22, 20064482out 22, 20102807
LeslieUC4848,791fev 10, 20054887jul 02, 2017362
Leonardo.stabileUC5048,367dez 18, 20054576jul 11, 20102910
Rei-arturUC5147,171jan 23, 20054905jun 05, 2017389
BurmeisterUC6042,315out 07, 20073918nov 08, 2016598
EamaralUC6142,301ago 07, 20083613mai 31, 201829
Rui SilvaUC6638,668mai 26, 20045147ago 10, 2016688
ViniciusmcUC6936,791nov 23, 20093140nov 12, 20131690
Luckas BladeUC7036,152dez 12, 20064217ago 10, 20151054
GunnexUC7734,490jan 09, 20074189set 27, 2017275
Marcelo VictorUC8034,079abr 18, 20064455abr 18, 201872
Manuel AnastácioUC8133,922mar 21, 20045213mar 24, 201897


Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 9.612.727 edições foram feitas por usuários anônimos, de um total de 35.631.390 edições ( 26e %)

50 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
EmausBotUC1797,082abr 24, 20102988jun 30, 2018-2,2802
Rei-botUC2599,428mai 21, 20064422set 04, 2010285540,897-
Luckas-botUC3452,722jan 28, 20083805ago 08, 20173252,432-
XqbotUC4351,880jan 15, 20093452jun 23, 20186234-
KLBot2UC5290,497jun 06, 20122214jul 08, 20131817415-
SieBotUC6282,991jan 17, 20074181jan 25, 20112712683-
SalebotUC7280,036set 22, 20083567jun 30, 2018-121
MerlIwBotUC8255,435fev 10, 20112696ago 09, 2013178524-
TXiKiBoTUC9244,391jan 04, 20074194jan 09, 201319973,341-
Thijs!botUC10238,408mai 13, 20064430out 17, 201220817,561-
FMTbotUC11231,178abr 21, 20074087nov 13, 201413247,792-
ZéroBotUC12224,129mar 19, 20103024mar 07, 20131940215-
VolkovBotUC13204,569jan 12, 20074186mar 07, 201319401,972-
RobotQuistnixUC14185,081jan 19, 20054909ago 23, 20173105,645-
EscarbotUC15183,672jun 04, 20064408mai 29, 20183116,562-
LijeBotUC16181,386jan 03, 20064560ago 14, 201668425,617-
ArthurBotUC17175,934out 01, 20083558nov 05, 2012206223-
Alch BotUC18159,457out 17, 20093177jun 29, 2018-2,065103
NTBotUC19138,887dez 29, 20044930mai 11, 200644325,128-
CommonsDelinkerUC20128,869set 24, 20064296jun 30, 2018-3,99487
LeoBotUC21126,459set 14, 20073941mai 23, 2010295987-
AddbotUC22109,496mai 15, 20122236ago 22, 201317721-
YurikBotUC23102,418jul 31, 20054716set 04, 200643165,639-
LuanbotUC2490,662jun 09, 20102942fev 23, 2015122216-
LegobotUC2588,776mar 10, 20131937abr 08, 20131908--
WikitanvirBotUC2686,099jul 18, 20102903mai 16, 201222353-
LaaknorBotUC2785,702jun 23, 20083658mar 07, 20131940418-
Danilo.botUC2882,319nov 25, 20093138jun 30, 2018-2,160-
RedBotUC2980,673fev 10, 20093426ago 25, 20122134101-
YFdyh-botUC3075,473out 17, 20112447nov 25, 20131677--
JAnDbotUC3175,164ago 03, 20064348jul 03, 20131822489-
DarwinBotUC3274,079fev 26, 20103045mar 16, 201126621-
WaldirBotUC3373,904jan 29, 20074169jun 29, 201414617,971-
AlexbotUC3469,438jan 12, 20083821out 08, 20122090287-
FlaBotUC3568,502out 10, 20054645dez 14, 201027544,216-
Numbo3-botUC3661,970mai 16, 20083696nov 28, 200931355-
Lucia BotUC3759,823set 21, 20083568abr 08, 201126398-
Aleth BotUC3859,297mai 18, 20112599jun 30, 2018-6323
ChuispastonBotUC3958,648set 16, 20102843abr 28, 201222535-
RibotBOTUC4053,343fev 28, 20093408jan 26, 201319807-
RodrigolopesbotUC4152,074jan 31, 20141610nov 10, 2015962--
MystBotUC4251,036jul 14, 20083637mar 08, 20122304326-
AlleborgoBotUC4350,097mai 10, 20074068ago 09, 2010288118-
RjbotUC4449,938ago 18, 20093237set 07, 2012212146-
LucienBOTUC4547,975fev 25, 20093411fev 23, 20131952210-
Makecat-botUC4644,443mai 10, 20122241mar 06, 20131941--
PtbotgourouUC4742,255ago 03, 20083617mar 06, 2013194152-
KamikazeBotUC4836,608jun 15, 20102936jan 27, 201319791,025-
Idioma-botUC4932,695dez 03, 20064226mar 07, 20131940370-
TobeBotUC5031,951ago 10, 20093245set 14, 2010284535-


Artigos que contêm pelo menos uma ligação interna e .. caracteres de texto legível, não contando códigos wiki e html,
ligações ocultas, etc.; títulos também não contam  (excluindo páginas de redirecionamento)

 < 32 ch< 64 ch< 128 ch< 256 ch< 512 ch< 1 k ch< 2 k ch< 4 k ch< 8 k ch< 16 k ch< 32 k ch< 64 k ch
mar 20120.0%0.1%1.5%5.9%15.8%46.2%73.1%87.9%95.2%98.4%99.6%100.0%
fev 20120.0%0.1%1.6%6.0%15.9%46.4%73.3%88.0%95.3%98.5%99.7%100.0%
jan 20120.0%0.1%1.6%6.1%16.1%46.7%73.5%88.1%95.3%98.5%99.6%100.0%
dez 20110.0%0.1%1.7%6.2%16.3%47.0%73.7%88.2%95.3%98.4%99.5%99.9%
nov 20110.0%0.1%1.7%6.3%16.5%47.3%74.0%88.4%95.5%98.6%99.7%100.0%
out 20110.0%0.1%1.6%6.2%16.4%47.4%74.1%88.4%95.4%98.5%99.6%100.0%
set 20110.0%0.1%1.6%6.2%16.5%47.6%74.3%88.5%95.5%98.5%99.6%99.9%
ago 20110.0%0.1%1.6%6.2%16.5%47.7%74.4%88.5%95.4%98.4%99.5%99.8%
jul 20110.0%0.1%1.6%6.3%16.7%48.0%74.7%88.7%95.6%98.6%99.7%100.0%
jun 20110.0%0.1%1.7%6.4%16.9%48.3%75.0%88.9%95.7%98.6%99.6%99.9%
mai 20110.0%0.1%1.7%6.4%16.9%48.4%75.1%88.9%95.6%98.5%99.5%99.8%
abr 20110.0%0.1%1.7%6.5%17.1%48.8%75.4%89.1%95.8%98.7%99.7%100.0%
mar 20110.0%0.1%1.7%6.5%17.1%48.9%75.5%89.1%95.7%98.5%99.5%99.8%
fev 20110.0%0.1%1.8%6.6%17.3%49.3%75.9%89.4%95.9%98.7%99.7%100.0%
jan 20110.0%0.1%1.8%6.6%17.3%49.4%75.9%89.3%95.8%98.6%99.6%99.9%
dez 20100.0%0.1%1.8%6.7%17.4%49.7%76.1%89.4%95.8%98.6%99.6%99.9%
nov 20100.0%0.1%1.9%7.0%18.1%48.6%75.6%89.2%95.8%98.6%99.6%99.9%
out 20100.0%0.1%1.9%7.1%18.3%49.2%75.8%89.0%95.6%98.4%99.4%99.7%
set 20100.0%0.1%2.0%7.3%18.6%49.6%76.2%89.3%95.9%98.7%99.7%100.0%
ago 20100.0%0.1%2.0%7.3%18.6%49.8%76.3%89.3%95.8%98.6%99.6%99.9%
jul 20100.0%0.1%2.0%7.4%18.9%50.3%76.3%89.3%95.8%98.6%99.6%99.9%
jun 20100.0%0.1%2.0%7.4%18.9%50.5%76.5%89.4%95.9%98.7%99.7%100.0%
mai 20100.0%0.1%2.0%7.4%19.0%50.8%76.8%89.6%96.0%98.7%99.7%100.0%
abr 20100.0%0.1%2.1%7.7%19.6%50.1%76.6%89.5%96.0%98.8%99.8%100.0%
mar 20100.0%0.1%2.1%7.8%19.9%50.3%76.8%89.6%96.0%98.7%99.7%100.0%
fev 20100.0%0.1%2.2%7.9%20.0%50.3%76.9%89.6%96.0%98.7%99.7%100.0%
jan 20100.0%0.1%2.2%7.9%20.1%50.6%77.1%89.7%96.0%98.6%99.5%99.8%
dez 20090.0%0.1%2.3%8.1%20.4%51.0%77.5%90.0%96.2%98.8%99.7%100.0%
nov 20090.0%0.1%2.4%8.3%20.7%51.4%77.7%90.1%96.3%98.9%99.8%100.0%
out 20090.0%0.1%2.4%8.3%20.8%51.6%77.6%90.0%96.2%98.8%99.7%100.0%
set 20090.0%0.1%2.5%8.4%21.0%51.9%77.8%90.1%96.2%98.7%99.6%99.9%
ago 20090.0%0.1%2.5%8.4%21.1%52.2%78.0%90.2%96.2%98.7%99.6%99.9%
jul 20090.0%0.1%2.4%8.3%21.0%52.4%78.3%90.4%96.4%98.9%99.8%100.0%
jun 20090.0%0.1%2.4%8.4%21.2%52.7%78.5%90.4%96.3%98.8%99.7%99.9%
mai 20090.0%0.1%2.4%8.4%21.2%52.8%78.6%90.5%96.3%98.7%99.5%99.7%
abr 20090.0%0.1%2.4%8.5%21.4%53.2%79.0%90.8%96.6%99.0%99.8%100.0%
mar 20090.0%0.1%2.4%8.4%21.4%53.3%79.1%90.8%96.5%98.9%99.7%99.9%
fev 20090.0%0.1%2.4%8.5%21.5%53.4%79.2%90.8%96.5%98.8%99.6%99.8%
jan 20090.0%0.1%2.4%8.6%21.7%53.8%79.5%91.0%96.6%98.9%99.7%99.9%
dez 20080.0%0.1%2.5%8.7%21.9%54.2%79.8%91.1%96.7%99.0%99.8%100.0%
nov 20080.0%0.1%2.5%8.7%22.0%54.4%80.0%91.2%96.7%98.9%99.7%99.9%
out 20080.0%0.1%2.4%8.7%22.1%54.6%80.3%91.3%96.7%98.9%99.6%99.8%
set 20080.0%0.1%2.3%8.6%22.0%54.8%80.9%91.6%96.9%99.1%99.8%100.0%
ago 20080.0%0.1%2.3%8.6%22.1%55.0%81.1%91.7%96.9%99.0%99.7%99.9%
jul 20080.0%0.1%2.3%8.5%22.1%55.2%81.4%91.9%97.0%99.1%99.8%100.0%
jun 20080.0%0.1%2.2%8.4%22.2%55.7%81.8%92.1%97.2%99.3%100.0%100.0%
mai 20080.0%0.1%2.4%8.9%23.2%54.1%80.8%91.5%96.8%98.9%99.6%99.8%
abr 20080.0%0.1%2.5%9.1%23.5%54.5%81.2%91.7%96.9%99.0%99.7%99.9%
mar 20080.0%0.1%2.5%9.2%24.0%54.8%81.5%91.9%97.0%99.1%99.8%100.0%
fev 20080.0%0.1%2.6%9.3%24.4%55.1%81.7%92.0%97.0%99.1%99.8%100.0%
jan 20080.0%0.1%2.8%9.6%24.7%55.5%82.1%92.2%97.1%99.1%99.8%100.0%
dez 20070.0%0.1%2.9%9.7%24.9%55.7%82.3%92.2%97.1%99.1%99.8%100.0%
nov 20070.0%0.1%2.9%9.7%25.0%55.9%82.6%92.4%97.2%99.1%99.7%99.9%
out 20070.0%0.1%2.9%9.7%25.2%56.2%82.9%92.6%97.3%99.2%99.8%100.0%
set 20070.0%0.1%3.1%10.7%28.0%58.6%81.3%91.5%96.8%98.9%99.6%99.8%
ago 20070.0%0.1%3.2%10.8%28.3%59.0%81.6%91.7%96.9%99.0%99.7%99.9%
jul 20070.0%0.1%3.2%10.9%28.6%59.6%82.1%92.0%97.1%99.2%99.9%100.0%
jun 20070.0%0.1%3.3%11.0%28.9%60.0%82.4%92.1%97.1%99.1%99.7%99.9%
mai 20070.0%0.1%3.2%10.7%28.8%60.2%82.6%92.1%97.0%99.0%99.6%99.8%
abr 20070.0%0.2%3.4%10.8%24.6%60.0%82.8%92.4%97.2%99.2%99.8%100.0%
mar 20070.0%0.2%3.5%10.7%24.6%60.3%83.1%92.5%97.2%99.1%99.7%99.9%
fev 20070.0%0.2%3.6%10.8%24.8%60.8%83.5%92.7%97.3%99.2%99.8%100.0%
jan 20070.1%0.3%3.8%11.0%25.0%61.3%83.9%92.9%97.4%99.2%99.8%100.0%
dez 20060.1%0.3%4.1%11.8%26.8%65.2%83.2%92.6%97.3%99.2%99.8%100.0%
nov 20060.1%0.3%4.3%12.2%27.6%66.3%83.2%92.6%97.3%99.2%99.8%100.0%
out 20060.1%0.3%4.2%12.1%28.0%67.6%83.6%92.9%97.5%99.3%99.9%100.0%
set 20060.1%0.3%4.4%12.3%28.4%68.6%84.4%93.2%97.6%99.4%100.0%100.0%
ago 20060.1%0.4%3.3%11.4%28.1%69.5%84.8%93.4%97.7%99.4%99.9%100.0%
jul 20060.1%0.4%3.5%11.9%29.4%71.2%85.2%93.5%97.6%99.3%99.8%99.9%
jun 20060.1%0.4%3.6%12.1%30.2%72.2%86.0%93.8%97.8%99.4%99.9%100.0%
mai 20060.1%0.4%3.6%12.2%31.1%72.3%86.1%93.9%97.8%99.4%99.9%100.0%
abr 20060.1%0.4%3.6%12.4%32.4%73.3%86.4%94.1%98.0%99.5%100.0%100.0%
mar 20060.1%0.4%3.7%13.3%33.0%74.1%86.9%94.3%98.0%99.5%100.0%100.0%
fev 20060.1%0.4%4.2%13.6%33.5%75.3%87.6%94.6%98.1%99.5%100.0%100.0%
jan 20060.1%0.4%4.3%13.9%33.8%76.5%88.2%94.8%98.2%99.5%99.9%100.0%
dez 20050.1%0.4%5.3%16.1%39.3%75.0%87.3%94.4%98.0%99.4%99.9%100.0%
nov 20050.1%0.4%5.7%16.4%41.0%75.6%87.4%94.3%97.9%99.2%99.7%99.8%
out 20050.1%0.5%6.0%16.8%42.3%76.7%88.1%94.7%98.1%99.4%99.8%99.9%
set 20050.2%0.6%6.3%17.3%43.2%77.7%88.8%95.2%98.4%99.6%100.0%100.0%
ago 20050.2%0.6%6.6%18.1%43.7%78.0%89.1%95.2%98.4%99.6%100.0%100.0%
jul 20050.2%0.6%7.3%20.1%47.7%75.7%87.8%94.6%98.1%99.4%99.9%100.0%
jun 20050.3%0.8%7.8%20.3%48.6%77.0%88.7%95.0%98.3%99.5%99.9%100.0%
mai 20050.4%0.8%7.6%26.8%48.8%77.9%88.9%95.1%98.3%99.5%99.9%100.0%
abr 20050.5%1.0%8.2%31.2%59.6%75.0%87.4%94.5%98.2%99.6%100.0%100.0%
mar 20050.7%1.2%8.8%32.7%60.6%75.4%87.3%94.4%98.0%99.3%99.7%99.8%
fev 20050.4%0.9%8.6%33.5%62.5%76.8%88.1%94.8%98.2%99.5%99.9%100.0%
jan 20050.5%1.1%9.3%35.3%64.6%78.2%88.7%94.8%98.1%99.4%99.8%99.9%
dez 20040.6%1.2%9.9%37.3%67.4%80.0%89.6%95.2%98.3%99.5%99.9%100.0%
nov 20040.5%1.1%10.2%39.0%69.9%81.7%90.6%95.7%98.5%99.5%99.9%100.0%
out 20040.5%1.1%10.4%40.4%72.6%83.9%91.5%96.1%98.5%99.5%99.9%100.0%
set 20040.5%1.0%10.7%42.4%75.0%85.9%92.3%96.4%98.7%99.6%100.0%100.0%
ago 20040.8%1.6%5.4%47.2%64.4%80.5%89.6%95.2%98.3%99.4%99.9%100.0%
jul 20041.0%1.9%5.8%51.8%66.9%81.9%90.8%95.7%98.5%99.6%100.0%100.0%
jun 20042.1%3.4%8.6%47.5%64.5%80.1%89.9%95.0%98.1%99.4%100.0%100.0%
mai 20042.3%3.7%8.8%49.3%66.5%80.6%90.8%95.4%98.2%99.3%99.9%100.0%
abr 20041.6%3.1%9.3%54.2%65.8%79.9%90.3%95.1%98.4%99.5%100.0%100.0%
mar 20041.0%2.7%9.7%56.4%68.0%80.1%90.8%95.7%98.6%99.6%100.0%100.0%
fev 20041.4%3.9%13.5%45.5%60.6%73.2%87.8%94.0%97.9%99.2%100.0%100.0%
jan 20041.7%4.8%18.8%37.9%56.9%70.4%81.7%90.3%96.7%98.9%99.9%99.9%
dez 20032.0%4.4%13.7%27.8%47.3%63.6%77.4%88.3%96.2%98.9%100.0%100.0%
nov 20031.8%4.3%13.9%27.8%46.6%63.2%77.1%87.8%95.8%98.9%99.9%99.9%
out 20031.8%4.3%13.9%27.8%46.6%63.2%77.1%87.8%95.8%98.9%99.9%99.9%
set 20031.9%4.5%14.3%28.5%47.7%64.3%77.5%87.9%95.9%99.0%100.0%100.0%
ago 20031.9%4.4%14.0%28.4%47.5%64.5%77.8%87.9%96.2%98.9%100.0%100.0%
jul 20032.6%5.5%16.8%33.6%50.9%65.0%75.7%86.0%95.4%98.6%100.0%100.0%
jun 20033.1%6.0%17.9%34.3%50.4%64.1%74.5%84.7%95.3%98.2%100.0%100.0%
mai 20033.5%7.0%18.7%35.0%51.9%66.9%77.5%86.3%95.7%98.0%99.9%99.9%
abr 20033.9%6.5%19.0%37.7%54.3%68.3%78.7%86.8%95.6%97.7%100.0%100.0%
mar 20034.3%7.0%19.7%38.9%56.2%69.4%79.4%86.2%94.8%97.5%99.9%99.9%
fev 20034.4%7.5%20.6%40.3%57.8%70.3%80.0%86.4%95.0%97.8%100.0%100.0%
jan 20036.5%9.7%23.3%41.7%59.5%70.8%78.9%85.7%94.1%97.3%99.9%99.9%
dez 20026.1%8.6%23.4%42.7%57.9%71.0%79.2%84.1%93.5%96.8%100.0%100.0%
nov 20026.8%9.5%25.9%45.1%59.7%71.6%78.4%83.0%92.6%96.3%100.0%100.0%
out 20027.8%10.7%27.7%45.2%59.8%71.0%78.3%83.2%92.9%96.8%100.0%100.0%
set 20028.5%11.7%29.8%48.4%60.6%70.7%77.1%83.0%92.6%96.9%100.0%100.0%
ago 20028.1%11.3%29.6%48.4%60.8%71.0%77.5%83.4%92.5%96.8%100.0%100.0%
jul 20027.3%9.5%28.6%47.1%60.0%70.7%76.9%82.5%92.1%96.6%100.0%100.0%
jun 20027.2%9.6%29.5%48.8%59.6%69.8%75.8%81.8%92.0%96.2%99.8%99.8%
mai 20025.6%8.4%26.7%45.7%57.0%66.2%71.8%78.8%90.8%95.7%99.9%99.9%
abr 20025.5%8.6%22.0%41.7%51.9%62.1%68.4%76.3%89.7%95.2%99.9%99.9%
mar 20025.6%8.8%22.3%41.3%51.6%61.9%68.2%76.1%89.6%95.2%100.0%100.0%
fev 20025.8%9.1%23.1%42.9%53.6%63.5%69.3%77.6%90.8%95.8%99.9%99.9%
jan 20025.2%8.7%23.5%44.4%54.8%65.2%70.4%79.1%91.3%96.5%100.0%100.0%
dez 20014.5%8.1%23.3%44.7%55.4%65.2%70.6%79.5%91.1%96.5%100.0%100.0%
nov 20014.7%7.5%23.4%44.0%55.2%64.5%69.2%78.5%90.6%96.2%99.9%99.9%
out 20014.5%6.8%25.0%47.7%59.1%68.2%72.7%81.8%92.0%96.5%99.9%99.9%
set 200113.6%18.1%31.7%49.9%59.0%72.6%72.6%90.8%99.9%99.9%99.9%99.9%
ago 200111.8%17.7%23.6%47.1%58.9%70.7%70.7%94.2%100.0%100.0%100.0%100.0%
jul 200133.3%50.0%50.0%50.0%50.0%50.0%50.0%100.0%100.0%100.0%100.0%100.0%
jun 200125.0%50.0%50.0%50.0%50.0%50.0%50.0%100.0%100.0%100.0%100.0%100.0%


Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.

See also Category Overview Complete (15 Mb!), Concise (239 kb)

categorizados 1
jun 20181,8 M124 k92 k49 k1,8 k77 k315315 k21 k 300    63936 k1,1 k24112 k159111
mai 20181,8 M123 k91 k49 k1,8 k76 k315314 k21 k 298    63735 k1,1 k24112 k158111
abr 20181,7 M122 k91 k49 k1,8 k76 k315312 k21 k 297    63635 k1,1 k24111 k155111
mar 20181,7 M122 k90 k48 k1,8 k75 k315310 k21 k 292    63535 k1,1 k24111 k154111
fev 20181,7 M121 k89 k48 k1,8 k74 k314308 k20 k 287    61635 k1,1 k24111 k153111
jan 20181,7 M120 k88 k47 k1,8 k74 k314305 k20 k 279    61334 k1,1 k24111 k152111
dez 20171,7 M119 k88 k46 k1,8 k73 k311300 k20 k 263    60934 k1,1 k24111 k149111
nov 20171,7 M118 k88 k46 k1,8 k72 k311297 k20 k 259    60533 k1,1 k24110 k148111
out 20171,7 M117 k87 k45 k1,8 k72 k310292 k20 k 256    60433 k1,1 k24110 k147111
set 20171,7 M116 k87 k44 k1,7 k71 k310284 k20 k 254    57832 k1,1 k2419,6 k145111
ago 20171,7 M115 k86 k43 k1,7 k69 k310278 k19 k 252    54832 k1,1 k2419,3 k14211 
jul 20171,6 M114 k86 k42 k1,7 k68 k310274 k19 k 251    54531 k1,0 k2419,2 k1401  
jun 20171,6 M114 k85 k42 k1,7 k68 k310270 k19 k 251    54531 k1,0 k2419,1 k1401  
mai 20171,6 M113 k85 k42 k1,7 k67 k310267 k19 k 251    54031 k1,0 k2419,0 k1381  
abr 20171,6 M112 k84 k41 k1,7 k67 k310264 k19 k 251    53931 k1,0 k2418,8 k1371  
mar 20171,6 M111 k84 k41 k1,7 k66 k309260 k19 k 249    53230 k1,0 k2418,6 k1371  
fev 20171,6 M109 k83 k40 k1,7 k66 k309255 k18 k 247    53130 k9922418,4 k1361  
jan 20171,6 M108 k83 k40 k1,7 k65 k308253 k18 k 245    52030 k9912418,2 k1321  
dez 20161,6 M107 k82 k39 k1,7 k64 k307250 k17 k 226    51329 k9902418,0 k1311  
nov 20161,6 M106 k82 k38 k1,7 k64 k306248 k16 k 224    49829 k9822417,7 k1291  
out 20161,6 M105 k81 k38 k1,7 k63 k305246 k15 k 224    49629 k9812417,5 k1291  
set 20161,6 M104 k81 k38 k1,7 k62 k304244 k15 k 222    49228 k9782417,4 k1281  
ago 20161,6 M103 k80 k37 k1,7 k62 k304243 k15 k 221    49028 k9742417,3 k1281  
jul 20161,5 M102 k80 k36 k1,7 k60 k304240 k14 k 220    48528 k9632417,1 k1261  
jun 20161,5 M101 k80 k36 k1,7 k59 k303237 k14 k 216    46627 k9582416,8 k1251  
mai 20161,5 M100 k79 k35 k1,7 k59 k303234 k14 k 214    42727 k9532416,5 k1251  
abr 20161,5 M99 k79 k35 k1,7 k59 k303229 k14 k 200    42427 k9512416,4 k1231  
mar 20161,5 M98 k78 k34 k1,6 k58 k302225 k14 k 185    42326 k9492416,4 k1211  
fev 20161,5 M97 k78 k34 k1,6 k58 k302222 k14 k 183    42126 k9392416,2 k1211  
jan 20161,5 M96 k77 k33 k1,6 k57 k301218 k14 k 181    41426 k9272416,0 k1211  
dez 20151,5 M95 k77 k33 k1,6 k56 k301212 k14 k 181    40626 k9202415,7 k1201  
nov 20151,5 M94 k77 k32 k1,6 k56 k301207 k13 k 180    40325 k9152415,6 k1201  
out 20151,5 M94 k76 k32 k1,6 k55 k301204 k13 k 176    39825 k9102415,4 k1191  
set 20151,4 M93 k76 k31 k1,6 k55 k301202 k13 k 174    39025 k9042415,2 k1191  
ago 20151,4 M92 k76 k31 k1,6 k55 k295199 k13 k 172    38524 k9022414,8 k1191  
jul 20151,4 M91 k75 k30 k1,6 k54 k295195 k13 k 156    37424 k8992414,3 k1191  
jun 20151,4 M90 k75 k29 k1,6 k54 k294191 k13 k 155    36124 k8892414,0 k1181  
mai 20151,4 M90 k75 k29 k1,6 k53 k294188 k13 k 155    35624 k8742413,9 k1171  
abr 20151,4 M89 k74 k29 k1,6 k53 k292184 k13 k 155    35424 k8702413,9 k1151  
mar 20151,4 M88 k73 k29 k1,6 k53 k291181 k13 k 155    35223 k8582413,8 k1141  
fev 20151,4 M87 k73 k28 k1,6 k52 k291179 k12 k 153    35123 k8472413,8 k1131  
jan 20151,4 M87 k73 k28 k1,6 k52 k291176 k12 k 153    34723 k8392413,7 k1131  
dez 20141,4 M86 k72 k27 k1,6 k51 k291172 k12 k 150    34722 k8192413,6 k1131  
nov 20141,4 M85 k71 k27 k1,6 k50 k291169 k12 k 148    33422 k8062413,6 k1131  
out 20141,3 M84 k70 k27 k1,6 k50 k291167 k12 k 147    32922 k8022413,5 k1131  
set 20141,3 M84 k70 k26 k1,6 k49 k291165 k12 k 144    32121 k7872413,4 k1131  
ago 20141,3 M83 k70 k26 k1,6 k49 k290163 k12 k 142    32021 k7482413,4 k1131  
jul 20141,3 M82 k69 k25 k1,6 k48 k288161 k12 k 138    31821 k7442413,3 k1101  
jun 20141,3 M81 k69 k25 k1,6 k48 k287160 k12 k 137    31821 k7322413,3 k1061  
mai 20141,3 M80 k69 k25 k1,6 k47 k287159 k12 k 134    31620 k7232413,3 k1031  
abr 20141,3 M79 k68 k25 k1,6 k47 k287157 k12 k 130    31520 k7192413,2 k1001  
mar 20141,3 M78 k68 k24 k1,6 k46 k286155 k12 k 129    31320 k7092413,2 k911  
fev 20141,3 M78 k68 k24 k1,6 k46 k286152 k12 k 129   9755231120 k7052413,1 k901  
jan 20141,3 M77 k67 k24 k1,6 k45 k285150 k12 k 128   10607930619 k6812413,0 k891  
dez 20131,3 M76 k67 k23 k1,6 k45 k284147 k11 k 128   10035730319 k6712412,9 k871  
nov 20131,2 M76 k66 k23 k1,6 k44 k283145 k11 k 127   8291929819 k6702412,9 k861  
out 20131,2 M75 k66 k22 k1,6 k44 k276144 k11 k 126   8454329819 k6602412,8 k801  
set 20131,2 M75 k65 k22 k1,5 k43 k275142 k11 k 122   8916129418 k6552412,7 k801  
ago 20131,2 M74 k65 k22 k1,5 k43 k263140 k11 k 122   9415529218 k6452412,7 k801  
jul 20131,2 M74 k64 k22 k1,5 k42 k253139 k11 k 121   10896529118 k6292412,7 k781  
jun 20131,2 M73 k63 k21 k1,4 k42 k243138 k10 k 118   11472028917 k6122412,6 k741  
mai 20131,2 M73 k63 k20 k1,4 k42 k236136 k10 k 115   12509027617 k5882412,6 k73   
abr 20131,2 M72 k62 k20 k1,4 k41 k232135 k10 k 108   11114726416 k5762412,5 k70   
mar 20131,2 M71 k61 k19 k1,4 k40 k232134 k9,8 k 105   11148525615 k5402312,4 k65   
fev 20131,2 M70 k60 k18 k1,4 k40 k231132 k9,7 k 103   10571523914 k5092312,3 k64   
jan 20131,2 M69 k59 k17 k1,4 k40 k230131 k9,6 k 101   13416323014 k465912,1 k62   
dez 20121,2 M68 k59 k16 k1,4 k39 k230127 k9,3 k 100   11204319513 k205412,0 k49   
nov 20121,2 M68 k58 k15 k1,4 k38 k230125 k9,1 k 96   9289618212 k198411,9 k49   
out 20121,1 M67 k58 k14 k1,4 k38 k228124 k8,9 k 94   9381818112 k195411,9 k49   
set 20121,1 M67 k57 k14 k1,3 k38 k228122 k8,8 k 93   9900917812 k195411,8 k49   
ago 20121,1 M66 k57 k13 k1,3 k37 k227121 k8,7 k 90   11512817411 k192411,8 k49   
jul 20121,1 M66 k56 k13 k1,3 k36 k226119 k8,5 k 87   12048917111 k181411,8 k46   
jun 20121,1 M65 k55 k13 k1,3 k36 k224115 k8,2 k 85   10767616410 k176411,7 k45   
mai 20121,1 M64 k55 k12 k1,3 k35 k223114 k8,1 k 83   11748415810 k171411,6 k44   
abr 20121,1 M64 k54 k12 k1,3 k35 k222112 k8,0 k 82   1058711489,8 k161311,6 k41   
mar 20121,1 M63 k53 k11 k1,3 k34 k222110 k7,8 k 81   1028981429,6 k149311,5 k41   
fev 20121,1 M63 k52 k11 k1,3 k34 k222108 k7,7 k 80   1122901379,3 k138311,5 k38   
jan 20121,1 M62 k52 k11 k1,3 k33 k220106 k7,7 k 78   1178541339,0 k137311,4 k38   
dez 20111,1 M62 k51 k10 k1,3 k33 k218104 k7,5 k 76   1142861158,7 k128311,3 k34   
nov 20111,1 M61 k51 k9,8 k1,3 k32 k217102 k7,4 k 75   1036631068,3 k124311,2 k33   
out 20111,1 M61 k50 k9,4 k1,2 k32 k216100 k7,3 k 70   1062061028,0 k121311,2 k33   
set 20111,0 M60 k49 k9,0 k1,2 k31 k21599 k7,1 k 67   1097941027,6 k116311,1 k33   
ago 20111,0 M60 k49 k8,7 k1,2 k31 k21397 k7,0 k 67   125151957,3 k111311,1 k32   
jul 20111,0 M60 k48 k8,3 k1,2 k31 k21396 k7,0 k 66   114142917,0 k110311,1 k31   
jun 20111,0 M59 k48 k7,7 k1,1 k30 k21294 k6,8 k 65   94610836,5 k103311,0 k30   
mai 20111,0 M59 k47 k7,3 k1,1 k30 k21193 k6,7 k 62   105030816,1 k88211,0 k30   
abr 20111,0 M59 k47 k6,9 k1,1 k29 k20992 k6,6 k 59   113121775,7 k732197629   
mar 20111,0 M58 k46 k6,3 k1,1 k29 k20990 k6,4 k 58   126386705,2 k612194328   
fev 20111,0 M58 k46 k5,9 k1,1 k29 k20788 k6,1 k 56   120613674,8 k552190528   
jan 2011994 k58 k45 k5,4 k1,1 k28 k20586 k6,0 k 56   138461564,5 k502 83828   
dez 2010982 k57 k45 k4,5 k1,1 k27 k19683 k5,8 k 54   125236383,7 k36  71427   
nov 2010970 k57 k44 k3,6 k1,1 k27 k19680 k5,6 k 51   110063282,9 k29  64126   
out 2010959 k56 k44 k3,1 k1,1 k27 k19678 k5,4 k 45   105786222,5 k28  56925   
set 2010951 k56 k43 k2,4 k1,1 k26 k19676 k5,1 k 40   113931221,9 k15  42220   
ago 2010943 k56 k43 k 1,1 k26 k19274 k5,0 k 15   111956          
jul 2010930 k55 k42 k 1,1 k24 k19072 k4,8 k 15   124597          
jun 2010921 k55 k41 k 1,1 k24 k18770 k4,7 k 15   122720          
mai 2010911 k55 k41 k 1,0 k23 k18668 k4,6 k 5   140219          
abr 2010895 k54 k41 k 1,0 k23 k18267 k4,5 k 5   135931          
mar 2010884 k54 k40 k 91422 k17865 k4,3 k 5   137619          
fev 2010873 k53 k40 k 90821 k17561 k4,0 k 4   134060          
jan 2010862 k52 k39 k 89720 k17158 k3,9 k 4   128075          
dez 2009853 k52 k39 k 85720 k17055 k3,8 k 4   125405          
nov 2009841 k51 k38 k 85220 k16853 k3,6 k 4   108755          
out 2009828 k51 k38 k 84619 k16751 k3,3 k 1   125813          
set 2009819 k50 k37 k 84319 k16649 k3,1 k 1   122458          
ago 2009810 k50 k37 k 78518 k16348 k2,8 k 1   131411          
jul 2009798 k49 k36 k 78317 k16147 k2,5 k     132273          
jun 2009787 k49 k35 k 75617 k15946 k2,3 k     121191          
mai 2009777 k48 k35 k 70016 k15644 k1,8 k     126661          
abr 2009766 k47 k34 k 68816 k15343 k1,2 k     117225          
mar 2009756 k47 k33 k 63315 k15141 k1,2 k     113901          
fev 2009746 k46 k33 k 60414 k14940 k1,1 k     108663          
jan 2009737 k46 k32 k 60214 k14939 k1,1 k     128034          
dez 2008725 k45 k31 k 59913 k14438 k861     126565          
nov 2008711 k45 k30 k 59313 k14437 k817     113307          
out 2008699 k44 k30 k 58913 k14435 k782     114430          
set 2008688 k44 k29 k 57112 k14334 k754     114003          
ago 2008678 k43 k28 k 55912 k14333 k741     126264          
jul 2008667 k43 k27 k 54711 k14132 k698     129978          
jun 2008654 k42 k26 k 54611 k14131 k645     121981          
mai 2008616 k41 k25 k 54010 k13930 k561     124436          
abr 2008605 k25 k24 k 54010 k13729 k527     122672          
mar 2008596 k24 k23 k 5409,9 k13725 k511     124652          
fev 2008584 k24 k22 k 5149,4 k13625 k501     118588          
jan 2008566 k23 k21 k 5139,1 k13624 k407     128299          
dez 2007553 k22 k20 k 5038,8 k13623 k398     104358          
nov 2007534 k22 k19 k 4988,3 k13522 k391     115286          
out 2007521 k21 k18 k 4837,6 k13321 k369     124410          
set 2007495 k21 k17 k 4836,7 k13219 k359     104699          
ago 2007484 k20 k16 k 4806,1 k13218 k346     96830          
jul 2007446 k10 k15 k 4805,6 k13117 k332     103261          
jun 2007414 k9,9 k14 k 4635,1 k13116 k312     96150          
mai 2007391 k9,5 k13 k 4584,9 k13015 k291     108723          
abr 2007378 k9,0 k12 k 4514,7 k12814 k249     95039          
mar 2007369 k8,5 k11 k 4194,4 k12513 k239     93953          
fev 2007350 k8,1 k9,6 k 4074,2 k11912 k228     82476          
jan 2007335 k7,6 k8,8 k 4004,1 k11511 k224     96804          
dez 2006311 k7,1 k7,9 k 3573,5 k10811 k207     145509          
nov 2006203 k6,3 k7,1 k 3453,3 k9110 k188     88654          
out 2006191 k5,9 k6,4 k 3433,0 k899,4 k173     84336          
set 2006181 k5,5 k5,5 k 3432,8 k869,0 k147     83434          
ago 2006170 k5,1 k5,1 k 3432,6 k788,6 k131     87330          
jul 2006158 k4,7 k4,4 k 3392,3 k767,8 k106     79649          
jun 2006146 k4,2 k3,8 k 3332,2 k757,3 k88     78443          
mai 2006132 k3,8 k3,2 k 3292,0 k706,7 k79     75899          
abr 2006120 k3,3 k2,7 k 3261,7 k696,2 k74     64342          
mar 2006107 k2,9 k2,2 k 3171,5 k665,6 k66     62048          
fev 200696 k2,6 k1,6 k 3151,3 k645,0 k55     58695          
jan 200688 k2,2 k1,2 k 3121,1 k584,4 k31     78027          
dez 200575 k1,9 k751 302926563,9 k25     45645          
nov 200569 k1,7 k627 289712563,6 k24     34017          
out 200564 k1,5 k605 267635523,3 k23     34584          
set 200559 k1,2 k581 265501513,1 k12     26980          
ago 200554 k1,1 k566 216464492,8 k9     40544          
jul 200545 k997546 201390472,5 k3     35072          
jun 200540 k854533 154299452,2 k2     32207          
mai 200536 k736421 154243411,9 k2     35479          
abr 200525 k632330 153174411,4 k1     28263          
mar 200521 k538303 153134371,2 k1     18504          
fev 200518 k476221 15390301,0 k1     16243          
jan 200516 k420192 15370308711     14791          
dez 200414 k337173 15351277091     16161          
nov 200412 k283160 12641275841     16896          
out 200410 k202137 12440234651     14331          
set 20048,7 k179129 12336223471     22860          
ago 20046,6 k156110 12334212951     11543          
jul 20045,6 k129102 12227152221     14726          
jun 20044,1 k9491 1191812117      8161          
mai 20043,2 k7076 1191512                  
abr 20042,5 k4863 101312                  
mar 20042,0 k3359 10410                  
fev 20041,3 k1941 917                  
jan 20049921433 9 5                  
dez 20038171127 8 4                  
nov 2003775327   4                  
out 2003775327   4                  
set 2003734326   4                  
ago 2003669325   4                  
jul 2003582321   3                  
jun 2003502320   2                  
mai 2003430315   1                  
abr 2003357313   1                  
mar 2003307313   1                  
fev 2003291313   1                  
jan 2003258212   1                  
dez 2002224211   1                  
nov 2002187210   1                  
out 2002177110   1                  
set 200216418   1                  
ago 200215517   1                  
jul 2002139 7   1                  
jun 2002126 7   1                  
mai 2002119 6   1                  
abr 2002113 6   1                  
mar 2002108 6   1                  
fev 2002100 2   1                  
jan 200296 2   1                  
dez 200196 2   1                  
nov 200190 2   1                  
out 200179 1                      
set 200114 1                      
ago 20016 1                      
jul 20014 1                      
jun 20014 1                      


Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons



For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

jul 2001: 1 1 Planeta

ago 2001: 1 1 20000 Varuna

set 2001: 1 1 Cristão

out 2001: 1 2 Antraz , 2 1 Fundo genético

nov 2001: 1 1 Design gráfico

dez 2001: 1 1 Programa de computador

jan 2002: 1 1 Spam

fev 2002: 1 1 Teoria dos jogos

mar 2002: 1 1 Viagens no tempo

mai 2002: 1 1 Tamanqueiro

jun 2002: 1 1 Roedores

jul 2002: 1 1 Sociologia

ago 2002: 1 1 World Wide Web

set 2002: 1 1 Roldão de Siqueira Fontes

out 2002: 1 1 Relógio (xadrez)

nov 2002: 1 2 Xadrez , 2 1 Notações do xadrez

dez 2002: 1 1 Red Hat Linux

jan 2003: 1 2 Havaí , 2 2 Unidades SI , 3 2 Filogenia , 4 1 Taxonomia (geral)

fev 2003: 1 1 Inhambu-açu

mar 2003: 1 2 Evolução , 2 2 Cidadania , 3 1 Fogo-fátuo

abr 2003: 1 2 Gato de Schrödinger , 2 1 1929

mai 2003: 1 2 Unix , 2 2 URSS , 3 2 Pecuária , 4 1 Artes visuais

jun 2003: 1 2 Mecânica (desambiguação) , 2 2 Dinâmica , 3 1 Lista de Estados soberanos

jul 2003: 1 2 Forró , 2 1 Mandriva

ago 2003: 1 2 Futebol , 2 2 Roger Bacon , 3 2 Rio Mondego , 4 2 Medicina baseada em evidências , 5 2 Zabumba , 6 2 Massa , 7 2 Moçambique , 8 2 Idade Contemporânea , 9 2 Figueira da Foz , 10 2 Distrito de Coimbra , 11 2 Desporto , 12 1 Fundo genético

set 2003: 1 1 Espiritismo (termo)

out 2003: 1 2 Lista de escritores do Brasil por movimento literário , 2 1 Espiritismo (termo)

dez 2003: 1 2 Wiki , 2 2 Sancho II de Portugal , 3 2 Criptografia , 4 2 América Latina , 5 1 Tamanqueiro

jan 2004: 1 3 Galiza , 2 2 Biologia molecular , 3 2 América do Sul , 4 2 Voyager 2 , 5 2 Rio Grande do Sul , 6 2 Hino Nacional Brasileiro , 7 2 Eucarionte , 8 2 Gato de pelo curto brasileiro , 9 2 Newton (desambiguação) , 10 2 13 de agosto , 11 2 Portugal , 12 2 Plutão , 13 2 Monera , 14 1 Peritónio

fev 2004: 1 5 Brasil , 2 4 Suíça , 3 4 Medicina , 4 3 Cuba , 5 3 Carl Kellner , 6 3 Ordo Templi Orientis , 7 3 Thelema , 8 3 Tailândia , 9 3 Cidade de Deus (filme) , 10 3 Myanmar , 11 3 Israel , 12 3 Índia , 13 3 Reino Unido , 14 3 Rio Grande do Norte , 15 3 Nova Zelândia , 16 3 Mitologia , 17 3 Mato Grosso do Sul , 18 3 República da Irlanda , 19 3 França , 20 3 Europa , 21 3 Argentina , 22 2 Lista de Estados soberanos , 23 2 Espiritismo (termo) , 24 2 Música clássica , 25 2 Estados Federados da Micronésia

mar 2004: 1 5 Candomblé , 2 5 Brasil , 3 4 ReactOS , 4 4 Niterói , 5 4 Lista de clubes de futebol do Brasil , 6 4 Religião , 7 4 Minas Gerais , 8 4 Música , 9 4 Engenharia , 10 4 Bahia , 11 3 Área , 12 3 Concílio de Nicea , 13 3 Tensegridade , 14 3 Martinho Lutero , 15 3 População , 16 3 Simetria , 17 3 Cultura do Japão , 18 3 Telecomunicação , 19 3 Escravidão , 20 3 Atentados de 11 de março de 2004 em Madrid , 21 3 Diagrama de classes , 22 3 História da Guiné-Bissau , 23 3 Microsoft Excel , 24 3 Oscar Niemeyer , 25 3 Calendário gregoriano

abr 2004: 1 6 Calvin e Hobbes , 2 5 Heroína , 3 5 França , 4 4 Espiritismo (termo) , 5 4 Centro de Mídia Independente , 6 4 Revolução de 25 de Abril de 1974 , 7 4 Psicologia , 8 4 Galileu Galilei , 9 4 Biografias , 10 4 Adolf Hitler , 11 3 Design gráfico , 12 3 Propaganda , 13 3 Fernando I de Portugal , 14 3 Ciberdemocracia , 15 3 Franz Schubert , 16 3 Relatividade restrita , 17 3 Oceano , 18 3 São Paulo (desambiguação) , 19 3 Karl Dönitz , 20 3 Condoleezza Rice , 21 3 Cultura de Singapura , 22 3 MPB , 23 3 Chico Buarque , 24 3 Município , 25 3 Orquídea

mai 2004: 1 8 Brasil , 2 7 Centro de Mídia Independente , 3 6 Príncipe Custódio de Xapanã , 4 6 Portugal , 5 5 Contrato de aprendizagem , 6 5 Estado Novo , 7 5 Jorge Amado , 8 5 Lista de listas , 9 4 Iroko (orixá) , 10 4 Jurema , 11 4 Batuque (religião) , 12 4 Karl Marx , 13 4 18 de maio , 14 4 Jorge Sampaio , 15 4 Candomblé , 16 4 Linguagens de Programação , 17 4 Xadrez , 18 4 Segunda Guerra Mundial , 19 4 Romancistas , 20 4 Biografias , 21 3 Música clássica , 22 3 Gás ideal , 23 3 Olinda , 24 3 1210 , 25 3 Jean-Jacques Rousseau

jun 2004: 1 7 Estados Unidos , 2 6 Língua portuguesa , 3 5 Rio de Janeiro , 4 5 Chá , 5 5 José Manuel Durão Barroso , 6 5 Jamaica , 7 5 União Soviética , 8 5 Inglaterra , 9 5 Filosofia , 10 5 Cinema , 11 5 Ludwig van Beethoven , 12 5 Amesterdão , 13 4 HTML , 14 4 Harry Potter , 15 4 Henrique de Borgonha, conde de Portucale , 16 4 Planetologia , 17 4 Marie Curie , 18 4 Fernando Torres (ator) , 19 4 Ana de Sousa , 20 4 Morna , 21 4 Mesopotâmia , 22 4 Língua árabe , 23 4 Caruaru , 24 4 Jurema , 25 4 Jorge Amado

jul 2004: 1 8 2004 , 2 7 Mahatma Gandhi , 3 7 Holocausto , 4 7 1 de janeiro , 5 7 Países Baixos , 6 7 Estados Unidos , 7 7 Brasília , 8 6 Lista de desportos , 9 6 Lista de escritores do Brasil por gênero literário , 10 6 Lista de chefes de governo de Portugal , 11 6 Universidade de São Paulo , 12 6 Oscar Niemeyer , 13 6 Linux , 14 6 Banco de dados , 15 6 Brasil , 16 6 Adolf Hitler , 17 5 Nelson Mandela , 18 5 Gustave Eiffel , 19 5 Pedro Santana Lopes , 20 5 Alfabeto latino , 21 5 Fernão de Magalhães , 22 5 Mozilla Application Suite , 23 5 29 de julho , 24 5 23 de julho , 25 5 Bretanha

ago 2004: 1 9 Estados Unidos , 2 8 África do Sul , 3 7 Portugal , 4 7 Getúlio Vargas , 5 6 Cuba , 6 6 Arthur Omar , 7 6 Sibéria , 8 6 Porto Alegre , 9 6 Brunei , 10 6 Brasil , 11 6 Argentina , 12 5 Rio de Janeiro , 13 5 Alfabeto fonético internacional , 14 5 Alfabeto latino , 15 5 Estados dos Estados Unidos , 16 5 Língua portuguesa , 17 5 25 de janeiro , 18 5 Banda desenhada , 19 5 Comores , 20 5 Burkina Faso , 21 5 Coreia do Sul , 22 5 Arábia Saudita , 23 5 Moçambique , 24 5 História do Brasil , 25 5 Grécia

set 2004: 1 9 Deserto , 2 8 Hidrogénio , 3 7 Baleia , 4 7 Lista de instituições de ensino superior do Brasil , 5 7 Atenas , 6 6 Regiões do Brasil , 7 6 Fernando Henrique Cardoso , 8 6 Judaísmo , 9 6 Grécia , 10 6 Estados Unidos , 11 6 Brasil , 12 6 Alemanha , 13 5 Coluna Prestes , 14 5 Passa Quatro , 15 5 Chechênia , 16 5 Salvador (Bahia) , 17 5 António de Oliveira Salazar , 18 5 Stanley Kubrick , 19 5 Deodoro da Fonseca , 20 5 Lista de escritores de língua portuguesa , 21 5 Quicksort , 22 5 Karl Marx , 23 5 Copa do Mundo FIFA , 24 5 Calendário gregoriano , 25 5 Crômio

out 2004: 1 7 Humberto de Alencar Castelo Branco , 2 7 2004 , 3 6 Maçã , 4 6 Psoríase , 5 6 Mona Lisa , 6 6 4 de outubro , 7 6 Neoliberalismo , 8 6 Lista de imperadores bizantinos , 9 5 Luz , 10 5 The Piper at the Gates of Dawn , 11 5 Che Guevara , 12 5 Fernando Sabino , 13 5 Lauraceae , 14 5 Lyon , 15 5 Anos de chumbo , 16 5 Spock , 17 5 1891 , 18 5 1971 , 19 5 1994 , 20 5 11 de outubro , 21 5 1 de fevereiro , 22 5 Guerra Civil Inglesa , 23 5 Pablo Picasso , 24 5 Fernando Henrique Cardoso , 25 5 Porto Rico

nov 2004: 1 8 São Paulo , 2 7 Sebastião Carvalho Leme , 3 7 Yasser Arafat , 4 7 Luiz Inácio Lula da Silva , 5 7 Hidrogénio , 6 6 Espiritismo (termo) , 7 6 Tony Blair , 8 6 ColdFusion , 9 6 Viaduto do Chá , 10 6 Theo van Gogh (cineasta) , 11 6 Serpente , 12 6 Belém (Pará) , 13 6 Aikido , 14 6 Religiões no Brasil , 15 6 Banda desenhada , 16 6 Império Romano , 17 6 Islão , 18 6 Jogo de computador , 19 6 Wiki , 20 6 Brasil , 21 5 The Sims , 22 5 Rede Globo , 23 5 Prostituição , 24 5 Oracle (banco de dados) , 25 5 Netscape

dez 2004: 1 9 Natal , 2 9 Brasil , 3 8 Sismo e tsunami do Oceano Índico de 2004 , 4 8 Tsunami , 5 8 Banda desenhada , 6 8 Leonardo da Vinci , 7 8 2004 , 8 8 Noam Chomsky , 9 8 Aves , 10 7 Friedrich Nietzsche , 11 6 Lost in Space , 12 6 Programa Apollo , 13 6 Sílex , 14 6 Língua polaca , 15 6 Os Simpsons , 16 6 Helena Blavatsky , 17 6 Mauricio de Sousa , 18 6 Carnaval , 19 6 Cambuquira , 20 6 Homossexualidade , 21 6 Linguística , 22 6 Lua , 23 6 Albert Einstein , 24 5 Wikipédia , 25 5 Sport Lisboa e Benfica

jan 2005: 1 15 Luiz Inácio Lula da Silva , 2 14 Brasil , 3 10 Leonel Brizola , 4 10 Veja , 5 8 Sismo e tsunami do Oceano Índico de 2004 , 6 8 Medicina , 7 7 Tsunami , 8 7 Amália Rodrigues , 9 6 Espiritismo (termo) , 10 6 Harry Potter , 11 6 Cocadaboa , 12 6 Lago Vitória , 13 6 Mir , 14 6 Renato Aragão , 15 6 Foguete espacial , 16 6 2005 , 17 6 Porto Alegre , 18 6 Comunismo , 19 5 Eletrobras Furnas , 20 5 CPF , 21 5 Insetívoro , 22 5 Conjunto Ibirapuera , 23 5 Açúcar invertido , 24 5 Ariane (foguete) , 25 5 Melão

fev 2005: 1 13 Espiritismo (termo) , 2 12 Luiz Inácio Lula da Silva , 3 8 Chico Xavier , 4 8 Sport Club Corinthians Paulista , 5 7 Antipapa João XXIII , 6 7 Arnold Schwarzenegger , 7 7 Golpe de Estado no Brasil em 1964 , 8 7 Santos Dumont , 9 6 Harry Potter , 10 6 Xuxa , 11 6 Cracker , 12 6 Cannabis sativa , 13 6 Língua portuguesa , 14 6 Black metal , 15 6 Haxixe , 16 6 Club de Regatas Vasco da Gama , 17 6 Brasil , 18 5 Bumerangue , 19 5 Vibrador , 20 5 Sismo de Valdivia de 1960 , 21 5 Calor específico , 22 5 Pato Donald , 23 5 Renovação Carismática Católica , 24 5 Kurt Cobain , 25 5 Catedral de Notre-Dame de Paris

mar 2005: 1 8 José Manuel Durão Barroso , 2 8 Brasil , 3 7 Espiritismo (termo) , 4 7 Exploração espacial , 5 7 Catolicismo , 6 7 Fidel Castro , 7 6 José Rodrigues , 8 6 Doença de Chagas , 9 6 Páscoa , 10 6 José Sócrates , 11 6 Golpe de Estado no Brasil em 1964 , 12 6 Lula , 13 6 Música , 14 6 Luiz Inácio Lula da Silva , 15 6 Sport Club Corinthians Paulista , 16 6 Adolf Hitler , 17 5 Deutsche Welle , 18 5 Caminhão , 19 5 Orangotango , 20 5 Escorpião (desambiguação) , 21 5 Papa Bento XIV , 22 5 Papa Bento XIII , 23 5 Tantra (banda) , 24 5 Floresta boreal , 25 5 Paulo Coelho

abr 2005: 1 24 Papa Bento XVI , 2 20 Papa João Paulo II , 3 16 Luiz Inácio Lula da Silva , 4 13 Português brasileiro , 5 12 Lista de Papas , 6 12 Papa , 7 9 2005 , 8 9 Brasil , 9 8 Conclave de 2005 , 10 7 Lili Caneças , 11 7 Tratado de Waitangi , 12 7 Cláudio Hummes , 13 7 Escorpião , 14 7 Presidente do Brasil , 15 7 Ceticismo , 16 7 Conclave , 17 7 Pablo Picasso , 18 7 J. R. R. Tolkien , 19 7 Friedrich Nietzsche , 20 7 Microsoft Windows , 21 7 Segunda Guerra Mundial , 22 7 Portugal , 23 7 Filosofia , 24 6 Harry Potter , 25 6 Metro do Porto

mai 2005: 1 15 Brasil , 2 10 Portugal , 3 10 Sebastião José de Carvalho e Melo , 4 9 Tareco , 5 9 Luiz Inácio Lula da Silva , 6 9 Estados Unidos , 7 8 Sport Lisboa e Benfica , 8 8 Reconquista , 9 8 Criacionismo , 10 8 Chico Xavier , 11 8 Montreal , 12 8 Partido dos Trabalhadores , 13 8 Albert Einstein , 14 7 Vitória-régia , 15 7 Volkswagen Gol , 16 7 U-Br , 17 7 Transfusão de sangue , 18 7 Lista de escritores de língua portuguesa , 19 7 Sorocaba , 20 6 Rio de Janeiro , 21 6 Espiritismo (termo) , 22 6 Final Fantasy VII , 23 6 John Forbes Nash , 24 6 Franquia , 25 6 Auto da Barca do Inferno

jun 2005: 1 11 Vasco Gonçalves , 2 11 Brasil , 3 10 Espiritismo (termo) , 4 10 Veja , 5 10 Portugal , 6 9 Club de Regatas Vasco da Gama , 7 9 Fernando Henrique Cardoso , 8 8 Eugénio de Andrade , 9 8 Copa das Confederações FIFA de 2005 , 10 8 Futebol Clube do Porto , 11 8 Álvaro Cunhal , 12 8 Linkin Park , 13 8 Tuberculose , 14 8 Candido Portinari , 15 8 Napoleão Bonaparte , 16 8 Japão , 17 8 Estados Unidos , 18 8 Espanha , 19 7 Olavo de Carvalho , 20 7 English As She Is Spoke , 21 7 Legião da Boa Vontade , 22 7 Aeroporto , 23 7 Cultura da Inglaterra , 24 7 Guerra de Secessão , 25 7 Mozilla Firefox

jul 2005: 1 18 Luiz Inácio Lula da Silva , 2 16 Brasil , 3 12 Saco de plástico , 4 12 São Paulo Futebol Clube , 5 12 Portugal , 6 10 Partido dos Trabalhadores , 7 9 Espiritismo (termo) , 8 9 Etimologia dos nomes dos países , 9 9 Escândalo do Mensalão , 10 9 Artur Virgílio Alves dos Reis , 11 9 Liga dos Campeões da UEFA , 12 9 Cinema western , 13 8 Masturbação , 14 8 Lista de hinos nacionais e regionais , 15 7 Nu metal , 16 7 Profecia , 17 7 Live 8 , 18 7 Racismo , 19 7 Homossexualidade , 20 7 Pink Floyd , 21 7 Língua portuguesa , 22 7 São Paulo , 23 7 Testemunhas de Jeová , 24 7 Jogo de interpretação de personagens , 25 7 Xadrez

ago 2005: 1 22 Sistema cooperativo , 2 16 Escândalo do Mensalão , 3 13 Edição radiofônica , 4 13 Partido dos Trabalhadores , 5 12 Luiz Inácio Lula da Silva , 6 12 Brasil , 7 10 Banda desenhada , 8 10 Lista de hinos nacionais e regionais , 9 10 Segunda Guerra Mundial , 10 9 Papa Bento XVI , 11 9 Homossexualidade , 12 9 Orkut , 13 9 Estados Unidos , 14 8 Metrô de São Paulo , 15 8 Friends , 16 8 Gíria sexual , 17 8 Hacker , 18 8 Basquetebol , 19 8 Lista de instituições de ensino superior do Brasil , 20 8 Israel , 21 7 Risorgimento , 22 7 Língua portuguesa , 23 7 Angra (banda) , 24 7 Aleister Crowley , 25 7 Deus

set 2005: 1 13 São Paulo Futebol Clube , 2 13 Sport Club Corinthians Paulista , 3 10 Sistema cooperativo , 4 10 Microsoft Windows , 5 10 Luiz Inácio Lula da Silva , 6 10 Brasil , 7 8 Sistemas de Correios Eletrônicos , 8 8 Escândalo do Mensalão , 9 8 Cruzeiro Esporte Clube , 10 8 Testemunhas de Jeová , 11 7 Espiritismo (termo) , 12 7 Projeto de workflow , 13 7 Furacão Katrina , 14 7 Severino Cavalcanti , 15 7 2005 , 16 7 Ténis , 17 7 Blumenau , 18 7 Língua portuguesa , 19 6 Wikipédia , 20 6 Harry Potter , 21 6 Anticomunismo , 22 6 Programa Apollo , 23 6 Federação Internacional de Futebol , 24 6 Golpe de Estado no Brasil em 1964 , 25 6 Fluxo de trabalho

out 2005: 1 19 Referendo no Brasil em 2005 , 2 14 Apartheid , 3 14 Brasil , 4 13 Gíria sexual , 5 12 Guerra de Secessão , 6 11 Espiritismo (termo) , 7 11 Sport Lisboa e Benfica , 8 10 2005 , 9 10 Sismo de Lisboa de 1755 , 10 10 Luiz Inácio Lula da Silva , 11 9 Aníbal Cavaco Silva , 12 9 História do Brasil , 13 9 Estados Unidos , 14 8 Estatuto do Desarmamento , 15 8 PlayStation 3 , 16 8 Racismo , 17 8 Vulcão , 18 8 Sport Club Internacional , 19 8 Lista de hinos nacionais e regionais , 20 8 Testemunhas de Jeová , 21 8 Paraná , 22 8 Nazismo , 23 8 México , 24 8 Fascismo , 25 8 Cristianismo

nov 2005: 1 15 Brasil , 2 13 Martinchel , 3 13 Sport Club Corinthians Paulista , 4 11 Foguete espacial , 5 10 Espiritismo (termo) , 6 10 Sport Lisboa e Benfica , 7 10 Sismo de Lisboa de 1755 , 8 10 Chile , 9 10 Austrália , 10 9 Camaleão , 11 9 Guerra do Paraguai , 12 9 Portugal , 13 8 Febre maculosa , 14 8 Ataque a Pearl Harbor , 15 8 Botafogo de Futebol e Regatas , 16 8 Orkut , 17 8 Wiki , 18 8 Jesus , 19 8 Estados Unidos , 20 8 Adolf Hitler , 21 7 Instituto do Patrimônio Histórico e Artístico Nacional , 22 7 Laura Pausini , 23 7 Futebol Clube do Porto , 24 7 Copa do Mundo FIFA de 2006 , 25 7 2005

dez 2005: 1 23 Portugal , 2 14 Igreja Universal do Reino de Deus , 3 14 Jesus , 4 14 Sport Club Corinthians Paulista , 5 14 Brasil , 6 13 Harry Potter , 7 13 Luiz Inácio Lula da Silva , 8 11 Copa do Mundo de Clubes da FIFA , 9 11 Sport Lisboa e Benfica , 10 11 Ronaldinho Gaúcho , 11 10 Copa do Mundo FIFA de 2006 , 12 10 Sport Club Internacional , 13 10 Orkut , 14 10 São Paulo Futebol Clube , 15 10 Revolução Francesa , 16 10 Minas Gerais , 17 9 Lista de Estados soberanos , 18 9 Taça Mundial de Clubes da FIFA , 19 9 Tibia , 20 9 Papai Noel , 21 9 Natal , 22 9 Grêmio Foot-Ball Porto Alegrense , 23 9 Sociedade Esportiva Palmeiras , 24 9 Campeonato Brasileiro de Futebol , 25 9 Angra (banda)

jan 2006: 1 23 Brasil , 2 19 Luiz Inácio Lula da Silva , 3 17 2006 , 4 17 São Paulo Futebol Clube , 5 17 Portugal , 6 17 Adolf Hitler , 7 16 Wikipédia , 8 16 Harry Potter , 9 14 2005 , 10 14 Orkut , 11 14 Chile , 12 14 Sport Club Corinthians Paulista , 13 13 Harry James Potter , 14 13 Copa do Mundo FIFA de 2006 , 15 13 Sociedade Esportiva Palmeiras , 16 12 Denominação cristã , 17 12 Clube Atlético Mineiro , 18 11 Igreja Universal do Reino de Deus , 19 11 Sport Lisboa e Benfica , 20 11 Sporting Clube de Portugal , 21 11 Grêmio Foot-Ball Porto Alegrense , 22 11 Io (satélite) , 23 11 Ditadura , 24 11 Google , 25 11 Cruzeiro Esporte Clube

fev 2006: 1 28 Luiz Inácio Lula da Silva , 2 18 Portugal , 3 17 Wikipédia , 4 17 Sport Club Corinthians Paulista , 5 16 Orkut , 6 15 Brasil , 7 13 Erwin Rommel , 8 13 The Beatles , 9 12 U2 , 10 12 Geraldo Alckmin , 11 12 Veja , 12 12 Segunda Guerra Mundial , 13 11 Piada , 14 11 Morangos com Açúcar , 15 11 Hacker , 16 11 Língua portuguesa , 17 11 São Paulo (estado) , 18 11 Juscelino Kubitschek , 19 11 Estados Unidos , 20 11 Angola , 21 10 Chuck Norris , 22 10 Otaku , 23 10 Prostituição , 24 10 Sociedade Esportiva Palmeiras , 25 10 Lista de instituições de ensino superior do Brasil

mar 2006: 1 34 Brasil , 2 25 Luiz Inácio Lula da Silva , 3 21 Portugal , 4 19 Orkut , 5 19 The Beatles , 6 19 Segunda Guerra Mundial , 7 16 Testemunhas de Jeová , 8 15 2006 , 9 15 Sport Club Corinthians Paulista , 10 14 Adolf Hitler , 11 13 Geraldo Alckmin , 12 12 Chuck Norris , 13 12 Marcos Pontes , 14 12 Curitiba , 15 12 Bíblia , 16 11 Igreja Universal do Reino de Deus , 17 11 Pedro I do Brasil , 18 11 Batalha das Termópilas , 19 11 Catarina Eufémia , 20 11 Rede Globo , 21 11 José Serra , 22 11 Língua portuguesa , 23 11 História do Brasil , 24 11 Clube de Regatas do Flamengo , 25 11 Estados Unidos

abr 2006: 1 28 Brasil , 2 22 São Paulo Futebol Clube , 3 22 Portugal , 4 21 Orkut , 5 20 Morangos com Açúcar , 6 20 Luiz Inácio Lula da Silva , 7 19 Marcos Pontes , 8 19 Estados Unidos , 9 16 Sport Club Corinthians Paulista , 10 16 Alemanha , 11 15 Segunda Guerra Mundial , 12 14 Geraldo Alckmin , 13 14 2006 , 14 13 RedeTV! , 15 13 Britney Spears , 16 12 Wikipédia , 17 12 Sport Lisboa e Benfica , 18 12 Evo Morales , 19 12 Os Cavaleiros do Zodíaco , 20 12 Seleção Brasileira de Futebol , 21 12 Revolução de 25 de Abril de 1974 , 22 11 Idade Antiga , 23 11 Museu da Língua Portuguesa , 24 11 Chuck Norris , 25 11 Grêmio Foot-Ball Porto Alegrense

mai 2006: 1 29 Brasil , 2 26 Orkut , 3 25 Copa do Mundo FIFA de 2006 , 4 23 Portugal , 5 22 Sport Club Corinthians Paulista , 6 21 Luiz Inácio Lula da Silva , 7 17 Wikipédia , 8 17 Rede Globo , 9 17 Morangos com Açúcar , 10 17 Argentina , 11 16 Futebol , 12 16 Atos de violência organizada no Brasil em 2006 , 13 16 2006 , 14 16 Sérvia e Montenegro , 15 15 Copa do Mundo FIFA , 16 15 Florianópolis , 17 15 Espanha , 18 14 Lost (série de TV) , 19 14 Seleção Brasileira de Futebol , 20 14 Segunda Guerra Mundial , 21 14 Belo Horizonte , 22 14 Alemanha , 23 13 Região Sudeste do Brasil , 24 13 Opus Dei , 25 13 Marketing

jun 2006: 1 66 Copa do Mundo FIFA de 2006 , 2 38 Brasil , 3 33 Bussunda , 4 26 Seleção Brasileira de Futebol , 5 26 Orkut , 6 25 Luiz Inácio Lula da Silva , 7 23 Copa do Mundo FIFA , 8 23 Alemanha , 9 21 Futebol , 10 19 Croácia , 11 19 Estados Unidos , 12 18 Casseta & Planeta , 13 18 Seleção Australiana de Futebol , 14 18 2006 , 15 18 Sport Club Corinthians Paulista , 16 17 Wikipédia , 17 17 Rebelde (telenovela) , 18 17 Gana , 19 17 Portugal , 20 17 Inglaterra , 21 17 Curitiba , 22 16 Trindade e Tobago , 23 15 Morangos com Açúcar , 24 15 Adolf Hitler , 25 14 Google

jul 2006: 1 38 Copa do Mundo FIFA de 2006 , 2 37 Brasil , 3 23 Clube de Regatas do Flamengo , 4 22 Zinédine Zidane , 5 21 Orkut , 6 20 Seleção Brasileira de Futebol , 7 20 Geraldo Alckmin , 8 19 RBD , 9 17 Hezbollah , 10 17 Estados Unidos , 11 16 Copa do Mundo FIFA , 12 16 Revolução Francesa , 13 16 Rio de Janeiro (estado) , 14 15 Anneliese Michel , 15 15 Linkin Park , 16 15 2006 , 17 15 São Paulo (estado) , 18 15 Alemanha , 19 14 Futebol , 20 14 Floribella (telenovela portuguesa) , 21 14 Conflito árabe-israelense , 22 14 Simple Plan , 23 14 Lost (série de TV) , 24 14 Carlos Alberto Parreira , 25 14 Ronaldo Nazário

ago 2006: 1 27 Orkut , 2 25 Geraldo Alckmin , 3 25 Brasil , 4 22 Luiz Inácio Lula da Silva , 5 21 Hezbollah , 6 21 Sport Club Internacional , 7 21 Estados Unidos , 8 20 Wikipédia , 9 20 Adolf Hitler , 10 18 RBD , 11 18 Elvis Presley , 12 18 Emo , 13 17 Grêmio Foot-Ball Porto Alegrense , 14 17 Israel , 15 16 Paraíso Tropical , 16 16 Eleições gerais no Brasil em 2006 , 17 16 José Serra , 18 16 Plutão , 19 16 Fidel Castro , 20 15 Simple Plan , 21 15 Francisco Louçã , 22 15 São Paulo (estado) , 23 14 Rebelde (telenovela) , 24 14 Gíria sexual , 25 14 2006

set 2006: 1 28 Brasil , 2 27 Orkut , 3 20 Eleições gerais no Brasil em 2006 , 4 20 Morangos com Açúcar , 5 19 Faculdade de Tecnologia de Jundiaí , 6 18 Geraldo Alckmin , 7 18 Estados Unidos , 8 17 Sport Club Corinthians Paulista , 9 16 Steve Irwin , 10 16 2006 , 11 16 Região Sul do Brasil , 12 15 Rebelde (telenovela) , 13 15 Páginas da Vida , 14 15 Santa Catarina , 15 15 Clube de Regatas do Flamengo , 16 14 RSS , 17 14 Grêmio Foot-Ball Porto Alegrense , 18 14 Rio Grande do Sul , 19 14 Segunda Guerra Mundial , 20 14 Portugal , 21 14 Japão , 22 13 Floribella (telenovela portuguesa) , 23 13 Daniella Cicarelli , 24 13 Lost (série de TV) , 25 13 Guerra Fria

out 2006: 1 50 Brasil , 2 29 Orkut , 3 24 Wikipédia , 4 22 Luiz Inácio Lula da Silva , 5 21 Estados Unidos , 6 20 Fernando Henrique Cardoso , 7 19 Eleições gerais no Brasil em 2006 , 8 19 Grêmio Foot-Ball Porto Alegrense , 9 18 Xuxa , 10 18 Sociedade Esportiva Palmeiras , 11 17 Lost (série de TV) , 12 17 Fernando Pessoa , 13 16 RBD , 14 16 Morangos com Açúcar , 15 15 YouTube , 16 15 Partido dos Trabalhadores , 17 14 Britney Spears , 18 14 Segunda Guerra Mundial , 19 13 Rebelde (telenovela) , 20 13 Geraldo Alckmin , 21 13 José Serra , 22 13 Partido da Social Democracia Brasileira , 23 13 Sexo , 24 13 Clube Atlético Mineiro , 25 13 Água

nov 2006: 1 50 Brasil , 2 23 2006 , 3 23 Rio Grande do Sul , 4 21 Orkut , 5 21 Jesus , 6 19 Wikipédia , 7 19 Club de Regatas Vasco da Gama , 8 19 África , 9 18 Morangos com Açúcar , 10 18 Britney Spears , 11 18 Curitiba , 12 17 Região Sul do Brasil , 13 17 Campeonato Brasileiro de Futebol , 14 17 Segunda Guerra Mundial , 15 17 Portugal , 16 16 Campeonato Brasileiro de Futebol de 2006 , 17 16 Japão , 18 16 Itália , 19 16 Sport Club Corinthians Paulista , 20 15 Toronto , 21 14 Kibe Loco , 22 14 Natal , 23 14 Clube Atlético Mineiro , 24 14 Os Lusíadas , 25 14 União Europeia

dez 2006: 1 41 Brasil , 2 26 Saddam Hussein , 3 22 Wikipédia , 4 18 High School Musical , 5 18 Grêmio Foot-Ball Porto Alegrense , 6 18 Club de Regatas Vasco da Gama , 7 17 2006 , 8 17 Natal , 9 17 Fortaleza , 10 16 Sport Club Internacional , 11 15 Copa do Mundo de Clubes da FIFA , 12 15 Copa do Mundo de Clubes da FIFA de 2006 , 13 15 Augusto Pinochet , 14 15 Avril Lavigne , 15 15 Curitiba , 16 14 Rebelde (telenovela) , 17 14 Páginas da Vida , 18 14 RBD , 19 14 James Brown , 20 14 Sport Club Corinthians Paulista , 21 13 Papai Noel , 22 13 Botafogo de Futebol e Regatas , 23 13 Britney Spears , 24 13 Teatro , 25 13 Rio Grande do Sul

jan 2007: 1 32 Brasil , 2 23 Sport Lisboa e Benfica , 3 23 Daniella Cicarelli , 4 23 2007 , 5 16 YouTube , 6 16 São Paulo (estado) , 7 16 Sport Club Corinthians Paulista , 8 15 Malhação , 9 15 Saddam Hussein , 10 15 Club de Regatas Vasco da Gama , 11 14 Rebelde (telenovela) , 12 14 MTV Brasil , 13 14 Aborto , 14 14 Mona Lisa , 15 14 Luiz Inácio Lula da Silva , 16 13 Pé na Jaca , 17 13 Futebol Clube do Porto , 18 13 Florianópolis , 19 13 Curitiba , 20 12 Os Monarcas , 21 12 Juliana Lohmann , 22 12 High School Musical , 23 12 PlayStation 3 , 24 12 Igreja Renascer em Cristo , 25 12 Grêmio Foot-Ball Porto Alegrense

fev 2007: 1 15 Sport Lisboa e Benfica , 2 15 Harry Potter , 3 15 Big Brother Brasil , 4 15 Aborto , 5 15 Club de Regatas Vasco da Gama , 6 15 Direito , 7 15 Brasil , 8 14 Naruto , 9 14 2007 , 10 14 Sport Club Corinthians Paulista , 11 14 Aquecimento global , 12 13 Paraíso Tropical , 13 13 Carnaval do Brasil , 14 13 Avatar: The Last Airbender , 15 13 Ilha de São Vicente (Cabo Verde) , 16 13 Carnaval , 17 12 Madonna , 18 12 Futebol Clube do Porto , 19 12 Rede Globo , 20 12 Orkut , 21 12 Portugal , 22 12 Getúlio Vargas , 23 11 Anna Nicole Smith , 24 11 Rebelde (telenovela) , 25 11 Gilberto Kassab

mar 2007: 1 24 Brasil , 2 23 Aquecimento global , 3 20 Paraíso Tropical , 4 18 2007 , 5 18 Catolicismo , 6 17 Sport Lisboa e Benfica , 7 17 Big Brother Brasil , 8 16 Henry Sobel , 9 16 José Sócrates , 10 16 Amazônia , 11 16 Club de Regatas Vasco da Gama , 12 16 Água , 13 15 História do Brasil , 14 15 Curitiba , 15 14 Ativismo pedófilo , 16 14 Ben 10 (desenho animado) , 17 14 Santo António de Lisboa , 18 14 Britney Spears , 19 13 Dia Internacional da Mulher , 20 13 Efeito estufa , 21 13 Sexo , 22 13 George W. Bush , 23 13 Vitória (Espírito Santo) , 24 13 Luís de Camões , 25 13 Clube de Regatas do Flamengo

abr 2007: 1 25 Brasil , 2 19 São Paulo Futebol Clube , 3 18 Canadá , 4 17 Adolf Hitler , 5 16 Heroes (série de televisão) , 6 16 Paraíso Tropical , 7 16 Campeonato Brasileiro de Futebol , 8 16 Juiz de Fora , 9 15 Fernanda Câncio , 10 15 Portugal , 11 15 Curitiba , 12 14 RecordTV , 13 14 Língua portuguesa , 14 14 Club de Regatas Vasco da Gama , 15 13 Nair Bello , 16 13 José Sócrates , 17 13 António de Oliveira Salazar , 18 13 2007 , 19 13 Universidade Estadual de Campinas , 20 13 Evanescence , 21 13 Revolução Francesa , 22 13 Deus , 23 13 Sport Club Corinthians Paulista , 24 13 Capitalismo , 25 12 Massacre de Virginia Tech

mai 2007: 1 32 Portugal , 2 21 Romário , 3 20 Brasil , 4 19 Papa Bento XVI , 5 18 Eterna Magia , 6 18 Enéas Carneiro , 7 18 Sport Club Corinthians Paulista , 8 17 Greves de 2007 em universidades públicas brasileiras , 9 17 Avatar: The Last Airbender , 10 17 Frei Galvão , 11 17 Grêmio Foot-Ball Porto Alegrense , 12 16 RecordTV , 13 16 Adolf Hitler , 14 15 Globalização , 15 15 Clube Atlético Mineiro , 16 15 Leonardo da Vinci , 17 15 São Paulo Futebol Clube , 18 15 Jesus , 19 14 Shingo Yabuki , 20 14 2007 , 21 14 Efeito estufa , 22 14 Rio de Janeiro (estado) , 23 13 Visita de Bento XVI ao Brasil , 24 13 António de Oliveira Salazar , 25 13 Campeonato Brasileiro de Futebol

jun 2007: 1 25 Sete Pecados , 2 21 Tríplice coroa , 3 21 Uberlândia , 4 21 Brasil , 5 20 Grêmio Foot-Ball Porto Alegrense , 6 18 Língua portuguesa , 7 17 Eterna Magia , 8 16 Paraíso Tropical , 9 15 Festa junina , 10 15 Região Sul do Brasil , 11 15 São Paulo (estado) , 12 14 Pé na Jaca , 13 14 Naruto , 14 14 2007 , 15 14 26 de junho , 16 14 Napoleão Bonaparte , 17 14 Vénus (planeta) , 18 14 Revolução Francesa , 19 14 Paraná , 20 14 Alemanha , 21 13 A Pedra do Reino , 22 13 Estádio do Maracanã , 23 13 Portugal , 24 13 Belo Horizonte , 25 12 História de Roraima

jul 2007: 1 82 Voo TAM 3054 , 2 39 Jogos Pan-Americanos de 2007 , 3 32 Brasil , 4 30 Antônio Carlos Magalhães , 5 25 Brasil nos Jogos Pan-Americanos de 2007 , 6 22 2007 , 7 22 Grêmio Foot-Ball Porto Alegrense , 8 21 Harry Potter and the Deathly Hallows , 9 20 Harry Potter , 10 20 Clube de Regatas do Flamengo , 11 19 Jade Barbosa , 12 19 Copa América de 2007 , 13 19 Botafogo de Futebol e Regatas , 14 19 São Paulo Futebol Clube , 15 18 Futebol nos Jogos Pan-Americanos de 2007 , 16 18 Estádio Olímpico João Havelange (Rio de Janeiro) , 17 18 Uberlândia , 18 17 Paraíso Tropical , 19 17 Club de Regatas Vasco da Gama , 20 16 Júlio Redecker , 21 16 Aeroporto de São Paulo-Congonhas , 22 16 Avril Lavigne , 23 16 Portugal , 24 15 Seleção Brasileira de Futebol , 25 15 Pedro II do Brasil

ago 2007: 1 31 Brasil , 2 23 São Paulo Futebol Clube , 3 23 Portugal , 4 20 Sport Lisboa e Benfica , 5 20 Pênis , 6 20 Aquecimento global , 7 18 NX Zero , 8 18 Harry Potter and the Deathly Hallows , 9 18 Avril Lavigne , 10 18 Amor , 11 18 Segunda Guerra Mundial , 12 17 Paraíso Tropical , 13 17 José Sócrates , 14 16 Voo TAM 3054 , 15 16 Caminhos do Coração , 16 16 Folclore , 17 16 Sport Club Corinthians Paulista , 18 15 Amigas & Rivais , 19 15 Zac Efron , 20 15 High School Musical , 21 15 Rebelde (telenovela) , 22 15 Clube Atlético Mineiro , 23 15 Japão , 24 14 Ashley Tisdale , 25 14 Naruto

set 2007: 1 37 Paraíso Tropical , 2 36 São Paulo Futebol Clube , 3 28 Sport Club Corinthians Paulista , 4 25 Avril Lavigne , 5 22 Ashley Tisdale , 6 22 Da Cor do Pecado , 7 22 Naruto , 8 21 Record News , 9 21 Luciano Pavarotti , 10 21 Brasil , 11 20 Duas Caras (telenovela) , 12 20 Malhação , 13 20 2007 , 14 20 Morangos com Açúcar , 15 19 Água , 16 18 Desejo Proibido , 17 18 Sete Pecados , 18 18 Renan Calheiros , 19 18 Britney Spears , 20 17 Futebol , 21 17 RBD , 22 17 Independência do Brasil , 23 17 Leonardo da Vinci , 24 16 Universidade Comunitária da Região de Chapecó , 25 16 RedeTV! ES

out 2007: 1 39 Brasil , 2 38 Duas Caras (telenovela) , 3 26 Paraíso Tropical , 4 25 Sport Club Corinthians Paulista , 5 24 Paulo Autran , 6 24 Da Cor do Pecado , 7 22 Tropa de Elite (2007) , 8 22 São Paulo Futebol Clube , 9 21 Malhação , 10 21 São Paulo (estado) , 11 20 NX Zero , 12 20 Kimi Räikkönen , 13 20 2007 , 14 20 Portugal , 15 19 Cuba , 16 19 Vale a Pena Ver de Novo , 17 19 Copa do Mundo FIFA de 2014 , 18 19 Naruto , 19 19 Gay , 20 19 Britney Spears , 21 17 Rebelde (telenovela) , 22 17 Batalhão de Operações Policiais Especiais (PMERJ) , 23 17 Leonardo da Vinci , 24 16 Desejo Proibido , 25 16 Sete Pecados

nov 2007: 1 34 Brasil , 2 33 Duas Caras (telenovela) , 3 26 Aníbal Cavaco Silva , 4 26 Belo Horizonte , 5 25 Campeonato Brasileiro de Futebol , 6 23 Desejo Proibido , 7 22 Coração de Estudante , 8 22 Hugo Chávez , 9 22 Brasília , 10 20 Avril Lavigne , 11 20 Naruto , 12 20 Britney Spears , 13 19 Zac Efron , 14 19 2007 , 15 19 Clube Atlético Mineiro , 16 19 Índice de Desenvolvimento Humano , 17 18 Vale a Pena Ver de Novo , 18 18 Malhação , 19 17 Zumbi dos Palmares , 20 17 Esporte Clube Bahia , 21 17 Europa , 22 16 Centro Universitário Assunção , 23 16 NX Zero , 24 16 Eterna Magia , 25 16 Região Sudeste do Brasil

dez 2007: 1 39 Brasil , 2 33 Sport Club Corinthians Paulista , 3 30 Duas Caras (telenovela) , 4 25 Sete Pecados , 5 24 2007 , 6 23 Clube Atlético Mineiro , 7 20 Gay , 8 18 Malhação , 9 17 Benazir Bhutto , 10 17 Contribuição Provisória sobre Movimentação Financeira , 11 16 RBD , 12 16 Natal , 13 16 Sociedade Esportiva Palmeiras , 14 16 Club de Regatas Vasco da Gama , 15 15 Akatsuki , 16 15 Rede Globo , 17 15 Língua portuguesa , 18 15 Belo Horizonte , 19 14 Desejo Proibido , 20 14 Caminhos do Coração , 21 14 Norton Nascimento , 22 14 Naruto , 23 14 Homossexualidade , 24 14 Napoleão Bonaparte , 25 14 Cruzeiro Esporte Clube

jan 2008: 1 33 Brasil , 2 31 Sasuke Uchiha , 3 26 Duas Caras (telenovela) , 4 23 Big Brother Brasil 8 , 5 20 Rede Globo , 6 19 Sete Pecados , 7 19 Bijuu (Naruto) , 8 19 Luiz Carlos Tourinho , 9 19 Aníbal Cavaco Silva , 10 18 Sport Lisboa e Benfica , 11 18 Heath Ledger , 12 18 São Paulo Futebol Clube , 13 17 NX Zero , 14 17 Ashley Tisdale , 15 16 Desejo Proibido , 16 16 Amigas & Rivais , 17 16 Kakashi Hatake , 18 16 Avril Lavigne , 19 16 Forças Armadas Revolucionárias da Colômbia , 20 16 Naruto , 21 16 2008 , 22 16 Morangos com Açúcar , 23 16 Língua portuguesa , 24 16 Sport Club Corinthians Paulista , 25 15 Copa Dubai

fev 2008: 1 36 Brasil , 2 27 Fidel Castro , 3 25 Sasuke Uchiha , 4 25 Taijutsu (Naruto) , 5 23 Beleza Pura , 6 23 Sete Pecados , 7 22 Caminhos do Coração , 8 22 Grêmio Foot-Ball Porto Alegrense , 9 21 Duas Caras (telenovela) , 10 20 Avril Lavigne , 11 20 2008 , 12 19 Bijuu (Naruto) , 13 19 Albert Einstein , 14 18 Beto Carrero , 15 18 Rede Globo , 16 16 Queridos Amigos , 17 16 Copa Libertadores da América de 2008 , 18 16 Kakashi Hatake , 19 16 Beija-Flor (escola de samba) , 20 16 Pelé , 21 15 Mariah Carey , 22 15 Xuxa , 23 15 Carnaval , 24 15 Salvador (Bahia) , 25 14 Desejo Proibido

mar 2008: 1 37 Brasil , 2 33 Caminhos do Coração , 3 28 Duas Caras (telenovela) , 4 25 Clube Atlético Mineiro , 5 21 Taijutsu (Naruto) , 6 21 Itachi Uchiha , 7 20 NX Zero , 8 20 Portugal , 9 19 Imigração japonesa no Brasil , 10 19 Forças Armadas Revolucionárias da Colômbia , 11 19 Rede Globo , 12 18 Big Brother Brasil 8 , 13 18 Tokio Hotel , 14 18 2008 , 15 18 Argentina , 16 17 Jonas Brothers , 17 17 Miley Cyrus , 18 17 Ben 10 (desenho animado) , 19 16 Bill Kaulitz , 20 16 Salvador (Bahia) , 21 16 Mona Lisa , 22 16 Grêmio Foot-Ball Porto Alegrense , 23 16 Leonardo da Vinci , 24 16 Rússia , 25 16 Clube de Regatas do Flamengo

abr 2008: 1 53 Brasil , 2 40 Caminhos do Coração , 3 39 Caso Isabella Nardoni , 4 23 Rede Globo , 5 21 Sasuke Uchiha , 6 21 Dengue , 7 20 Beleza Pura , 8 20 Duas Caras (telenovela) , 9 20 Hannah Montana , 10 19 Miley Cyrus , 11 19 Cabocla (2004) , 12 18 Ciranda de Pedra (2008) , 13 16 Desejo Proibido , 14 16 Sócrates , 15 15 Campeonato Brasileiro de Futebol de 2008 - Série C , 16 15 Taijutsu (Naruto) , 17 15 Xuxa , 18 15 Amor , 19 15 Grêmio Foot-Ball Porto Alegrense , 20 15 1993 , 21 15 Clube de Regatas do Flamengo , 22 14 Futebol , 23 14 Kekkei Genkai , 24 14 Harry Potter , 25 14 Forças Armadas Revolucionárias da Colômbia

mai 2008: 1 35 Caminhos do Coração , 2 32 A Favorita , 3 25 Beleza Pura , 4 25 Duas Caras (telenovela) , 5 24 Caso Isabella Nardoni , 6 23 Ciranda de Pedra (2008) , 7 21 2008 , 8 20 Clube de Regatas do Flamengo , 9 18 Avril Lavigne , 10 18 Brasil , 11 17 Desejo Proibido , 12 17 Dia do Trabalhador , 13 17 Cristianismo , 14 16 Britney Spears , 15 16 Sexo , 16 15 Futebol , 17 15 Jonas Brothers , 18 15 Miley Cyrus , 19 15 Acordo Ortográfico de 1990 , 20 15 Ashley Tisdale , 21 15 Rio de Janeiro (estado) , 22 15 Linux , 23 15 Sport Club Corinthians Paulista , 24 15 Curitiba , 25 14 Os Mutantes: Caminhos do Coração

jun 2008: 1 51 A Favorita , 2 39 Os Mutantes: Caminhos do Coração , 3 35 Campeonato Europeu de Futebol de 2008 , 4 26 Caminhos do Coração , 5 23 Duas Caras (telenovela) , 6 23 Cabocla (2004) , 7 22 Beleza Pura , 8 21 Sport Club do Recife , 9 20 Ciranda de Pedra (2008) , 10 20 Rede Globo , 11 20 Voleibol , 12 20 Argentina , 13 19 Ruth Cardoso , 14 19 Festa junina , 15 19 Pantanal (telenovela) , 16 18 RecordTV , 17 17 Ashley Tisdale , 18 17 Taijutsu (Naruto) , 19 17 Britney Spears , 20 17 Brasil , 21 16 Futebol , 22 16 Basquetebol , 23 15 Malhação (15.ª temporada) , 24 15 RedeTV! , 25 15 Leonardo da Vinci

jul 2008: 1 34 Os Mutantes: Caminhos do Coração , 2 32 Dercy Gonçalves , 3 29 A Favorita , 4 26 Beleza Pura , 5 26 Clube de Regatas do Flamengo , 6 24 Jonas Brothers , 7 23 Povo dos Estados Unidos , 8 19 Ciranda de Pedra (2008) , 9 19 Chamas da Vida , 10 19 Cabocla (2004) , 11 18 Fluminense Football Club , 12 18 Britney Spears , 13 17 Campeonato Brasileiro de Futebol de 2008 - Série A , 14 17 Campeonato Brasileiro de Futebol de 2008 - Série C , 15 17 Vale a Pena Ver de Novo , 16 17 Brasil , 17 16 Gilmar Mendes , 18 16 Íngrid Betancourt , 19 15 Futebol , 20 15 Caminhos do Coração , 21 15 Pantanal (telenovela) , 22 15 Jogos Olímpicos de Verão de 2008 , 23 15 2008 , 24 15 São Paulo Futebol Clube , 25 15 Brasília

ago 2008: 1 49 Jogos Olímpicos de Verão de 2008 , 2 45 Os Mutantes: Caminhos do Coração , 3 43 A Favorita , 4 34 Jonas Brothers , 5 34 Jogos Olímpicos , 6 31 Michael Phelps , 7 28 César Cielo , 8 27 Quadro de medalhas dos Jogos Olímpicos de Verão de 2008 , 9 26 Brasil nos Jogos Olímpicos de Verão de 2008 , 10 24 Beleza Pura , 11 24 Voleibol , 12 23 Sociedade Esportiva Palmeiras , 13 23 Club de Regatas Vasco da Gama , 14 23 Brasil , 15 22 Miley Cyrus , 16 20 Três Irmãs (telenovela) , 17 20 Usain Bolt , 18 20 Britney Spears , 19 20 China (civilização) , 20 20 Clube de Regatas do Flamengo , 21 19 Rede Globo , 22 18 RBD , 23 18 Clube Atlético Mineiro , 24 18 Google , 25 18 China

set 2008: 1 40 Os Mutantes: Caminhos do Coração , 2 37 Três Irmãs (telenovela) , 3 34 A Favorita , 4 28 Grande Colisor de Hádrons , 5 24 Ciranda de Pedra (2008) , 6 24 Beleza Pura , 7 23 Clube Atlético Mineiro , 8 22 Google , 9 20 Independência do Brasil , 10 18 Club de Regatas Vasco da Gama , 11 17 Negócio da China , 12 17 Clube Atlético Paranaense , 13 17 Brasil , 14 16 Cristiano Ronaldo , 15 16 2008 , 16 16 Região Nordeste do Brasil , 17 16 Cruzeiro Esporte Clube , 18 16 Água , 19 15 Chamas da Vida , 20 15 Jonas Brothers , 21 15 NX Zero , 22 15 Paul Newman , 23 15 Machado de Assis , 24 15 Santos Futebol Clube , 25 15 Japão

out 2008: 1 36 A Favorita , 2 36 Brasil , 3 26 Negócio da China , 4 26 Três Irmãs (telenovela) , 5 26 Britney Spears , 6 23 Portugal , 7 20 Wikipédia , 8 20 Os Mutantes: Caminhos do Coração , 9 20 Jonas Brothers , 10 20 NX Zero , 11 19 Fluminense Football Club , 12 19 Clube Atlético Mineiro , 13 19 Adolf Hitler , 14 18 Ciranda de Pedra (2008) , 15 18 Selena Gomez , 16 18 Sociedade Esportiva Palmeiras , 17 17 Íris Stefanelli , 18 17 Toma Lá, Dá Cá , 19 17 2008 , 20 17 Lisboa , 21 16 Malhação (15.ª temporada) , 22 16 Cruzeiro Esporte Clube , 23 16 Brasília , 24 15 Eduardo Paes , 25 15 Rede Globo

nov 2008: 1 38 A Favorita , 2 33 Barack Obama , 3 28 Os Mutantes: Caminhos do Coração , 4 27 Britney Spears , 5 24 Club de Regatas Vasco da Gama , 6 24 Brasil , 7 22 Negócio da China , 8 20 Lewis Hamilton , 9 19 RBD , 10 19 Portugal , 11 18 2008 , 12 18 George W. Bush , 13 17 NX Zero , 14 16 Três Irmãs (telenovela) , 15 16 Fluminense Football Club , 16 15 Rua Maria Antônia , 17 15 Rihanna , 18 15 Avril Lavigne , 19 15 Sociedade Esportiva Palmeiras , 20 15 Clube de Regatas do Flamengo , 21 15 Sport Club Corinthians Paulista , 22 14 Dilma Rousseff , 23 14 Coritiba Foot Ball Club , 24 14 Minas Gerais , 25 13 Chamas da Vida

dez 2008: 1 48 A Favorita , 2 33 Grêmio Foot-Ball Porto Alegrense , 3 27 Campeonato Brasileiro de Futebol , 4 27 Club de Regatas Vasco da Gama , 5 26 Os Mutantes: Caminhos do Coração , 6 24 Sociedade Esportiva Palmeiras , 7 23 São Paulo Futebol Clube , 8 22 Rihanna , 9 21 Habbo Hotel , 10 21 Britney Spears , 11 21 Sport Club Corinthians Paulista , 12 20 Copa do Mundo de Clubes da FIFA , 13 20 Três Irmãs (telenovela) , 14 20 NX Zero , 15 20 Fluminense Football Club , 16 20 Portugal , 17 20 Brasil , 18 19 Ronaldo Nazário , 19 18 Madonna , 20 18 Clube Atlético Mineiro , 21 18 Clube de Regatas do Flamengo , 22 16 Revelação (telenovela) , 23 16 Negócio da China , 24 16 Avril Lavigne , 25 15 Chamas da Vida

jan 2009: 1 39 A Favorita , 2 30 Barack Obama , 3 29 Os Mutantes: Caminhos do Coração , 4 25 Brasil , 5 24 Caminho das Índias , 6 24 Maysa , 7 24 Clube Atlético Mineiro , 8 23 Operação Chumbo Fundido , 9 22 Sport Club Corinthians Paulista , 10 21 Copa São Paulo de Futebol Júnior de 2009 , 11 21 2009 , 12 20 Maysa: Quando Fala o Coração , 13 20 Acordo Ortográfico de 1990 , 14 20 Grêmio Foot-Ball Porto Alegrense , 15 19 Malhação (16.ª temporada) , 16 19 Cristiano Ronaldo , 17 19 São Paulo Futebol Clube , 18 18 Miley Cyrus , 19 18 Sociedade Esportiva Palmeiras , 20 18 Britney Spears , 21 18 Clube de Regatas do Flamengo , 22 17 Santos Futebol Clube , 23 17 Lisboa , 24 16 Big Brother Brasil 9 , 25 16 Ashley Tisdale

fev 2009: 1 30 Brasil , 2 24 Sport Club Corinthians Paulista , 3 23 Os Mutantes: Caminhos do Coração , 4 23 Clube Atlético Mineiro , 5 22 Senhora do Destino , 6 21 Caminho das Índias , 7 20 Sky Brasil , 8 18 NX Zero , 9 18 Lisboa , 10 16 Copa Libertadores da América de 2009 , 11 16 Chamas da Vida , 12 16 Avril Lavigne , 13 16 Sociedade Esportiva Palmeiras , 14 15 Negócio da China , 15 15 Rihanna , 16 14 Big Brother Brasil 9 , 17 14 Cesare Battisti (ativista) , 18 14 Barack Obama , 19 14 Paulínia , 20 14 Club de Regatas Vasco da Gama , 21 13 Jóhanna Sigurðardóttir , 22 13 Oscar 2009 , 23 13 Três Irmãs (telenovela) , 24 13 A Favorita , 25 13 Ashley Tisdale

mar 2009: 1 40 Clodovil Hernandes , 2 37 Ronaldo Nazário , 3 25 Mutantes: Promessas de Amor , 4 25 Big Brother Brasil 9 , 5 25 Os Mutantes: Caminhos do Coração , 6 23 Paraíso (2009) , 7 19 Sociedade Esportiva Palmeiras , 8 18 Naruto Uzumaki , 9 17 Caminho das Índias , 10 17 Acordo Ortográfico de 1990 , 11 17 Clube de Regatas do Flamengo , 12 16 Clube Atlético Mineiro , 13 16 1994 , 14 15 Caras & Bocas , 15 15 Negócio da China , 16 15 Três Irmãs (telenovela) , 17 15 Temporada de Fórmula 1 de 2009 , 18 15 Sport Club Corinthians Paulista , 19 14 Paulo Pimenta , 20 14 Natasha Richardson , 21 14 Guns N' Roses , 22 14 São Paulo Futebol Clube , 23 13 Copa do Brasil de Futebol de 2009 , 24 13 Big Brother Brasil , 25 13 Senhora do Destino

abr 2009: 1 31 Caras & Bocas , 2 29 Gripe suína , 3 27 Pandemia de gripe A de 2009 , 4 25 Ronaldo Nazário , 5 22 Caminho das Índias , 6 22 Clube de Regatas do Flamengo , 7 22 Sport Club Corinthians Paulista , 8 21 Grêmio Foot-Ball Porto Alegrense , 9 20 Susan Boyle , 10 19 Avril Lavigne , 11 18 Cruzeiro Esporte Clube , 12 17 Mutantes: Promessas de Amor , 13 17 Chamas da Vida , 14 17 Rede Globo , 15 17 Clube Atlético Mineiro , 16 16 Campeonato Brasileiro de Futebol de 2009 - Série D , 17 16 2009 , 18 16 Santos Futebol Clube , 19 16 Sociedade Esportiva Palmeiras , 20 15 Acordo Ortográfico de 1990 , 21 15 Fluminense Football Club , 22 15 Nuno Álvares Pereira , 23 15 Língua portuguesa , 24 15 Gato , 25 15 Brasil

mai 2009: 1 31 Ronaldo Nazário , 2 30 Pandemia de gripe A de 2009 , 3 30 Clube de Regatas do Flamengo , 4 29 Sport Club Corinthians Paulista , 5 25 Gripe suína , 6 25 Fluminense Football Club , 7 25 Avril Lavigne , 8 25 Grêmio Foot-Ball Porto Alegrense , 9 24 Caras & Bocas , 10 23 Copa Libertadores da América de 2009 , 11 23 Rede Globo , 12 23 Sociedade Esportiva Palmeiras , 13 23 Clube Atlético Mineiro , 14 23 Cruzeiro Esporte Clube , 15 23 São Paulo Futebol Clube , 16 20 Caminho das Índias , 17 19 Mutantes: Promessas de Amor , 18 17 Darwinius masillae , 19 17 Campeonato Brasileiro de Futebol de 2009 - Série A , 20 17 Club de Regatas Vasco da Gama , 21 17 Brasil , 22 16 BRF , 23 16 Poder Paralelo , 24 16 Campeonato Brasileiro de Futebol de 2009 - Série D , 25 15 Resultados da fase final da Copa Libertadores da América de 2009

jun 2009: 1 71 Michael Jackson , 2 64 Voo Air France 447 , 3 33 Caminho das Índias , 4 24 Cristiano Ronaldo , 5 24 Rede Globo , 6 23 Clube de Regatas do Flamengo , 7 21 Vende-se um Véu de Noiva , 8 21 A Fazenda , 9 21 Pedro Luís de Orléans e Bragança , 10 21 Real Madrid Club de Fútbol , 11 21 Sport Club Corinthians Paulista , 12 20 Festa junina , 13 20 Sociedade Esportiva Palmeiras , 14 20 São Paulo Futebol Clube , 15 19 Pandemia de gripe A de 2009 , 16 19 Seleção Brasileira de Futebol , 17 19 Senhora do Destino , 18 19 Club de Regatas Vasco da Gama , 19 18 Caras & Bocas , 20 17 Miley Cyrus , 21 17 Kaká , 22 17 Britney Spears , 23 16 Mutantes: Promessas de Amor , 24 16 Campeonato Brasileiro de Futebol , 25 15 Viver a Vida (telenovela)

jul 2009: 1 55 Michael Jackson , 2 33 Bela, a Feia , 3 31 Caras & Bocas , 4 29 Caminho das Índias , 5 25 Clube de Regatas do Flamengo , 6 24 Golpe militar em Honduras em 2009 , 7 23 Som & Fúria , 8 23 Britney Spears , 9 23 Clube Atlético Mineiro , 10 23 Cruzeiro Esporte Clube , 11 22 2009 , 12 22 São Paulo Futebol Clube , 13 22 Sport Club Corinthians Paulista , 14 21 Ronaldo Nazário , 15 19 Sasuke Uchiha , 16 19 Mutantes: Promessas de Amor , 17 19 Real Madrid Club de Fútbol , 18 18 Poder Paralelo , 19 18 Santos Futebol Clube , 20 17 Ilha dos Desafios , 21 17 Rede Globo , 22 17 Sociedade Esportiva Palmeiras , 23 16 Vende-se um Véu de Noiva , 24 16 A Fazenda , 25 16 Senhora do Destino

ago 2009: 1 39 Michael Jackson , 2 33 Bela, a Feia , 3 33 Caminho das Índias , 4 33 Brasil , 5 28 Ilha dos Desafios , 6 26 RecordTV , 7 26 Clube de Regatas do Flamengo , 8 25 Rede Globo , 9 25 Club de Regatas Vasco da Gama , 10 24 Caras & Bocas , 11 24 Sport Club Corinthians Paulista , 12 23 Viver a Vida (telenovela) , 13 23 Usain Bolt , 14 23 Grêmio Foot-Ball Porto Alegrense , 15 23 São Paulo Futebol Clube , 16 22 Alma Gêmea , 17 21 Pandemia de gripe A de 2009 no Brasil , 18 21 A Fazenda , 19 19 Senhora do Destino , 20 19 Santos Futebol Clube , 21 18 Pandemia de gripe A de 2009 , 22 18 Madonna , 23 18 Clube Atlético Mineiro , 24 17 Vende-se um Véu de Noiva , 25 17 Real Madrid Club de Fútbol

set 2009: 1 39 Viver a Vida (telenovela) , 2 39 Caminho das Índias , 3 23 Caras & Bocas , 4 22 Brasil , 5 21 Patrick Swayze , 6 21 2009 , 7 20 Britney Spears , 8 20 Sport Club Corinthians Paulista , 9 19 Grêmio Foot-Ball Porto Alegrense , 10 18 Cama de Gato (telenovela) , 11 18 Camada pré-sal , 12 18 Cruzeiro Esporte Clube , 13 17 Rede Globo , 14 16 Sasuke Uchiha , 15 16 Bela, a Feia , 16 16 Paraíso (2009) , 17 16 Cristiano Ronaldo , 18 16 Santos Futebol Clube , 19 15 Ilha dos Desafios , 20 15 Supernatural (série de televisão) , 21 15 Fluminense Football Club , 22 15 Alma Gêmea , 23 15 Andebol , 24 15 Clube Atlético Mineiro , 25 15 Albert Einstein

out 2009: 1 36 Viver a Vida (telenovela) , 2 27 Jogos Olímpicos de Verão de 2016 , 3 26 Maitê Proença , 4 26 Britney Spears , 5 24 Cama de Gato (telenovela) , 6 23 Michael Jackson , 7 22 Rede Globo , 8 21 Pânico na TV , 9 21 Brasil , 10 17 Malhação (16.ª temporada) , 11 17 Mercedes Sosa , 12 17 Clube Atlético Mineiro , 13 17 Portugal , 14 16 São Paulo Futebol Clube , 15 15 Twitter , 16 15 Windows 7 , 17 15 Jonas Brothers , 18 15 Barack Obama , 19 15 Rogério Ceni , 20 15 RecordTV , 21 14 Caras & Bocas , 22 14 Ilha dos Desafios , 23 14 Temporada de Fórmula 1 de 2010 , 24 14 Vanessa Hudgens , 25 14 Jenson Button

nov 2009: 1 32 Apagão no Brasil e Paraguai em 2009 , 2 31 Daniel Pádua , 3 27 Viver a Vida (telenovela) , 4 22 Malhação ID , 5 22 Brasil , 6 21 Lady Gaga , 7 21 Naruto , 8 20 Claude Lévi-Strauss , 9 19 Fluminense Football Club , 10 19 São Paulo Futebol Clube , 11 19 Clube de Regatas do Flamengo , 12 18 Caras & Bocas , 13 18 Temporada de Fórmula 1 de 2010 , 14 18 Selena Gomez , 15 18 RecordTV , 16 18 Britney Spears , 17 17 Análise financeira , 18 17 Copa do Mundo FIFA de 2010 , 19 17 Pânico na TV , 20 17 Club de Regatas Vasco da Gama , 21 16 Cine (banda) , 22 16 Cama de Gato (telenovela) , 23 15 Jonas Brothers , 24 15 Celso Pitta , 25 15 Rede Globo

dez 2009: 1 47 Clube de Regatas do Flamengo , 2 27 Campeonato Brasileiro de Futebol , 3 27 Club de Regatas Vasco da Gama , 4 25 Viver a Vida (telenovela) , 5 25 Leila Lopes , 6 24 Caras & Bocas , 7 24 Brittany Murphy , 8 24 Clube Atlético Mineiro , 9 24 Brasil , 10 22 Cinquentinha , 11 22 Copa do Mundo FIFA de 2010 , 12 21 Temporada de Fórmula 1 de 2010 , 13 21 RecordTV , 14 21 2010 , 15 21 São Paulo Futebol Clube , 16 20 Avatar (filme) , 17 18 Tempos Modernos (telenovela) , 18 18 Bela, a Feia , 19 18 Lombardi (locutor) , 20 18 Lady Gaga , 21 18 Supernatural (série de televisão) , 22 17 Copa do Mundo de Clubes da FIFA , 23 17 Campeonato Brasileiro de Futebol de 2009 - Série A , 24 17 Lista de títulos do Clube de Regatas do Flamengo , 25 17 Fluminense Football Club

jan 2010: 1 39 Tempos Modernos (telenovela) , 2 36 2010 , 3 34 Zilda Arns , 4 33 Clube de Regatas do Flamengo , 5 28 Partido da imprensa golpista , 6 26 Caras & Bocas , 7 26 Brasil , 8 25 Sismo do Haiti de 2010 , 9 25 Big Brother Brasil 10 , 10 25 Avatar (filme) , 11 24 Burj Khalifa , 12 23 Supernatural (série de televisão) , 13 23 Haiti , 14 23 São Paulo Futebol Clube , 15 22 Viver a Vida (telenovela) , 16 21 Cama de Gato (telenovela) , 17 20 Cristiano Ronaldo , 18 20 Rede Globo , 19 20 Sociedade Esportiva Palmeiras , 20 20 Britney Spears , 21 20 Club de Regatas Vasco da Gama , 22 20 Sport Club Corinthians Paulista , 23 19 Lady Gaga , 24 19 Santos Futebol Clube , 25 18 Copa São Paulo de Futebol Júnior de 2010

fev 2010: 1 27 Big Brother Brasil 10 , 2 26 Clube de Regatas do Flamengo , 3 24 2010 , 4 23 Viver a Vida (telenovela) , 5 22 Rede Globo , 6 22 Santos Futebol Clube , 7 21 Lady Gaga , 8 21 Sport Club Corinthians Paulista , 9 20 Sismo do Chile de 2010 , 10 20 Alma Gêmea , 11 19 Uma Rosa com Amor (2010) , 12 19 Tempos Modernos (telenovela) , 13 19 José Roberto Arruda , 14 19 Beyoncé , 15 19 RecordTV , 16 19 Sociedade Esportiva Palmeiras , 17 18 Total Drama Action , 18 17 Roberto Abbondanzieri , 19 17 Jogos Olímpicos de Inverno de 2010 , 20 17 Botafogo de Futebol e Regatas , 21 17 Cruzeiro Esporte Clube , 22 17 Luiz Inácio Lula da Silva , 23 16 Copa Libertadores da América de 2010 , 24 16 Miley Cyrus , 25 16 Britney Spears

mar 2010: 1 40 Lady Gaga , 2 25 Big Brother Brasil 10 , 3 25 Caso Isabella Nardoni , 4 24 Cama de Gato (telenovela) , 5 23 Rede Globo , 6 22 Viver a Vida (telenovela) , 7 21 Israel , 8 20 Marcelo Dourado , 9 20 Big Brother Brasil , 10 20 Luiz Inácio Lula da Silva , 11 20 Brasil , 12 19 2010 , 13 19 Club de Regatas Vasco da Gama , 14 18 Copa do Brasil de Futebol de 2010 , 15 18 Temporada de Fórmula 1 de 2010 , 16 18 Miley Cyrus , 17 17 Isa TK+ , 18 17 Kesha , 19 17 Isa TKM , 20 16 Escrito nas Estrelas (telenovela) , 21 16 Sismo do Chile de 2010 , 22 16 Sinhá Moça (2006) , 23 16 Glauco Villas Boas , 24 16 Ronaldo Nazário , 25 16 Naruto

abr 2010: 1 27 Viver a Vida (telenovela) , 2 26 Escrito nas Estrelas (telenovela) , 3 26 Rede Globo , 4 21 Naruto , 5 21 José Serra , 6 21 Campeonato Brasileiro de Futebol , 7 20 Tempos Modernos (telenovela) , 8 20 Isa TK+ , 9 20 Sport Club Corinthians Paulista , 10 19 Clube Atlético Mineiro , 11 19 Sol , 12 19 Clube de Regatas do Flamengo , 13 19 Brasil , 14 18 Cama de Gato (telenovela) , 15 18 Copa Libertadores da América de 2010 , 16 18 Lech Kaczyński , 17 18 Botafogo de Futebol e Regatas , 18 18 São Miguel Arcanjo (São Paulo) , 19 18 Portugal , 20 17 Teoria das hidroplacas , 21 17 Bela, a Feia , 22 17 Grêmio Foot-Ball Porto Alegrense , 23 17 Britney Spears , 24 16 Desastres naturais no Rio de Janeiro em abril de 2010 , 25 16 Fluminense Football Club

mai 2010: 1 43 Passione , 2 27 Ribeirão do Tempo , 3 26 Seleção Brasileira de Futebol , 4 23 Restart (banda) , 5 23 Escrito nas Estrelas (telenovela) , 6 21 Bela, a Feia , 7 21 Viver a Vida (telenovela) , 8 21 Grêmio Foot-Ball Porto Alegrense , 9 20 Santos Futebol Clube , 10 19 Tempos Modernos (telenovela) , 11 19 Brasil , 12 18 Ben 10: Supremacia Alienígena , 13 18 Cruzeiro Esporte Clube , 14 17 Wikipédia , 15 17 Futebol Clube do Porto , 16 16 Voo Afriqiyah Airways 771 , 17 16 Copa Libertadores da América de 2010 , 18 16 Ben 10: Alien Force , 19 16 Botafogo de Futebol e Regatas , 20 16 Portugal , 21 15 Ashley Tisdale , 22 15 Lionel Messi , 23 15 Naruto Uzumaki , 24 15 Naruto , 25 15 Rede Globo

jun 2010: 1 80 Copa do Mundo FIFA de 2010 , 2 31 José Saramago , 3 30 Passione , 4 23 Ataque à Flotilha da Liberdade , 5 20 Tempos Modernos (telenovela) , 6 19 Justin Bieber , 7 19 Seleção Brasileira de Futebol , 8 19 Brasil , 9 18 Vuvuzela , 10 18 Rede Globo , 11 18 Cruzeiro Esporte Clube , 12 17 Bela, a Feia , 13 17 Shakira , 14 17 Futebol Clube do Porto , 15 16 Isa TK+ , 16 16 Copa do Mundo FIFA de 2010 – Grupo A , 17 16 Kaká , 18 16 Clube Atlético Mineiro , 19 16 Clube de Regatas do Flamengo , 20 15 Ribeirão do Tempo , 21 15 Escrito nas Estrelas (telenovela) , 22 15 Copa do Mundo FIFA de 2010 – Grupo G , 23 15 Guns N' Roses , 24 14 Lady Gaga , 25 14 ICarly

jul 2010: 1 49 Copa do Mundo FIFA de 2010 , 2 37 Lady Gaga , 3 37 Seleção Brasileira de Futebol , 4 35 Ti Ti Ti (2010) , 5 30 Copa do Mundo FIFA de 2014 , 6 29 Caso Eliza Samudio , 7 28 Bruno Fernandes de Souza , 8 26 Tempos Modernos (telenovela) , 9 26 Mano Menezes , 10 23 Felipe Melo , 11 23 Clube Atlético Mineiro , 12 22 Escrito nas Estrelas (telenovela) , 13 21 João Moutinho , 14 21 Clube de Regatas do Flamengo , 15 21 Brasil , 16 19 Dunga , 17 18 Ribeirão do Tempo , 18 18 Passione , 19 18 Adidas Jabulani , 20 18 ICarly , 21 18 Futebol Clube do Porto , 22 17 Paul (polvo) , 23 17 Larissa Riquelme , 24 17 Total Drama Action , 25 17 Rede Globo

ago 2010: 1 31 Ti Ti Ti (2010) , 2 28 Portugal , 3 26 Lady Gaga , 4 24 Total Drama Action , 5 24 Brasil , 6 23 Dilma Rousseff , 7 23 José Serra , 8 22 Neymar , 9 21 Campeonato Brasileiro de Futebol de 2010 - Série A , 10 21 Clube Atlético Mineiro , 11 21 Cruzeiro Esporte Clube , 12 20 Ronaldinho Gaúcho , 13 20 Rede Globo , 14 19 Grêmio Foot-Ball Porto Alegrense , 15 18 Malhação (18.ª temporada) , 16 18 Passione , 17 18 Seleção Brasileira de Futebol , 18 18 Sport Club Corinthians Paulista , 19 17 Escrito nas Estrelas (telenovela) , 20 17 Fluminense Football Club , 21 17 Robinho , 22 16 Cine (banda) , 23 16 Felipe Garcia dos Prazeres , 24 16 Dulce María , 25 16 Santos Futebol Clube

set 2010: 1 28 Brasil , 2 25 Clube de Regatas do Flamengo , 3 22 Lady Gaga , 4 21 A Fazenda 3 , 5 21 Rede Globo , 6 21 Portugal , 7 20 Justin Bieber , 8 20 Madonna , 9 20 Clube Atlético Mineiro , 10 20 São Paulo Futebol Clube , 11 20 Sport Club Corinthians Paulista , 12 19 Araguaia (telenovela) , 13 19 Ti Ti Ti (2010) , 14 19 Escrito nas Estrelas (telenovela) , 15 18 Erenice Guerra , 16 18 Fluminense Football Club , 17 18 Grêmio Foot-Ball Porto Alegrense , 18 16 Implantação da República Portuguesa , 19 16 Independência do Brasil , 20 16 Club de Regatas Vasco da Gama , 21 14 Cine (banda) , 22 14 Campeonato Brasileiro de Futebol de 2010 - Série A , 23 14 Neymar , 24 14 Ferris Bueller's Day Off , 25 14 Lista de músicos recordistas de vendas

out 2010: 1 49 Dilma Rousseff , 2 29 José Serra , 3 24 Anahí , 4 22 Luiz Inácio Lula da Silva , 5 20 Restart (banda) , 6 20 Clube de Regatas do Flamengo , 7 19 Eleição presidencial no Brasil em 2010 , 8 19 Romeu Tuma , 9 19 Portugal , 10 18 Acidente na mina San José em 2010 , 11 18 Tropa de Elite 2: o Inimigo agora É Outro , 12 18 Cruzeiro Esporte Clube , 13 18 Brasil , 14 17 A Fazenda 3 , 15 17 2010 , 16 16 Santos Futebol Clube , 17 16 Sociedade Esportiva Palmeiras , 18 16 Club de Regatas Vasco da Gama , 19 15 Araguaia (telenovela) , 20 15 Passione , 21 15 Cristiano Ronaldo , 22 15 Mario Vargas Llosa , 23 15 Partido dos Trabalhadores , 24 15 Grêmio Foot-Ball Porto Alegrense , 25 15 Clube Atlético Mineiro

nov 2010: 1 66 Dilma Rousseff , 2 37 Luiz Inácio Lula da Silva , 3 33 Brasil , 4 27 Atos de violência organizada no Rio de Janeiro em 2010 , 5 20 Katy Perry , 6 20 Clube de Regatas do Flamengo , 7 19 Clube Atlético Mineiro , 8 17 Restart (banda) , 9 17 Leslie Nielsen , 10 17 Fluminense Football Club , 11 17 Madonna , 12 17 Botafogo de Futebol e Regatas , 13 17 Esporte Clube Bahia , 14 16 Lista de presidentes do Brasil , 15 16 Michael Jackson , 16 15 Kesha , 17 15 Rede Globo , 18 15 2010 , 19 15 Portugal , 20 15 Sport Club Corinthians Paulista , 21 14 Lista de episódios de iCarly , 22 14 Cher , 23 14 Seleção Brasileira de Futebol , 24 14 Futebol Clube do Porto , 25 14 Cão

dez 2010: 1 47 Campeonato Brasileiro de Futebol , 2 44 Fluminense Football Club , 3 33 Santos Futebol Clube , 4 29 Grêmio Foot-Ball Porto Alegrense , 5 28 Clube Atlético Mineiro , 6 27 Sport Club Corinthians Paulista , 7 26 Clube de Regatas do Flamengo , 8 25 Campeonato Brasileiro de Futebol de 2010 - Série A , 9 25 Copa do Mundo de Clubes da FIFA de 2010 , 10 24 Sociedade Esportiva Palmeiras , 11 24 Club de Regatas Vasco da Gama , 12 22 São Paulo Futebol Clube , 13 20 Justin Bieber , 14 20 Lady Gaga , 15 20 WikiLeaks , 16 19 Cyndi Lauper , 17 19 Cruzeiro Esporte Clube , 18 18 Rede Globo , 19 18 Portugal , 20 17 Julian Assange , 21 17 Anahí , 22 17 Dilma Rousseff , 23 16 Tout Puissant Mazembe , 24 16 Homossexualidade , 25 16 Bon Jovi

jan 2011: 1 60 Dilma Rousseff , 2 42 Ronaldinho Gaúcho , 3 29 Enchentes e deslizamentos de terra no Rio de Janeiro em 2011 , 4 29 Big Brother Brasil 11 , 5 27 Copa São Paulo de Futebol Júnior de 2011 , 6 26 Campeonato Brasileiro de Futebol , 7 25 Grêmio Foot-Ball Porto Alegrense , 8 25 Cruzeiro Esporte Clube , 9 25 Luiz Inácio Lula da Silva , 10 24 Passione , 11 24 Santos Futebol Clube , 12 24 Brasil , 13 23 Lionel Messi , 14 23 Fluminense Football Club , 15 23 Club de Regatas Vasco da Gama , 16 22 Cristiano Ronaldo , 17 22 2011 , 18 22 Portugal , 19 22 Clube de Regatas do Flamengo , 20 21 Hold It Against Me , 21 21 Clube Atlético Mineiro , 22 20 Insensato Coração , 23 20 ICarly , 24 20 Thiago Neves , 25 20 Sport Club Corinthians Paulista

fev 2011: 1 37 Grêmio Foot-Ball Porto Alegrense , 2 30 Ronaldo Nazário , 3 25 Hosni Mubarak , 4 24 Big Brother Brasil 11 , 5 24 Ronaldinho Gaúcho , 6 24 Clube de Regatas do Flamengo , 7 23 Justin Bieber , 8 23 Sport Club Corinthians Paulista , 9 22 Revolução Egípcia de 2011 , 10 22 Liédson , 11 20 Femme Fatale (álbum) , 12 20 RecordTV , 13 20 Campeonato Brasileiro de Futebol , 14 19 Lady Gaga , 15 19 Fluminense Football Club , 16 19 Santos Futebol Clube , 17 19 Club de Regatas Vasco da Gama , 18 18 Egito , 19 18 Rogério Ceni , 20 17 Free step , 21 16 Born This Way (canção) , 22 16 Copa União , 23 16 Katy Perry , 24 16 ICarly , 25 16 Anahí

mar 2011: 1 34 Sismo e tsunami de Tohoku de 2011 , 2 28 Big Brother Brasil 11 , 3 26 José Alencar , 4 25 Britney Spears , 5 22 Rebelde (telenovela brasileira) , 6 22 Fluminense Football Club , 7 21 Elizabeth Taylor , 8 21 2011 , 9 20 Selena Gomez , 10 20 Sport Club Corinthians Paulista , 11 19 Ti Ti Ti (2010) , 12 19 ICarly , 13 19 Adriano Leite Ribeiro , 14 19 Líbia , 15 18 Rebecca Black , 16 18 Manu Gavassi , 17 17 Sistema operativo , 18 17 Portugal , 19 16 Wikipédia , 20 16 Guerra Civil Líbia (2011) , 21 16 Araguaia (telenovela) , 22 16 Everybody Hates Chris , 23 16 Botafogo de Futebol e Regatas , 24 16 Pré-história , 25 15 Femme Fatale (álbum)

abr 2011: 1 52 Massacre de Realengo , 2 25 Banda colorida , 3 25 Britney Spears , 4 23 Kate Middleton , 5 21 Cordel Encantado , 6 20 Espiritismo (termo) , 7 20 Portugal , 8 19 Fluminense Football Club , 9 18 Born This Way (canção) , 10 18 Copa Libertadores da América de 2011 , 11 18 Copa do Brasil de Futebol de 2011 , 12 18 Neonazismo , 13 17 Amor e Revolução , 14 17 Campeonato Paulista de Futebol de 2011 - Série A1 , 15 17 Chico Xavier , 16 16 Rebelde (telenovela brasileira) , 17 16 ICarly , 18 16 Páscoa , 19 16 Futebol Clube do Porto , 20 16 Grêmio Foot-Ball Porto Alegrense , 21 16 Brasil , 22 16 Ateísmo , 23 15 Veganismo , 24 15 Monteiro Lobato , 25 15 Santos Futebol Clube

mai 2011: 1 57 Osama bin Laden , 2 51 Morte de Osama bin Laden , 3 22 Lionel Messi , 4 20 Grêmio Foot-Ball Porto Alegrense , 5 20 Brasil , 6 19 Ezequiel Miralles , 7 19 Fluminense Football Club , 8 19 Coritiba Foot Ball Club , 9 19 Clube Atlético Mineiro , 10 19 Sport Club Corinthians Paulista , 11 18 Neymar , 12 18 Yahoo! Respostas , 13 18 Botafogo de Futebol e Regatas , 14 18 Portugal , 15 17 Born This Way , 16 17 Santos Futebol Clube , 17 17 Club de Regatas Vasco da Gama , 18 16 Protestos de 2011 na Espanha , 19 16 Copa do Brasil de Futebol de 2011 , 20 16 Ronaldinho Gaúcho , 21 16 2011 , 22 15 Insensato Coração , 23 15 Futebol Clube do Porto , 24 14 Casamento de Guilherme de Gales e Catarina Middleton , 25 14 Campeonato Brasileiro de Futebol de 2011 - Série D

jun 2011: 1 28 Angélico Vieira , 2 25 Santos Futebol Clube , 3 23 Pedro Passos Coelho , 4 21 Club de Regatas Vasco da Gama , 5 18 Copa do Brasil de Futebol de 2011 , 6 17 Fluminense Football Club , 7 17 Ronaldinho Gaúcho , 8 16 Neymar , 9 16 2011 , 10 16 Sporting Clube de Portugal , 11 16 Clube Atlético Paranaense , 12 16 Portugal , 13 15 Gleisi Hoffmann , 14 15 José Sócrates , 15 14 Mortes em junho de 2011 , 16 14 Eleições legislativas portuguesas de 2011 , 17 14 Lucas Rodrigues Moura da Silva , 18 14 Miranda Cosgrove , 19 14 Antonio Palocci , 20 14 Seleção Brasileira de Futebol , 21 14 Botafogo de Futebol e Regatas , 22 14 Chocolate , 23 14 Sport Club Corinthians Paulista , 24 13 Insensato Coração , 25 13 André Villas-Boas

jul 2011: 1 52 Amy Winehouse , 2 32 Sudão do Sul , 3 31 O Astro (2011) , 4 28 Itamar Franco , 5 26 Copa América de 2011 , 6 24 Atentados de 22 de julho de 2011 na Noruega , 7 22 Santos Futebol Clube , 8 21 Neymar , 9 21 Fluminense Football Club , 10 21 Seleção Brasileira de Futebol , 11 20 Harry Potter and the Deathly Hallows – Part 2 , 12 20 Born This Way , 13 19 Portugal , 14 18 Alejandro Martinuccio , 15 18 Clube Atlético Paranaense , 16 17 A Fazenda 4 , 17 17 Campeonato Brasileiro de Futebol de 2011 - Série A , 18 17 Sporting Clube de Portugal , 19 16 Harry Potter , 20 16 Pelé , 21 15 Total Drama World Tour , 22 15 Copa do Mundo de Futebol Feminino de 2011 , 23 15 Darío Conca , 24 15 2011 , 25 15 Grêmio Foot-Ball Porto Alegrense

ago 2011: 1 30 Ronaldinho Gaúcho , 2 28 Fina Estampa , 3 27 Tumultos na Inglaterra em 2011 , 4 21 Hiperconjugação , 5 18 Copa do Mundo FIFA Sub-20 de 2011 , 6 18 Fluminense Football Club , 7 18 Sociedade Esportiva Palmeiras , 8 17 O Astro (2011) , 9 17 Insensato Coração , 10 17 Dilma Rousseff , 11 16 Wikipédia , 12 16 Santos Futebol Clube , 13 16 Grêmio Foot-Ball Porto Alegrense , 14 16 Club de Regatas Vasco da Gama , 15 15 Pro Evolution Soccer 2012 , 16 15 A Fazenda 4 , 17 15 Malhação (18.ª temporada) , 18 15 São Paulo Futebol Clube , 19 15 Folclore , 20 14 UFC 134 , 21 14 Elenco de Insensato Coração , 22 14 Harry Potter and the Deathly Hallows – Part 2 , 23 14 El Chavo del Ocho , 24 14 Futebol Clube do Porto , 25 14 Portugal

set 2011: 1 27 Leila Lopes (Miss Universo) , 2 23 A Vida da Gente , 3 23 Fina Estampa , 4 21 Rock in Rio , 5 17 Miss Universo 2011 , 6 17 Ataques de 11 de setembro de 2001 , 7 16 São Paulo Futebol Clube , 8 16 Evolução , 9 15 Campeonato Brasileiro de Futebol de 2011 - Série C , 10 15 Leandro Damião , 11 15 Campeonato Brasileiro de Futebol de 2011 - Série A , 12 14 Seleção Brasileira de Futebol , 13 14 África , 14 13 Lua Blanco , 15 13 Paula Fernandes , 16 13 Neymar , 17 13 Superclássico das Américas , 18 13 2011 , 19 13 Santos Futebol Clube , 20 13 Club de Regatas Vasco da Gama , 21 13 Brasil , 22 12 Malhação Conectados , 23 12 Glee , 24 12 Mulheres de Areia (1993) , 25 12 Luana Piovani

out 2011: 1 28 Steve Jobs , 2 26 Jogos Pan-Americanos de 2011 , 3 24 Neymar , 4 23 Muammar al-Gaddafi , 5 22 Aquele Beijo , 6 20 Rock in Rio , 7 18 Rebelde (telenovela brasileira) , 8 18 Fina Estampa , 9 18 Club de Regatas Vasco da Gama , 10 16 Fluminense Football Club , 11 15 Quadro de medalhas dos Jogos Pan-Americanos de 2011 , 12 15 Lua Blanco , 13 15 Brasil , 14 14 Campeonato Brasileiro de Futebol de 2011 - Série A , 15 14 Copa do Mundo FIFA de 2014 , 16 14 2011 , 17 13 A Vida da Gente , 18 13 O Astro (2011) , 19 13 Born This Way , 20 13 Teleton (Brasil) , 21 13 Ultimate Fighting Championship , 22 13 Mariah Carey , 23 12 Brasil nos Jogos Pan-Americanos de 2011 , 24 12 Justin Bieber , 25 12 Lady Gaga

nov 2011: 1 16 Campeonato Brasileiro de Futebol de 2011 - Série A , 2 16 Brasil , 3 15 Beyoncé , 4 14 Neymar , 5 13 Gusttavo Lima , 6 13 Grand Theft Auto V , 7 13 Talk That Talk , 8 13 Copa Libertadores da América de 2012 , 9 13 Lua Blanco , 10 13 Fina Estampa , 11 13 Glee , 12 13 Via Embratel , 13 13 Fluminense Football Club , 14 13 Santos Futebol Clube , 15 13 Belém (Pará) , 16 12 Rebeldes (álbum) , 17 12 Aquele Beijo , 18 12 Campeonato Brasileiro de Futebol de 2011 - Série C , 19 12 Muammar al-Gaddafi , 20 12 Dilma Rousseff , 21 12 Associação Portuguesa de Desportos , 22 11 Mel Fronckowiak , 23 11 Bruno Mars , 24 11 Disney Channel (Brasil) , 25 11 Ultimate Fighting Championship

dez 2011: 1 29 A Privataria Tucana , 2 24 Santos Futebol Clube , 3 23 Sport Club Corinthians Paulista , 4 22 Copa do Mundo de Clubes da FIFA de 2011 , 5 22 Campeonato Brasileiro de Futebol de 2011 - Série A , 6 22 Sócrates (futebolista) , 7 20 Copa Libertadores da América de 2012 , 8 20 Clube Atlético Paranaense , 9 18 Mortes em dezembro de 2011 , 10 17 Fina Estampa , 11 17 Club de Regatas Vasco da Gama , 12 17 Portugal , 13 16 Silvio Santos , 14 15 Fluminense Football Club , 15 15 Cesária Évora , 16 15 Grêmio Foot-Ball Porto Alegrense , 17 15 Campeonato Brasileiro de Futebol , 18 15 Brasil , 19 14 Canal OFF , 20 14 Copa do Brasil de Futebol de 2012 , 21 14 Neymar , 22 14 Botafogo de Futebol e Regatas , 23 14 Vasco da Gama , 24 14 São Paulo Futebol Clube , 25 13 Copa do Mundo de Clubes da FIFA

jan 2012: 1 26 Stop Online Piracy Act , 2 24 Fluminense Football Club , 3 24 Santos Futebol Clube , 4 23 Copa São Paulo de Futebol Júnior de 2012 , 5 23 Club de Regatas Vasco da Gama , 6 22 Big Brother Brasil 12 , 7 22 Ai, se Eu Te Pego , 8 22 Osvaldo Filho , 9 21 Sport Club Corinthians Paulista , 10 20 Lionel Messi , 11 20 Vágner Love , 12 19 São Paulo Futebol Clube , 13 18 Protesto contra SOPA e PIPA , 14 18 Costa Concordia , 15 18 Megaupload , 16 17 Jesús Dátolo , 17 17 Thiago Neves , 18 17 Sociedade Esportiva Palmeiras , 19 16 Beyoncé , 20 16 Grêmio Foot-Ball Porto Alegrense , 21 15 Naufrágio do Costa Concordia , 22 15 O Brado Retumbante , 23 15 Clube Atlético Paranaense , 24 15 Brasil , 25 14 Michel Teló

fev 2012: 1 41 Whitney Houston , 2 23 Wando , 3 21 As Brasileiras , 4 18 Vanderlei Luxemburgo , 5 17 Coritiba Foot Ball Club , 6 16 Mortes em fevereiro de 2012 , 7 16 Amor Eterno Amor , 8 16 Seleção Brasileira de Futebol , 9 16 Software livre , 10 15 Adele , 11 15 Pânico na TV , 12 14 Big Brother Brasil 12 , 13 14 Taça Guanabara de 2012 , 14 14 A Vida da Gente , 15 14 Copa Libertadores da América de 2012 , 16 14 Hernán Barcos , 17 14 Via Embratel , 18 14 Vágner Love , 19 14 Grêmio Foot-Ball Porto Alegrense , 20 14 Club de Regatas Vasco da Gama , 21 13 O Artista , 22 13 Resultados do Carnaval do Rio de Janeiro em 2012 , 23 12 Fina Estampa , 24 12 Joel Santana , 25 12 Diagrama de Venn

mar 2012: 1 36 Avenida Brasil (telenovela) , 2 34 Chico Anysio , 3 22 Big Brother Brasil 12 , 4 20 Santos Futebol Clube , 5 19 Fina Estampa , 6 18 Millôr Fernandes , 7 17 Copa Libertadores da América de 2012 , 8 15 Claro TV (Brasil) , 9 15 Francisco Xavier do Amaral , 10 15 Brasil , 11 14 Amor Eterno Amor , 12 14 Rebelde (telenovela brasileira) , 13 14 Adriano Leite Ribeiro , 14 14 Pânico na TV , 15 14 Club de Regatas Vasco da Gama , 16 13 Mortes em março de 2012 , 17 13 Vladimir Putin , 18 13 Cruzeiro Esporte Clube , 19 12 Pânico na Band , 20 12 MDNA , 21 12 Lionel Messi , 22 12 Sociedade Esportiva Palmeiras , 23 12 Fortaleza Esporte Clube , 24 11 Método de ensino , 25 11 Copa do Brasil de Futebol de 2012

abr 2012: 1 27 Itarana , 2 24 Cheias de Charme , 3 22 Santos Futebol Clube , 4 19 Copa Libertadores da América de 2012 , 5 18 Pânico na Band , 6 17 MDNA , 7 17 Campeonato Paulista de Futebol de 2012 - Série A1 , 8 16 Rebelde (telenovela brasileira) , 9 15 Gideon Sundbäck , 10 15 MTV Brasil , 11 15 Associação Portuguesa de Desportos , 12 14 Marvel's The Avengers , 13 14 Fluminense Football Club , 14 14 Pânico na TV , 15 14 Esporte Clube Vitória , 16 14 Hacker , 17 13 Reintegração de posse na USP em 2011 , 18 13 Quarta cúpula do BRICS , 19 13 Avenida Brasil (telenovela) , 20 13 Lista de episódios de Julie e os Fantasmas , 21 13 Drama Total: A Vingança da Ilha , 22 13 Lionel Messi , 23 13 Anencefalia , 24 13 Albert Einstein , 25 12 Mortes em abril de 2012

mai 2012: 1 29 Carrossel (telenovela) , 2 25 Copa Libertadores da América de 2012 , 3 24 Campeonato Brasileiro de Futebol de 2012 - Série A , 4 22 Marvel's The Avengers , 5 21 François Hollande , 6 20 Sport Club Corinthians Paulista , 7 19 Campeonato Brasileiro de Futebol de 2012 - Série D , 8 19 Rede Globo , 9 18 Santos Futebol Clube , 10 17 Botafogo de Futebol e Regatas , 11 16 Lista de canções em Glee , 12 16 Club de Regatas Vasco da Gama , 13 15 As Brasileiras , 14 15 Avenida Brasil (telenovela) , 15 15 One Direction , 16 15 Campeonato Brasileiro de Futebol de 2012 - Série B , 17 15 Campeonato Brasileiro de Futebol de 2012 - Série C , 18 15 Copa do Brasil de Futebol de 2012 , 19 15 Fluminense Football Club , 20 15 Robin Gibb , 21 15 Donna Summer , 22 14 O Grito , 23 14 Chelsea Football Club , 24 14 Campeonato Brasileiro de Futebol , 25 13 ICarly (6.ª temporada)

jun 2012: 1 37 Campeonato Europeu de Futebol de 2012 , 2 21 Rio+20 , 3 20 Destituição de Fernando Lugo , 4 19 Romarinho , 5 19 Avenida Brasil (telenovela) , 6 19 Campeonato Brasileiro de Futebol de 2012 - Série A , 7 19 Campeonato Brasileiro de Futebol , 8 18 Clarence Seedorf , 9 18 Alan Turing , 10 17 A Fazenda 5 , 11 17 Ronaldinho Gaúcho , 12 16 Santos Futebol Clube , 13 16 Brasil , 14 15 Cheias de Charme , 15 15 Máscaras (telenovela) , 16 15 Luciana Abreu , 17 13 Mohamed Morsi , 18 13 Mortes em junho de 2012 , 19 13 Gloob , 20 13 Copa Libertadores da América de 2012 , 21 13 Mario Balotelli , 22 13 Fernando Lugo , 23 13 Johnny Depp , 24 13 Grêmio Foot-Ball Porto Alegrense , 25 13 Mercado Comum do Sul

jul 2012: 1 33 Sport Club Corinthians Paulista , 2 25 Sociedade Esportiva Palmeiras , 3 24 Avenida Brasil (telenovela) , 4 23 Campeonato Brasileiro de Futebol de 2012 - Série A , 5 23 Fluminense Football Club , 6 22 Esporte Clube Bahia , 7 21 Cheias de Charme , 8 21 Jogos Olímpicos de Verão de 2012 , 9 20 Grêmio Foot-Ball Porto Alegrense , 10 19 Zlatan Ibrahimović , 11 18 Campeonato Brasileiro de Futebol de 2012 - Série C , 12 18 Sebastián Abreu , 13 18 Copa Libertadores da América , 14 17 Emerson Sheik , 15 16 Campeonato Europeu de Futebol de 2012 , 16 15 Romarinho , 17 15 Anderson Silva , 18 15 Gilmar Mendes , 19 15 Mariah Carey , 20 15 Liédson , 21 15 Club de Regatas Vasco da Gama , 22 15 Televisão , 23 15 Clube de Regatas do Flamengo , 24 14 O Maior Brasileiro de Todos os Tempos , 25 14 ICarly (6.ª temporada)

ago 2012: 1 21 Malhação: Intensa como a Vida , 2 21 A Fazenda 5 , 3 21 Brasil nos Jogos Olímpicos de Verão de 2012 , 4 20 Jogos Olímpicos de Verão de 2012 , 5 20 Sport Club Corinthians Paulista , 6 17 Avenida Brasil (telenovela) , 7 17 Campeonato Brasileiro de Futebol de 2012 - Série A , 8 17 Michael Phelps , 9 17 Seleção Brasileira de Futebol , 10 16 Futebol nos Jogos Olímpicos de Verão de 2012 - Masculino , 11 15 Carrossel (telenovela) , 12 15 Celso Russomanno , 13 15 Portugal , 14 14 Quadro de medalhas dos Jogos Olímpicos de Verão de 2012 , 15 14 Arthur Aguiar , 16 14 Cheias de Charme , 17 14 Copa Sul-Americana de 2012 , 18 13 Mortes em agosto de 2012 , 19 13 Mars Science Laboratory , 20 13 Lucas Rodrigues Moura da Silva , 21 13 Taylor Swift , 22 13 Paris Saint-Germain Football Club , 23 13 Maria Montessori , 24 13 Folclore , 25 13 Brasil

set 2012: 1 25 Hebe Camargo , 2 18 Lado a Lado , 3 17 Cheias de Charme , 4 16 Guerra dos Sexos (2012) , 5 15 Gangnam Style , 6 15 Celso Russomanno , 7 15 Seleção Brasileira de Futebol , 8 14 ConeCrewDiretoria , 9 14 Hulk (futebolista) , 10 13 Balacobaco (telenovela) , 11 13 ICarly (6.ª temporada) , 12 13 Glee , 13 13 Jogos Paralímpicos de Verão de 2012 , 14 13 Sport Club Corinthians Paulista , 15 12 The Voice Brasil (1.ª temporada) , 16 12 Mortes em setembro de 2012 , 17 12 Carly Rae Jepsen , 18 12 A Fazenda 5 , 19 12 IPhone 5 , 20 12 Michael Clarke Duncan , 21 12 María la del Barrio , 22 12 Latino (cantor) , 23 12 Botafogo de Futebol e Regatas , 24 12 Santos Futebol Clube , 25 12 Ilhas Malvinas

out 2012: 1 49 Avenida Brasil (telenovela) , 2 31 Salve Jorge , 3 25 Guerra dos Sexos (2012) , 4 18 Furacão Sandy (2012) , 5 17 Lady Gaga , 6 17 Lionel Messi , 7 17 Eric Hobsbawm , 8 16 Anderson Silva , 9 16 Fernando Haddad , 10 16 Hebe Camargo , 11 15 Cheias de Charme , 12 15 Neymar , 13 14 Felix Baumgartner , 14 14 ICarly (7.ª temporada) , 15 14 Gangnam Style , 16 14 Alexsandro de Souza , 17 14 Fluminense Football Club , 18 13 Miley Cyrus , 19 13 Luís Fabiano , 20 13 Sporting Clube de Portugal , 21 12 Lado a Lado , 22 12 Elenco de Avenida Brasil (telenovela) , 23 12 Windows 8 , 24 12 José Paulo Bezerra Maciel Junior , 25 12 Sport Club Corinthians Paulista

nov 2012: 1 21 Neymar , 2 20 Campeonato Brasileiro de Futebol de 2013 - Série A , 3 20 Copa do Brasil de Futebol de 2013 , 4 19 Fazenda de Verão , 5 19 Campeonato Brasileiro de Futebol de 2012 - Série A , 6 18 Marcos Paulo , 7 16 Linux Educacional , 8 16 Seleção Brasileira de Futebol , 9 15 Copa do Mundo de Futsal de 2012 , 10 15 Copa Libertadores da América de 2013 , 11 15 Avenged Sevenfold , 12 15 Campeonato Brasileiro de Futebol , 13 15 Brasil , 14 14 Copa Sul-Americana de 2012 , 15 14 Copa do Mundo de Clubes da FIFA de 2012 , 16 14 Pedro Passos Coelho , 17 14 Roberto Carlos , 18 13 Secret Story - Casa dos Segredos (3.ª edição) , 19 13 Salve Jorge , 20 13 Call of Duty: Black Ops II , 21 13 Campeonato Brasileiro de Futebol de 2013 - Série C , 22 13 Campeonato Brasileiro de Futebol de 2013 - Série B , 23 13 Avenida Brasil (telenovela) , 24 13 Sport Club Corinthians Paulista , 25 12 Mortes em novembro de 2012

dez 2012: 1 32 Oscar Niemeyer , 2 29 Sport Club Corinthians Paulista , 3 28 Copa do Mundo de Clubes da FIFA de 2012 , 4 27 Arena do Grêmio , 5 23 Copa do Mundo de Clubes da FIFA , 6 21 Salve Jorge , 7 21 Copa Libertadores da América de 2013 , 8 21 Copa do Brasil de Futebol de 2013 , 9 20 Campeonato Brasileiro de Futebol de 2013 - Série A , 10 19 Avenida Brasil (telenovela) , 11 19 São Paulo Futebol Clube , 12 18 Copa Sul-Americana de 2012 , 13 18 Club de Regatas Vasco da Gama , 14 17 Fluminense Football Club , 15 16 Neymar , 16 15 Fenômeno 2012 , 17 15 Back to Black , 18 15 Fernando Prass , 19 15 Copa Sul-Americana , 20 15 Natal , 21 15 Recife , 22 14 Lucas Rodrigues Moura da Silva , 23 14 Copa das Confederações FIFA de 2013 , 24 14 La usurpadora , 25 14 Madonna

jan 2013: 1 55 Incêndio na boate Kiss , 2 27 Big Brother Brasil 13 , 3 26 Sport Club Corinthians Paulista , 4 20 Malhação: Intensa como a Vida , 5 20 Salve Jorge , 6 19 Copa São Paulo de Futebol Júnior de 2013 , 7 19 Avenida Brasil (telenovela) , 8 17 O Canto da Sereia (minissérie) , 9 16 Copa Libertadores da América de 2013 , 10 16 Guerra dos Sexos (2012) , 11 16 Club de Regatas Vasco da Gama , 12 15 Lado a Lado , 13 15 Copa do Brasil de Futebol de 2013 , 14 15 Edir Macedo , 15 14 Aaron Swartz , 16 14 Copa do Nordeste de Futebol de 2013 , 17 14 Raio (meteorologia) , 18 14 Clube Atlético Paranaense , 19 13 Demi Lovato , 20 13 Taylor Swift , 21 13 Avenged Sevenfold , 22 13 2013 , 23 13 Islândia , 24 12 Cheias de Charme , 25 12 Anderson Vital da Silva

fev 2013: 1 30 Papa Bento XVI , 2 26 Incêndio na boate Kiss , 3 18 Salve Jorge , 4 18 Copa Libertadores da América de 2013 , 5 17 2013 , 6 16 Meteoro de Cheliabinsk , 7 16 Copa do Brasil de Futebol de 2013 , 8 16 Central Nacional de Televisão , 9 16 Hernán Barcos , 10 15 Big Brother Brasil 13 , 11 15 PlayStation 4 , 12 13 Lado a Lado , 13 13 Paulo Henrique Ganso , 14 13 Marcelo Moreno , 15 13 Unidos de Vila Isabel , 16 13 Seleção Brasileira de Futebol , 17 13 Futebol Clube do Porto , 18 12 Naldo Benny , 19 12 Larissa Manoela , 20 12 Taylor Swift , 21 12 Clube Atlético Paranaense , 22 12 Sistema Solar , 23 11 Flor do Caribe , 24 11 Pânico na Band , 25 11 Guerra dos Sexos (2012)

mar 2013: 1 88 Papa Francisco , 2 49 Hugo Chávez , 3 30 Chorão (cantor) , 4 28 Big Brother Brasil 13 , 5 28 Charlie Brown Jr. , 6 24 Papa Bento XVI , 7 23 Lista de Papas , 8 23 Papa , 9 21 Marco Feliciano , 10 21 Copa do Brasil de Futebol de 2013 , 11 20 Salve Jorge , 12 20 Madonna , 13 16 Big Brother Brasil , 14 16 2013 , 15 15 Emílio Santiago , 16 15 Porto Alegre , 17 14 Flor do Caribe , 18 14 Copa do Nordeste de Futebol de 2013 , 19 14 Lado a Lado , 20 14 Avenida Brasil (telenovela) , 21 14 Gareth Bale , 22 14 Anderson Silva , 23 14 Clube de Regatas do Flamengo , 24 13 Heart Attack , 25 13 Conclave de 2013

abr 2013: 1 29 Copa do Brasil de Futebol de 2013 , 2 28 Atentado à Maratona de Boston de 2013 , 3 27 Sangue Bom , 4 22 Copa Libertadores da América de 2013 , 5 21 Papa Francisco , 6 20 Margaret Thatcher , 7 19 Anderson Vital da Silva , 8 18 Clube de Regatas do Flamengo , 9 17 Esporte Clube Bahia , 10 17 Sport Club Corinthians Paulista , 11 16 Nicolás Maduro , 12 16 Kristen Stewart , 13 16 Pré-história , 14 15 Wikipédia , 15 15 Coreia do Norte , 16 15 Filosofia , 17 14 Malhação: Intensa como a Vida , 18 14 Guerra dos Sexos (2012) , 19 14 Seleção Brasileira de Futebol , 20 13 Marco Feliciano , 21 13 Neymar , 22 13 Taylor Swift , 23 13 Fluminense Football Club , 24 13 Charlie Brown Jr. , 25 13 Rede Globo

mai 2013: 1 35 Amor à Vida , 2 27 Copa do Brasil de Futebol de 2013 , 3 27 Neymar , 4 24 Sangue Bom , 5 24 Salve Jorge , 6 24 Copa das Confederações FIFA de 2013 , 7 21 Campeonato Brasileiro de Futebol de 2013 - Série A , 8 20 Sport Lisboa e Benfica , 9 20 Cruzeiro Esporte Clube , 10 19 Anitta , 11 19 Copa Libertadores da América de 2013 , 12 19 Mia Couto , 13 18 Clube Atlético Paranaense , 14 17 Marco Feliciano , 15 17 Avenida Brasil (telenovela) , 16 17 Fluminense Football Club , 17 16 Campeonato Brasileiro de Futebol de 2013 - Série D , 18 16 Campeonato Paulista de Futebol de 2013 - Série A1 , 19 16 Fußball-Club Bayern München , 20 16 Esporte Clube Bahia , 21 16 Grêmio Foot-Ball Porto Alegrense , 22 16 Club de Regatas Vasco da Gama , 23 16 Sport Club Corinthians Paulista , 24 15 Campeonato Brasileiro de Futebol de 2013 - Série B , 25 14 Xbox One

jun 2013: 1 141 Protestos no Brasil em 2013 , 2 52 Copa das Confederações FIFA de 2013 , 3 45 Cidades participantes dos protestos no Brasil em 2013 , 4 30 Amor à Vida , 5 24 Sangue Bom , 6 23 Seleção Brasileira de Futebol , 7 21 Anitta , 8 20 Saramandaia (2013) , 9 20 Campeonato Brasileiro de Futebol de 2013 - Série A , 10 19 Protestos contra o aumento da passagem de ônibus no Brasil em 2013 , 11 19 Avenida Brasil (telenovela) , 12 19 PlayStation 4 , 13 19 Neymar , 14 19 Movimento Passe Livre , 15 17 PEC 37 , 16 17 Copa do Mundo FIFA de 2014 , 17 16 Seleção Taitiana de Futebol , 18 16 Real Madrid Club de Fútbol , 19 15 Xbox One , 20 15 Carrossel (telenovela) , 21 15 Esporte Clube Bahia , 22 14 A Fazenda 6 , 23 14 Marco Feliciano , 24 14 Anderson Silva , 25 14 Avenged Sevenfold

jul 2013: 1 29 Protestos no Brasil em 2013 , 2 29 Cruzeiro Esporte Clube , 3 26 MC Daleste , 4 22 Anderson Silva , 5 21 A Fazenda 6 , 6 21 Sangue Bom , 7 20 Chiquititas (2013) , 8 20 Cory Monteith , 9 20 Kristen Stewart , 10 19 Amor à Vida , 11 19 Copa do Brasil de Futebol de 2013 , 12 19 Copa das Confederações FIFA de 2013 , 13 18 Copa Libertadores da América de 2013 , 14 18 Clube Atlético Mineiro , 15 17 Jorge de Cambridge , 16 17 Avenida Brasil (telenovela) , 17 16 Anitta , 18 16 Malhação Casa Cheia , 19 16 Final da Copa Libertadores da América de 2013 , 20 16 Copa Sul-Americana de 2013 , 21 16 Alexandre Pato , 22 16 Association Sportive de Monaco Football Club , 23 16 Kaká , 24 15 Maiquel Falcão , 25 15 Cobras & Lagartos

ago 2013: 1 18 Copa Sul-Americana de 2013 , 2 16 O Cravo e a Rosa , 3 15 Sangue Bom , 4 14 Gareth Bale , 5 13 Roar , 6 13 Amor à Vida , 7 13 Copa do Brasil de Futebol de 2013 , 8 13 Jesús Dátolo , 9 13 Cannabis (psicotrópico) , 10 12 Isabel dos Santos , 11 12 Eusébio Cup , 12 12 Avenged Sevenfold , 13 12 Esporte Clube Bahia , 14 12 Grêmio Foot-Ball Porto Alegrense , 15 11 Edward Snowden , 16 11 Victor Vinícius Coelho dos Santos , 17 11 One Direction , 18 11 Carrossel (telenovela) , 19 11 Ronaldinho Gaúcho , 20 11 Campeonato Brasileiro de Futebol , 21 11 William Shakespeare , 22 10 Protestos no Brasil em 2013 , 23 10 A Fazenda 6 , 24 10 UFC Fight Night: Shogun vs. Sonnen , 25 10 Anitta

set 2013: 1 26 Champignon (músico) , 2 17 A Fazenda 6 , 3 16 Saramandaia (2013) , 4 15 Amor à Vida , 5 15 Gareth Bale , 6 15 Império do Brasil , 7 13 MTV (Brasil) , 8 13 Joia Rara , 9 13 Kaká , 10 13 Charlie Brown Jr. , 11 13 Clube Atlético Paranaense , 12 12 Salve Jorge , 13 12 Copa Sul-Americana de 2013 , 14 12 Campeonato Brasileiro de Futebol de 2013 - Série A , 15 11 Tiroteio e sequestro no centro comercial Westgate , 16 11 Protestos no Brasil em 2013 , 17 11 Sangue Bom , 18 11 Chiquititas (2013) , 19 11 Avenida Brasil (telenovela) , 20 11 Real Madrid Club de Fútbol , 21 11 Matemática , 22 11 Distrito Federal (Brasil) , 23 10 Wrecking Ball (canção de Miley Cyrus) , 24 10 Flor do Caribe , 25 10 Mesut Özil

out 2013: 1 18 Guilherme Briggs , 2 17 MTV Brasil , 3 16 MTV (Brasil) , 4 16 Copa do Mundo FIFA de 2014 , 5 14 Joia Rara , 6 13 Amor à Vida , 7 13 Avenida Brasil (telenovela) , 8 13 Ideal TV , 9 12 Sangue Bom , 10 12 Hernane Vidal de Souza , 11 11 Além do Horizonte (telenovela) , 12 11 Protestos no Brasil em 2013 , 13 11 Malala Yousafzai , 14 11 Campeonato Brasileiro de Futebol de 2013 - Série A , 15 11 Black bloc , 16 11 Impenetrabilidade , 17 11 ISO/IEC 17799 , 18 10 Mortes em outubro de 2013 , 19 10 Fifth Harmony , 20 10 UFC 166 , 21 10 Salve Jorge , 22 10 Facebook , 23 10 O Cravo e a Rosa , 24 9 The Voice Brasil (2.ª temporada) , 25 9 Anitta

nov 2013: 1 23 Clube de Regatas do Flamengo , 2 19 Campeonato Brasileiro de Futebol de 2013 - Série B , 3 18 Copa do Mundo FIFA de 2014 , 4 18 Cruzeiro Esporte Clube , 5 17 Amor à Vida , 6 15 Copa do Brasil de Futebol de 2013 , 7 15 Clube Atlético Mineiro , 8 14 Black Friday , 9 14 Miley Cyrus , 10 13 Copa Libertadores da América de 2014 , 11 13 Copa Sul-Americana de 2013 , 12 12 The Voice Brasil (2.ª temporada) , 13 12 Além do Horizonte (telenovela) , 14 12 Sangue Bom , 15 12 Títulos do Clube de Regatas do Flamengo no futebol , 16 12 Doris Lessing , 17 12 Fluminense Football Club , 18 12 Pepsi , 19 12 Sociedade Esportiva Palmeiras , 20 11 Talleres de Córdoba Rugby Club , 21 11 Campeonato Brasileiro de Futebol de 2013 - Série A , 22 11 Club de Regatas Vasco da Gama , 23 11 Nazismo , 24 10 Tufão Haiyan (2013) , 25 10 Wikipédia

dez 2013: 1 30 Nelson Mandela , 2 29 Paul Walker , 3 26 Copa do Mundo de Clubes da FIFA de 2013 , 4 25 Fluminense Football Club , 5 21 Copa Libertadores da América de 2014 , 6 19 Grêmio Foot-Ball Porto Alegrense , 7 18 Campeonato Mundial de Handebol Feminino de 2013 , 8 18 Campeonato Brasileiro de Futebol de 2014 - Série A , 9 18 Campeonato Brasileiro de Futebol de 2013 - Série A , 10 17 Raja Club Athletic , 11 16 Santa Cruz Futebol Clube , 12 14 Mortes em dezembro de 2013 , 13 14 Além do Horizonte (telenovela) , 14 14 Reginaldo Rossi , 15 14 Michael Schumacher , 16 14 2013 , 17 13 Taylor Swift , 18 13 Papai Noel , 19 13 Esporte Clube Bahia , 20 12 Martín Silva , 21 12 José Genoino , 22 12 Botafogo de Futebol e Regatas , 23 11 Leandro Damião , 24 11 Fußball-Club Bayern München , 25 11 Adriano Leite Ribeiro

jan 2014: 1 33 Eusébio , 2 24 Em Família (telenovela) , 3 23 Amor à Vida , 4 23 Yudi Tamashiro , 5 22 Big Brother Brasil 14 , 6 20 Amores Roubados , 7 19 Copa São Paulo de Futebol Júnior de 2014 , 8 18 Caras & Bocas , 9 18 Ariel Sharon , 10 18 2014 , 11 16 Grêmio Foot-Ball Porto Alegrense , 12 15 Fluminense Football Club , 13 14 Rolezinho , 14 14 Mortes em janeiro de 2014 , 15 14 Além do Horizonte (telenovela) , 16 14 Campeonato Paulista de Futebol de 2014 - Série A1 , 17 14 Minas Gerais , 18 13 FIFA Ballon d'Or , 19 13 Dian Fossey , 20 13 Ballon d'Or , 21 13 Slipknot , 22 13 Criciúma Esporte Clube , 23 13 Clube de Regatas do Flamengo , 24 12 Facebook , 25 12 O Cravo e a Rosa

fev 2014: 1 29 Em Família (telenovela) , 2 17 Jogos Olímpicos de Inverno de 2014 , 3 16 Amor à Vida , 4 15 MC Gui , 5 15 Joia Rara , 6 15 Copa do Mundo FIFA de 2014 , 7 14 Rachel Sheherazade , 8 14 Campeonato Brasileiro de Futebol de 2014 - Série A , 9 14 Alfred Russel Wallace , 10 14 Língua portuguesa , 11 13 Big Brother Brasil 14 , 12 13 Campeonato Paulista de Futebol de 2014 - Série A1 , 13 13 Reino Unido , 14 12 Flappy Bird , 15 12 Rolezinho , 16 12 UFC Fight Night: Machida vs. Mousasi , 17 12 Avenida Brasil (telenovela) , 18 12 Facebook , 19 12 Alexandre Pato , 20 12 Túlio Maravilha , 21 12 Renascimento , 22 11 Mortes em fevereiro de 2014 , 23 11 2014 na televisão , 24 11 Lorde (cantora) , 25 11 Copa Libertadores da América de 2014

mar 2014: 1 24 República Autônoma da Crimeia , 2 20 Voo Malaysia Airlines 370 , 3 20 Em Família (telenovela) , 4 17 Big Brother Brasil 14 , 5 17 Marco Civil da Internet , 6 16 Paulo Goulart , 7 15 Raissa Chaddad , 8 15 Lepo Lepo , 9 15 Campeonato Paulista de Futebol de 2014 - Série A1 , 10 15 Esporte Clube Vitória , 11 14 The Noite com Danilo Gentili , 12 14 Esporte Clube Bahia , 13 14 Inclusão digital , 14 13 2014 na televisão , 15 13 Joia Rara , 16 13 Revolução Industrial , 17 12 Eduardo Schechtel , 18 12 Meu Pedacinho de Chão (2014) , 19 12 Lorde (cantora) , 20 12 Little Mix , 21 12 2014 , 22 12 Mona Lisa , 23 12 Ucrânia , 24 12 Lisboa , 25 12 Lua

abr 2014: 1 26 Copa do Brasil de Futebol de 2014 , 2 24 José Wilker , 3 23 Meu Pedacinho de Chão (2014) , 4 22 Luciano do Valle , 5 21 Amor à Vida , 6 20 Geração Brasil , 7 18 Campeonato Brasileiro de Futebol de 2014 - Série D , 8 18 Nicolas Anelka , 9 17 Rede Globo , 10 17 José de Anchieta , 11 17 Senhora do Destino , 12 16 Clube de Regatas do Flamengo , 13 15 Copa Verde de Futebol de 2014 , 14 15 Marco Civil da Internet , 15 15 Copa do Mundo FIFA de 2014 , 16 15 Tiradentes , 17 15 Segunda Guerra Mundial , 18 14 Em Família (telenovela) , 19 14 Campeonato Brasileiro de Futebol de 2014 - Série A , 20 14 Caras & Bocas , 21 14 Leonardo da Vinci , 22 13 Mortes em abril de 2014 , 23 13 Ross Lynch , 24 13 Fluminense Football Club , 25 13 Gabriel García Márquez

mai 2014: 1 36 EXO , 2 28 Geração Brasil , 3 23 Copa do Mundo FIFA de 2014 , 4 22 Arena Corinthians , 5 20 Campeonato Brasileiro de Futebol de 2014 - Série D , 6 17 Anitta , 7 17 Copa do Brasil de Futebol de 2014 , 8 17 Supernatural (série de televisão) , 9 16 Em Família (telenovela) , 10 16 Fifth Harmony , 11 16 Sport Lisboa e Benfica , 12 15 Além do Horizonte (telenovela) , 13 14 Avenida Brasil (telenovela) , 14 14 David Luiz , 15 14 Segunda Guerra Mundial , 16 13 Lionel Messi , 17 13 Maria Gaetana Agnesi , 18 12 Sangue Bom , 19 12 Campeonato Brasileiro de Futebol de 2014 - Série A , 20 12 Caras & Bocas , 21 11 Malhação Casa Cheia , 22 11 Chiquititas (2013) , 23 11 Campeonato Brasileiro de Futebol de 2014 - Série B , 24 11 Copa Libertadores da América de 2014 , 25 11 SM Entertainment

jun 2014: 1 62 Copa do Mundo FIFA de 2014 , 2 32 Seleção Brasileira de Futebol , 3 24 Kaká , 4 19 Arena Corinthians , 5 16 Copa do Mundo FIFA de 2014 – Grupo A , 6 16 Doncaster Rovers Football Club , 7 16 Fernandão , 8 15 New York City Football Club , 9 15 Frederico Chaves Guedes , 10 14 Hulk (futebolista) , 11 14 Guillermo Ochoa , 12 14 Óbidos (Portugal) , 13 14 Filipe VI de Espanha , 14 13 Ultraviolence , 15 13 Copa do Mundo FIFA de 2014 – Fase final , 16 13 Arena Pantanal , 17 13 David Luiz , 18 13 Estádio Joaquim Américo Guimarães , 19 13 Clube de Regatas do Flamengo , 20 12 Geração Brasil , 21 12 Copa do Mundo FIFA de 2014 – Grupo B , 22 12 José Paulo Bezerra Maciel Junior , 23 11 Chiquititas (2013) , 24 11 Oscar dos Santos Emboaba Júnior , 25 11 Arena de Pernambuco

jul 2014: 1 42 Seleção Brasileira de Futebol , 2 35 Copa do Mundo FIFA de 2014 , 3 27 Em Família (telenovela) , 4 26 James Rodríguez , 5 25 Meu Pedacinho de Chão (2014) , 6 23 Neymar , 7 22 David Luiz , 8 22 Ronaldinho Gaúcho , 9 18 Malhação Sonhos , 10 18 Campeonato Brasileiro de Futebol de 2014 - Série A , 11 18 Ariano Suassuna , 12 17 Geração Brasil , 13 17 Alexandre Padilha , 14 17 Seleção Alemã de Futebol , 15 17 Luiz Felipe Scolari , 16 16 Voo Malaysia Airlines 17 , 17 16 Sangue Bom , 18 16 Chiquititas (2013) , 19 16 Eduardo da Silva , 20 16 Cobras & Lagartos , 21 15 O Rebu (2014) , 22 15 Arena Corinthians , 23 15 Chelsea Football Club , 24 15 Clube Atlético Mineiro , 25 15 Sport Club Corinthians Paulista

ago 2014: 1 51 Eduardo Campos , 2 31 Miriam Leitão , 3 26 Robin Williams , 4 24 Neymar , 5 21 Copa do Brasil de Futebol de 2014 , 6 18 Eleição presidencial no Brasil em 2014 , 7 17 Paulo Baier , 8 17 Fluminense Football Club , 9 16 Malhação Sonhos , 10 15 Campeonato Brasileiro de Futebol de 2014 - Série A , 11 14 Surto de ébola na África Ocidental , 12 14 Douglas Pereira dos Santos , 13 14 Roger Abdelmassih , 14 14 Ángel Di María , 15 14 Paysandu Sport Club , 16 14 Segunda Guerra Mundial , 17 13 Meu Pedacinho de Chão (2014) , 18 13 One Direction , 19 13 Robinho , 20 13 Associazione Calcio Milan , 21 13 Jô Soares , 22 13 Seleção Brasileira de Futebol , 23 13 Grêmio Foot-Ball Porto Alegrense , 24 13 Club de Regatas Vasco da Gama , 25 13 Clube de Regatas do Flamengo

set 2014: 1 25 Neymar , 2 20 Eleição presidencial no Brasil em 2014 , 3 19 Geração Brasil , 4 19 Club de Regatas Vasco da Gama , 5 17 A Fazenda 7 , 6 17 Campeonato Brasileiro de Futebol de 2014 - Série A , 7 16 Clube de Regatas do Flamengo , 8 15 Posídon , 9 14 Katy Perry , 10 14 Levy Fidelix , 11 14 Sortilegio (telenovela) , 12 14 Santos Futebol Clube , 13 14 11 de setembro , 14 13 Ladies' Code , 15 13 Campeonato Brasileiro de Futebol de 2014 - Série B , 16 13 Campeonato Brasileiro de Futebol de 2014 - Série D , 17 13 Joan Rivers , 18 13 Seleção Brasileira de Futebol , 19 13 Michael Jackson , 20 13 Comunismo , 21 12 Girl Meets World , 22 12 Lana Del Rey , 23 12 Girls' Generation , 24 12 19 de setembro , 25 12 7 de setembro

out 2014: 1 34 Eleição presidencial no Brasil em 2014 , 2 28 Aécio Neves , 3 24 Dilma Rousseff , 4 18 Seleção Brasileira de Futebol , 5 18 Avaí Futebol Clube , 6 17 Alto Astral , 7 17 Dia das bruxas , 8 17 Clube de Regatas do Flamengo , 9 16 A Fazenda 7 , 10 16 Campeonato Brasileiro de Futebol de 2014 - Série A , 11 16 Fernando Henrique Cardoso , 12 15 Fifth Harmony , 13 15 Neymar , 14 13 Mi pecado , 15 13 Levy Fidelix , 16 13 Corujão (programa de televisão) , 17 13 Portugal , 18 12 Surto de ébola na África Ocidental , 19 12 Girls' Generation , 20 12 Lista de presidentes do Brasil , 21 12 Sapo-comum , 22 12 Grêmio Foot-Ball Porto Alegrense , 23 12 Vincent van Gogh , 24 12 Club de Regatas Vasco da Gama , 25 11 Geração Brasil

nov 2014: 1 25 Clube Atlético Mineiro , 2 24 Roberto Gómez Bolaños , 3 21 Copa do Brasil de Futebol , 4 20 Alto Astral , 5 19 Neymar , 6 19 Dilma Rousseff , 7 16 Copa Libertadores da América de 2015 , 8 16 Campeonato Brasileiro de Futebol de 2014 - Série A , 9 16 Nicki Minaj , 10 16 Lady Gaga , 11 15 Arrow (série de televisão) , 12 15 Cruzeiro Esporte Clube , 13 14 Mortes em novembro de 2014 , 14 14 Copa do Brasil de Futebol de 2014 , 15 14 Clássico Mineiro , 16 14 Basquetebol , 17 13 Sophia Abrahão , 18 13 Ariana Grande , 19 13 Allianz Parque , 20 13 Vênus ao espelho , 21 13 Maite Perroni , 22 13 Campeonato Brasileiro de Futebol - Série B , 23 13 Avaí Futebol Clube , 24 13 José Sócrates , 25 12 Pro Evolution Soccer 2015

dez 2014: 1 28 Clube Atlético Mineiro , 2 21 Copa Libertadores da América de 2015 , 3 21 Gabriel Medina , 4 18 Grêmio Foot-Ball Porto Alegrense , 5 17 Copa do Mundo de Clubes da FIFA de 2014 , 6 17 Maite Perroni , 7 17 Roberto Gómez Bolaños , 8 16 Allianz Parque , 9 16 Sociedade Esportiva Palmeiras , 10 15 Igreja Universal do Reino de Deus , 11 15 Ariana Grande , 12 15 Facebook , 13 15 Luís Ricardo , 14 14 A Fazenda 7 , 15 14 WhatsApp , 16 14 Lady Gaga , 17 14 Michael Jackson , 18 13 Alto Astral , 19 13 Éverton Ribeiro , 20 13 Miley Cyrus , 21 13 Frederico Chaves Guedes , 22 13 Dilma Rousseff , 23 13 Club de Regatas Vasco da Gama , 24 12 Malhação Sonhos , 25 12 Copa do Brasil de Futebol de 2015

jan 2015: 1 31 Massacre do Charlie Hebdo , 2 26 Copa São Paulo de Futebol Júnior de 2015 , 3 23 Alto Astral , 4 22 Eduardo Pereira Rodrigues , 5 21 Leandro Damião , 6 19 Lucas Silva , 7 18 2015 , 8 16 Caso Marco Archer , 9 16 Charlie Hebdo , 10 16 Amor à Vida , 11 16 Éverton Ribeiro , 12 16 Cobras & Lagartos , 13 15 Felizes para Sempre? , 14 15 2015 na televisão , 15 15 Giorgian De Arrascaeta , 16 15 Malhação Sonhos , 17 15 O Rei do Gado , 18 15 Google , 19 14 Florida Cup de 2015 , 20 14 Ricardo Goulart , 21 14 Ricardo Centurión , 22 14 Chiquititas (2013) , 23 14 Eugenio Mena , 24 14 Diego Tardelli , 25 14 Fortaleza Esporte Clube

fev 2015: 1 19 Alto Astral , 2 17 Paulo André , 3 15 Malhação Sonhos , 4 15 Anderson Silva , 5 15 Beyoncé , 6 14 Campeonato Paulista de Futebol de 2015 - Série A1 , 7 14 Babilônia (telenovela) , 8 14 Wanessa Camargo , 9 14 Xuxa , 10 14 Botafogo de Futebol e Regatas , 11 14 Santos Futebol Clube , 12 14 Ilhas Malvinas , 13 14 Sport Club Corinthians Paulista , 14 13 Mortes em fevereiro de 2015 , 15 13 Campeonato Carioca de Futebol de 2015 , 16 13 Sophia Abrahão , 17 13 Tomie Ohtake , 18 12 Birdman ou (A Inesperada Virtude da Ignorância) , 19 12 Copa do Nordeste de Futebol de 2015 , 20 12 Kéfera Buchmann , 21 12 David Martins Miranda , 22 12 RBD , 23 12 Fernando Henrique Cardoso , 24 11 Lista de canções em Glee (6ª temporada) , 25 11 Carrossel (telenovela)

mar 2015: 1 31 Babilônia (telenovela) , 2 21 Voo Germanwings 9525 , 3 20 Sete Vidas , 4 20 Inezita Barroso , 5 18 Protestos contra o governo Dilma Rousseff , 6 18 Alto Astral , 7 18 José Rico , 8 17 Campeonato Paulista de Futebol de 2015 - Série A1 , 9 17 Revolução Industrial , 10 15 Carrossel (telenovela) , 11 15 Arte rupestre , 12 15 2015 , 13 14 Agora É Tarde , 14 14 Leonardo da Silva Moura , 15 14 Santos Futebol Clube , 16 13 Cristian Rodríguez , 17 13 Antonio Anastasia , 18 13 Maria Esperança , 19 13 Jorge Loredo , 20 13 Edir Macedo , 21 13 Páscoa , 22 13 Aécio Neves , 23 12 Lista de telenovelas das oito da Rede Globo , 24 12 Mortes em março de 2015 , 25 12 Mil e Uma Noites (série de televisão)

abr 2015: 1 25 Babilônia (telenovela) , 2 23 Copa do Brasil de Futebol de 2015 , 3 22 Alto Astral , 4 21 Copa Libertadores da América de 2015 , 5 21 Furious 7 , 6 17 2015 na televisão , 7 17 Pablo Armero , 8 17 Sete Vidas , 9 17 Jorge Jesus , 10 17 Antônio Abujamra , 11 16 Sismo do Nepal de 2015 , 12 16 Avengers: Age of Ultron , 13 16 Fabrício dos Santos Silva , 14 16 Rihanna , 15 15 Campeonato Paulista de Futebol de 2015 - Série A1 , 16 15 Corazón indomable , 17 15 Zayn , 18 15 Anselmo Ralph , 19 15 David Luiz , 20 15 Pelé , 21 14 Copa do Mundo de Clubes da FIFA , 22 14 Beyoncé , 23 14 Manoel de Oliveira , 24 14 Ronaldinho Gaúcho , 25 13 Avenida Brasil (telenovela)

mai 2015: 1 29 Alto Astral , 2 28 Babilônia (telenovela) , 3 24 Copa Libertadores da América de 2015 , 4 22 Faculdade Cásper Líbero , 5 21 Avengers: Age of Ultron , 6 21 Club de Regatas Vasco da Gama , 7 20 Copa do Brasil de Futebol de 2015 , 8 19 Paolo Guerrero , 9 19 Liga dos Campeões da UEFA , 10 18 Campeonato Brasileiro de Futebol de 2015 - Série A , 11 16 Liga dos Campeões da UEFA de 2014–15 , 12 15 Campeonato Brasileiro de Futebol de 2015 - Série D , 13 15 Austin Mahone , 14 15 Ceará Sporting Club , 15 15 Dia do Trabalhador , 16 14 Claudia Leitte , 17 14 TV Gazeta , 18 14 Beyoncé , 19 14 Comunicação audiovisual , 20 14 Robinho , 21 14 Grêmio Foot-Ball Porto Alegrense , 22 14 Netuno (planeta) , 23 13 Mad Max: Estrada da Fúria , 24 13 Campeonato Brasileiro de Futebol de 2015 - Série B , 25 13 Sete Vidas

jun 2015: 1 54 Matala , 2 31 Inferência incerta , 3 30 Cristiano Araújo , 4 28 Copa América de 2015 , 5 24 Verdades Secretas , 6 23 Equol , 7 22 Club de Regatas Vasco da Gama , 8 20 Campeonato Brasileiro de Futebol de 2015 - Série A , 9 17 Sete Vidas , 10 16 Jorge Jesus , 11 16 Paolo Guerrero , 12 16 Leonardo da Silva Moura , 13 16 Seleção Brasileira de Futebol , 14 15 Camila Queiroz , 15 15 Angola , 16 14 Roberto Firmino , 17 14 Alecsandro , 18 14 Emerson Sheik , 19 13 2015 na televisão , 20 13 Malhação Sonhos , 21 13 5 Seconds of Summer , 22 13 Marco Silva , 23 13 Jurassic World , 24 13 Copa do Mundo de Futebol Feminino de 2015 , 25 13 Anselmo Ralph

jul 2015: 1 24 Babilônia (telenovela) , 2 24 Paolo Guerrero , 3 19 Caminho das Índias , 4 19 Jogos Pan-Americanos de 2015 , 5 19 Iker Casillas , 6 17 2015 na televisão , 7 16 Verdades Secretas , 8 16 NGA (cantor) , 9 16 Sete Vidas , 10 16 Club de Regatas Vasco da Gama , 11 15 Corazón indomable , 12 15 Douglas Pereira dos Santos , 13 15 Cúmplices de um Resgate , 14 14 Copa do Mundo FIFA de Futebol de Areia de 2015 , 15 14 Copa Sul-Americana de 2015 , 16 14 La usurpadora , 17 14 Os Simpsons , 18 14 Plutão , 19 13 Brasil nos Jogos Pan-Americanos de 2015 , 20 13 Windows 10 , 21 13 Campeonato Brasileiro de Futebol de 2015 - Série A , 22 13 Soy tu dueña , 23 13 Maisa Silva , 24 13 Fluminense Football Club , 25 13 Malhação

ago 2015: 1 40 Aeroporto de Agadir Al Massira , 2 31 Babilônia (telenovela) , 3 29 Campeonato Brasileiro de Futebol de 2015 - Série A , 4 26 A Regra do Jogo (telenovela) , 5 23 Estereoquímica , 6 22 Cúmplices de um Resgate , 7 20 Mastocitose , 8 18 Shelbie Bruce , 9 18 Grenal , 10 16 Segunda Guerra Mundial , 11 15 Malhação: Seu Lugar no Mundo , 12 15 Malhação Sonhos , 13 15 Copa do Brasil de Futebol de 2015 , 14 15 Ronda Rousey , 15 14 Mortes em agosto de 2015 , 16 14 Verdades Secretas , 17 14 Caminho das Índias , 18 14 Maisa Silva , 19 13 Xuxa Meneghel (programa de televisão) , 20 13 Minecraft , 21 13 League of Legends , 22 13 Ángel Di María , 23 13 Google , 24 12 Filtro linear de suavização , 25 12 Liga dos Campeões da UEFA de 2015–16

set 2015: 1 35 A Regra do Jogo (telenovela) , 2 21 Verdades Secretas , 3 18 Campeonato Brasileiro de Futebol de 2015 - Série A , 4 18 Betty Lago , 5 17 Google , 6 16 Monte Galinheiro , 7 16 Ronaldinho Gaúcho , 8 15 Mundo Disney , 9 15 Kéfera Buchmann , 10 15 Martha Root , 11 15 17 de setembro , 12 14 A Fazenda 8 , 13 13 Babilônia (telenovela) , 14 13 Santos Futebol Clube , 15 13 Marte (planeta) , 16 12 Agostinho Neto , 17 11 Nicki Minaj , 18 11 Oiran , 19 11 Partido dos Trabalhadores , 20 11 Grêmio Foot-Ball Porto Alegrense , 21 11 Budismo , 22 10 Campeonato Brasileiro de Futebol de 2015 - Série D , 23 10 Avenida Brasil (telenovela) , 24 10 Ben Carson , 25 10 Teresa (2010)

out 2015: 1 20 Yoná Magalhães , 2 19 Bang (álbum) , 3 16 A Regra do Jogo (telenovela) , 4 16 Eleições legislativas portuguesas de 2015 , 5 15 A Fazenda 8 , 6 15 Campeonato Brasileiro de Futebol de 2015 - Série A , 7 15 Simone de Beauvoir , 8 15 Sporting Clube de Portugal , 9 14 Luís Carlos Miele , 10 13 Furacão Patricia (2015) , 11 13 Verdades Secretas , 12 13 Copa do Brasil de Futebol de 2015 , 13 13 Empresa de Transportes Braso Lisboa , 14 13 Dia das bruxas , 15 13 2015 , 16 13 Direitos humanos , 17 13 Segunda Guerra Mundial , 18 12 Interruptor unilateral de silício , 19 12 Monte Galinheiro , 20 12 Larissa Manoela , 21 12 League of Legends , 22 12 Katy Perry , 23 12 Cúmplices de um Resgate , 24 11 The Voice Brasil (4.ª temporada) , 25 11 Aeroporto de Agadir Al Massira

nov 2015: 1 37 Ataques de novembro de 2015 em Paris , 2 23 Rompimento de barragem em Mariana , 3 22 Campeonato Brasileiro de Futebol de 2015 - Série A , 4 21 António Costa , 5 17 George Boole , 6 16 Delcídio do Amaral , 7 16 Sport Club Corinthians Paulista , 8 15 A Regra do Jogo (telenovela) , 9 15 Cúmplices de um Resgate , 10 15 Ditadura militar no Brasil (1964–1985) , 11 14 XXI Governo Constitucional de Portugal , 12 14 Proclamação da República do Brasil , 13 13 A Fazenda 8 , 14 13 Wesley Safadão , 15 13 Pedro Arroja , 16 13 Club de Regatas Vasco da Gama , 17 12 25 (álbum) , 18 12 Pietra di Bismantova , 19 12 Survivor Series (2015) , 20 12 Copa Libertadores da América de 2016 , 21 12 Eliminatórias da Copa do Mundo FIFA de 2018 - América do Sul , 22 12 Estado Islâmico do Iraque e do Levante , 23 12 Majestoso , 24 12 Estado islâmico , 25 12 Ricardo Oliveira

dez 2015: 1 21 Impeachment de Dilma Rousseff , 2 21 A Regra do Jogo (telenovela) , 3 20 Star Wars: Episódio VII - O Despertar da Força , 4 18 Copa do Mundo de Clubes da FIFA de 2015 , 5 16 Copa Libertadores da América de 2016 , 6 16 Partido dos Trabalhadores , 7 15 Fernando Prass , 8 15 Santos Futebol Clube , 9 15 Club de Regatas Vasco da Gama , 10 14 Copa do Mundo de Clubes da FIFA , 11 14 Marília Pêra , 12 13 Jean Wyllys , 13 13 Jadson , 14 13 Joelma Mendes , 15 13 Fascismo , 16 12 MasterChef Júnior (Brasil) , 17 12 Eleições presidenciais portuguesas de 2016 , 18 12 Allianz Parque , 19 12 Ricardo Oliveira , 20 12 António Costa , 21 12 Papai Noel , 22 12 14 de dezembro , 23 12 Cruzeiro Esporte Clube , 24 12 São Paulo (estado) , 25 11 Mortes em dezembro de 2015

jan 2016: 1 25 Mortes em janeiro de 2016 , 2 25 Copa São Paulo de Futebol Júnior de 2016 , 3 24 Eleições presidenciais portuguesas de 2016 , 4 24 Marcelo Rebelo de Sousa , 5 23 Lady Gaga , 6 22 Florida Cup de 2016 , 7 22 Alexandre Pato , 8 20 David Bowie , 9 20 Partido dos Trabalhadores , 10 18 2016 , 11 17 A Regra do Jogo (telenovela) , 12 17 André Felipe Ribeiro de Souza , 13 16 Wendell Lira , 14 16 Teste nuclear norte-coreano de janeiro de 2016 , 15 16 Os Dez Mandamentos (filme de 2016) , 16 16 Star Wars: Episódio VII - O Despertar da Força , 17 16 Charles Perrault , 18 15 John Boyega , 19 15 Vírus da zica , 20 15 Giovanni Augusto , 21 15 Copa São Paulo de Futebol Júnior , 22 15 Sport Club Corinthians Paulista , 23 14 Biel (cantor) , 24 14 2016 na televisão , 25 14 Laep Investments

fev 2016: 1 27 Vírus da zica , 2 18 Mortes em fevereiro de 2016 , 3 18 Surto de vírus Zika (2015–presente) , 4 17 A Regra do Jogo (telenovela) , 5 17 Leonardo DiCaprio , 6 17 Albert Einstein , 7 16 Resultados do Carnaval do Rio de Janeiro em 2016 , 8 16 Felipe Neto , 9 16 Sport Club Corinthians Paulista , 10 15 Campeonato Paulista de Futebol de 2016 - Série A1 , 11 15 Deadpool (filme) , 12 15 Carnaval , 13 14 Copa Libertadores da América de 2016 , 14 14 2016 na televisão , 15 14 Estação Primeira de Mangueira , 16 14 Acre , 17 13 Chicungunha , 18 13 Lady Gaga , 19 13 Sporting Clube de Portugal , 20 13 Google , 21 13 Lisboa , 22 12 Resultados da segunda fase da Copa Libertadores da América de 2016 , 23 12 Biel (cantor) , 24 12 WhatsApp , 25 12 Footjob

mar 2016: 1 38 Luiz Inácio Lula da Silva , 2 24 Atentados em Bruxelas em março de 2016 , 3 24 Mortes em março de 2016 , 4 23 Velho Chico (telenovela) , 5 20 Sérgio Moro , 6 20 Batman v Superman: Dawn of Justice , 7 20 Where Are You Now , 8 19 Impeachment de Dilma Rousseff , 9 19 Batata , 10 18 Vírus da zica , 11 17 Campeonato Paulista de Futebol de 2016 - Série A1 , 12 17 Copa Libertadores da América de 2016 , 13 17 Casa Civil (Brasil) , 14 17 Johan Cruijff , 15 16 Afrikanerbond , 16 16 2016 na televisão , 17 16 Donald Trump , 18 15 Copa do Nordeste de Futebol de 2016 , 19 15 Fifth Harmony , 20 15 Club Penguin , 21 15 Karl Marx , 22 14 Lista de ministros da Casa Civil do Brasil , 23 14 Eduardo Cunha , 24 14 Facebook , 25 14 Zlatan Ibrahimović

abr 2016: 1 34 Impeachment de Dilma Rousseff , 2 25 Campeonato Paulista de Futebol de 2016 - Série A1 , 3 25 Copa Libertadores da América de 2016 , 4 23 Panama Papers , 5 23 Copa do Brasil de Futebol de 2016 , 6 21 Prince , 7 21 Dilma Rousseff , 8 20 Carlos Alberto Brilhante Ustra , 9 19 Velho Chico (telenovela) , 10 19 Campeonato Brasileiro de Futebol de 2016 - Série D , 11 18 Janaína Paschoal , 12 16 Batman v Superman: Dawn of Justice , 13 16 Lady Gaga , 14 16 Globalização , 15 16 4 de abril , 16 16 Cristianismo , 17 15 Capitão América: Guerra Civil , 18 15 Homem de Ferro , 19 15 Jogos Olímpicos , 20 14 Eduardo (rapper) , 21 14 Tereza Rachel , 22 14 Michel Temer , 23 14 Fluminense Football Club , 24 13 Mortes em abril de 2016 , 25 13 Ronaldinho Gaúcho

mai 2016: 1 50 Michel Temer , 2 28 Impeachment de Dilma Rousseff , 3 26 Copa do Brasil de Futebol de 2016 , 4 25 Dilma Rousseff , 5 22 Renato Sanches , 6 22 Haja Coração , 7 21 Capitão América: Guerra Civil , 8 18 Campeonato Brasileiro de Futebol de 2016 - Série D , 9 18 Escrava Mãe , 10 17 Waldir Maranhão , 11 17 Eduardo Cunha , 12 17 Cauby Peixoto , 13 17 Santa Cruz Futebol Clube , 14 16 Paysandu Sport Club , 15 16 Club de Regatas Vasco da Gama , 16 15 Copa Libertadores da América de 2016 , 17 15 X-Men: Apocalipse , 18 15 Ministério da Cultura (Brasil) , 19 15 Zlatan Ibrahimović , 20 15 Liga dos Campeões da UEFA , 21 15 Esporte Clube Bahia , 22 14 Governo Michel Temer , 23 14 Marcela Temer , 24 14 Lista de presidentes do Brasil , 25 14 Grêmio Foot-Ball Porto Alegrense

jun 2016: 1 27 Copa América Centenário , 2 23 Haja Coração , 3 21 Muhammad Ali , 4 19 Dunga , 5 18 Mortes em junho de 2016 , 6 17 Massacre de Orlando , 7 17 Christina Grimmie , 8 17 Pedro Pablo Kuczynski , 9 16 Eduardo Cunha , 10 16 Rubén Aguirre , 11 16 Tite (treinador de futebol) , 12 16 Seleção Brasileira de Futebol , 13 16 Sport Club Corinthians Paulista , 14 15 Renato Sanches , 15 14 Saída do Reino Unido da União Europeia , 16 14 I.O.I , 17 14 Escrava Mãe , 18 14 4Minute , 19 14 Daniel Alves , 20 13 Impeachment de Dilma Rousseff , 21 13 Anton Yelchin , 22 13 Lady Gaga , 23 13 David Cameron , 24 13 Ronaldinho Gaúcho , 25 13 2016

jul 2016: 1 21 Copa do Brasil de Futebol de 2016 , 2 20 Rodrigo Maia , 3 19 Atentado de julho de 2016 em Nice , 4 19 Grêmio Foot-Ball Porto Alegrense , 5 18 Ronaldinho Gaúcho , 6 17 Atentado de julho de 2016 em Munique , 7 17 Gabriel Jesus , 8 17 Guilherme Karam , 9 16 Campeonato Brasileiro de Futebol de 2016 - Série D , 10 16 Lady Gaga , 11 16 Cúmplices de um Resgate , 12 16 Club de Regatas Vasco da Gama , 13 15 Theresa May , 14 15 Final do Campeonato Europeu de Futebol de 2016 , 15 15 Camilo de Oliveira , 16 15 Héctor Babenco , 17 14 Tentativa de golpe de Estado na Turquia em 2016 , 18 14 BTS , 19 14 Cheias de Charme , 20 14 Éderzito António Macedo Lopes , 21 14 Eduardo Cunha , 22 14 Sport Club Corinthians Paulista , 23 13 Mortes em julho de 2016 , 24 13 Impeachment de Dilma Rousseff , 25 13 Juno (sonda espacial)

ago 2016: 1 45 Jogos Olímpicos de Verão de 2016 , 2 24 Thiago Braz , 3 23 Seleção Brasileira de Futebol , 4 22 Futebol nos Jogos Olímpicos , 5 21 Arthur Mariano , 6 21 Futebol nos Jogos Olímpicos de Verão de 2016 - Masculino , 7 21 Usain Bolt , 8 21 Lista de medalhas brasileiras nos Jogos Olímpicos , 9 20 Brasil nos Jogos Olímpicos de Verão de 2016 , 10 19 Gabriel Barbosa , 11 18 Mortes em agosto de 2016 , 12 18 BTS , 13 18 Cerimônia de abertura dos Jogos Olímpicos de Verão de 2016 , 14 18 EXO , 15 18 Rafaela Silva , 16 17 Futebol nos Jogos Olímpicos de Verão de 2016 - Feminino , 17 17 Jogos Olímpicos de Verão de 2020 , 18 17 Brasil nos Jogos Olímpicos , 19 17 Michel Temer , 20 16 Black Pink , 21 16 Michael Phelps , 22 15 Justiça (minissérie) , 23 15 Esquadrão Suicida (filme) , 24 15 Futebol nos Jogos Olímpicos de Verão de 2016 , 25 15 Isaquias Queiroz

set 2016: 1 50 Domingos Montagner , 2 24 BTS , 3 22 Jogos Paralímpicos de Verão de 2016 , 4 20 Madre Teresa de Calcutá , 5 19 Protestos contra o governo Michel Temer , 6 19 Impeachment de Dilma Rousseff , 7 17 Velho Chico (telenovela) , 8 17 Partido da Social Democracia Brasileira , 9 15 A Lei do Amor , 10 15 Copa do Brasil de Futebol de 2016 , 11 15 Cheias de Charme , 12 15 Pablo Escobar , 13 14 Mortes em setembro de 2016 , 14 14 Justiça (minissérie) , 15 14 Jeon Jung-kook , 16 14 Virada Cultural , 17 13 Sol Nascente (telenovela) , 18 13 Eliminatórias da Copa do Mundo FIFA de 2018 - América do Sul , 19 13 Felipe Neto , 20 13 Neymar , 21 13 Magno Malta , 22 13 Jogos Olímpicos de Verão de 2016 , 23 13 2016 , 24 13 Comunismo , 25 12 Eleição municipal de São Paulo em 2016

out 2016: 1 30 A Lei do Amor , 2 27 Marcelo Crivella , 3 22 Haja Coração , 4 22 João Doria , 5 20 Partido da Social Democracia Brasileira , 6 20 António Guterres , 7 18 Copa Libertadores da América de 2017 , 8 18 Carlos Alberto Torres , 9 16 Furacão Matthew , 10 15 Mortes em outubro de 2016 , 11 15 Rock Story , 12 15 Shawn Mendes , 13 15 Eleições municipais no Brasil em 2016 , 14 14 Soy Luna , 15 14 Neymar , 16 14 Bhumibol Adulyadej , 17 14 Bob Dylan , 18 14 2016 , 19 13 Volta Redonda Futebol Clube , 20 13 Fortaleza Esporte Clube , 21 13 Sport Club Corinthians Paulista , 22 12 Sol Nascente (telenovela) , 23 12 The Walking Dead (série de televisão) , 24 12 Fernando Haddad , 25 12 Curitiba

nov 2016: 1 37 Voo LaMia 2933 , 2 28 Donald Trump , 3 21 Rock Story , 4 21 Copa do Brasil de Futebol de 2016 , 5 21 2016 , 6 20 Mortes em novembro de 2016 , 7 20 Marcos Danilo Padilha , 8 20 Fidel Castro , 9 19 RecordTV , 10 18 Copa Libertadores da América de 2017 , 11 16 Black Pink , 12 16 Copa Sul-Americana de 2016 , 13 16 Haja Coração , 14 16 Associação Chapecoense de Futebol , 15 15 2NE1 , 16 15 Geddel Vieira Lima , 17 14 Novo Regime Fiscal , 18 14 Deva Pascovicci , 19 14 Mário Sérgio Pontes de Paiva , 20 14 Hillary Clinton , 21 13 Carinha de Anjo , 22 13 Eleição presidencial nos Estados Unidos em 2016 , 23 13 Sérgio Cabral Filho , 24 13 Cléber Santana , 25 13 Sociedade Esportiva Palmeiras

dez 2016: 1 34 Copa Libertadores da América de 2017 , 2 26 Voo LaMia 2933 , 3 25 Copa do Mundo de Clubes da FIFA de 2016 , 4 25 Associação Chapecoense de Futebol , 5 22 Mortes em dezembro de 2016 , 6 20 Copa Sul-Americana de 2016 , 7 20 Carrie Fisher , 8 18 Camila Cabello , 9 18 George Michael , 10 18 Grêmio Foot-Ball Porto Alegrense , 11 17 Sociedade Esportiva Palmeiras , 12 15 Jakson Follmann , 13 15 Novo Regime Fiscal , 14 15 Mário Sérgio Santos Costa , 15 15 BTS , 16 15 Andrés D'Alessandro , 17 14 Marcos Danilo Padilha , 18 14 Grupo Oi , 19 13 Atentado de Berlim em 2016 , 20 13 Andrei Karlov , 21 13 Black Pink , 22 13 Campeonato Brasileiro de Futebol de 2017 - Série B , 23 13 A Lei do Amor , 24 13 Copa Sul-Americana de 2017 , 25 13 Pedro Geromel

jan 2017: 1 29 Copa São Paulo de Futebol Júnior de 2017 , 2 28 2017 , 3 24 Donald Trump , 4 23 Big Brother Brasil 17 , 5 23 Teori Zavascki , 6 22 Florida Cup de 2017 , 7 21 Mário Soares , 8 18 Mortes em janeiro de 2017 , 9 18 Loalwa Braz , 10 18 Sociedade Esportiva Palmeiras , 11 17 Black Pink , 12 17 Eike Batista , 13 17 Copa São Paulo de Futebol Júnior , 14 16 Familicídio em Campinas em 2016 , 15 16 Gabriel Girotto Franco , 16 15 A Lei do Amor , 17 15 Angelina Jolie , 18 14 David Neres , 19 14 Eduardo Pereira Rodrigues , 20 14 Felipe Melo , 21 14 Zygmunt Bauman , 22 14 Michel Temer , 23 13 Resultados da fase final da Copa São Paulo de Futebol Júnior de 2017 , 24 13 Malhação: Pro Dia Nascer Feliz , 25 13 Copa Libertadores da América de 2017

fev 2017: 1 28 Marisa Letícia Lula da Silva , 2 18 Alexandre de Moraes , 3 17 Girabola de 2017 , 4 17 Campeonato Paulista de Futebol de 2017 - Série A1 , 5 16 Big Brother Brasil 17 , 6 14 Crise da segurança pública no Espírito Santo em 2017 , 7 14 Mortes em fevereiro de 2017 , 8 14 Copa do Nordeste de Futebol de 2017 , 9 14 Impeachment de Dilma Rousseff , 10 14 Copa Libertadores da América de 2017 , 11 14 Frederico Chaves Guedes , 12 14 2017 , 13 14 Carmen Miranda , 14 13 Gilberto Oliveira Souza Júnior , 15 13 Sociedade Esportiva Palmeiras , 16 13 Luiz Inácio Lula da Silva , 17 12 TRAPPIST-1 , 18 12 A Lei do Amor , 19 12 Rock Story , 20 12 EXO , 21 12 Lista de partidos políticos do Brasil , 22 11 Kard , 23 11 Oscar 2017 , 24 11 William Pottker , 25 11 Paolo Guerrero

mar 2017: 1 20 Operação Carne Fraca , 2 20 O Rico e Lázaro , 3 20 Campeonato Paulista de Futebol de 2017 - Série A1 , 4 19 Big Brother Brasil 17 , 5 17 Resultados do Carnaval do Rio de Janeiro em 2017 , 6 17 A Força do Querer , 7 17 Andrés D'Alessandro , 8 15 Logan (filme) , 9 15 Novo Mundo (telenovela) , 10 15 Governo Michel Temer , 11 15 Seleção Brasileira de Futebol , 12 15 Carmen Miranda , 13 14 Atentado em Westminster de 2017 , 14 14 Mortes em março de 2017 , 15 14 Black Pink , 16 14 Portela (escola de samba) , 17 14 Boa Esporte Clube , 18 14 Didier Drogba , 19 14 Unidos da Tijuca , 20 13 Miguel Borja , 21 13 Malhação: Pro Dia Nascer Feliz , 22 13 Lista de personalidades do YouTube , 23 13 Crissiumal , 24 12 A Lei do Amor , 25 12 Copa do Nordeste de Futebol de 2017

abr 2017: 1 24 A Força do Querer , 2 23 Prova Ciclística 9 de Julho , 3 19 Big Brother Brasil 17 , 4 19 13 Reasons Why , 5 19 Jerry Adriani , 6 18 Campeonato Paulista de Futebol de 2017 - Série A1 , 7 18 Solar da Baronesa , 8 17 Katherine Langford , 9 17 Os Dias Eram Assim , 10 17 Belchior , 11 16 Edifício Esther , 12 16 Avenida da Liberdade (São Paulo) , 13 16 Bruno Fernandes de Souza , 14 15 Brasil Paralelo , 15 15 Capela dos Aflitos , 16 15 Chu Ming Silveira , 17 15 Museu de Anatomia Veterinária da Faculdade de Medicina Veterinária e Zootecnia da USP , 18 15 Jockey Club de São Paulo , 19 15 Cemitério da Consolação , 20 15 Sala São Paulo , 21 15 Parque Zoológico de São Paulo , 22 15 Viaduto do Chá , 23 14 Caminhada Noturna , 24 14 Parque Ibirapuera , 25 14 Anhembi Parque

mai 2017: 1 20 Atentado na Manchester Arena em 2017 , 2 20 Vinícius Júnior , 3 20 Salvador Sobral , 4 20 Belchior , 5 18 Pega Pega , 6 18 Emmanuel Macron , 7 18 Esporte Clube Bahia , 8 17 Mortes em maio de 2017 , 9 17 Aécio Neves , 10 16 Governo Michel Temer , 11 16 Nelson Xavier , 12 14 A Força do Querer , 13 14 Copa Libertadores da América de 2017 , 14 13 WannaCry , 15 13 Campeonato Paulista de Futebol de 2017 - Série A1 , 16 13 Festival Eurovisão da Canção 2017 , 17 13 Desimpedidos , 18 13 Almir Guineto , 19 13 Associação Atlética Ponte Preta , 20 13 Lista de partidos políticos do Brasil , 21 13 Clube Atlético Paranaense , 22 12 Witness (álbum de Katy Perry) , 23 12 Santuário de Fátima , 24 12 Não Vou Pagar o Pato , 25 12 Copa do Nordeste de Futebol de 2017

jun 2017: 1 26 Copa das Confederações FIFA de 2017 , 2 21 Incêndio florestal de Pedrógão Grande em 2017 , 3 21 Pega Pega , 4 17 A Força do Querer , 5 17 Adam West , 6 16 Black Pink , 7 16 Monsta X , 8 15 Pabllo Vittar , 9 15 Mulher-Maravilha (filme) , 10 15 Pretty Little Liars (série de televisão) , 11 15 Estádio Luso-Brasileiro , 12 14 Anitta , 13 13 Geuvânio , 14 13 James Rodríguez , 15 13 Rhodolfo , 16 13 Club de Regatas Vasco da Gama , 17 12 Campeonato Brasileiro de Futebol de 2017 - Série B , 18 12 The Leftovers , 19 12 Radar meteorológico , 20 12 Sociedade Esportiva Palmeiras , 21 11 Juacas , 22 11 Rock Story , 23 11 Governo Michel Temer , 24 11 Camila Queiroz , 25 11 Herman Benjamin

jul 2017: 1 28 Luiz Inácio Lula da Silva , 2 22 Mortes em julho de 2017 , 3 18 Diego Alves , 4 16 A Força do Querer , 5 16 Spider-Man: Homecoming , 6 16 Anitta , 7 14 Kard , 8 14 Black Pink , 9 14 Camila Cabello , 10 14 Waldir Peres , 11 13 12.ª reunião de cúpula do G20 , 12 13 Red Velvet , 13 13 Fortaleza Esporte Clube , 14 12 A Casa (1.ª temporada) , 15 12 Copa das Confederações FIFA de 2017 , 16 12 Pretty Little Liars (série de televisão) , 17 12 Clube de Regatas do Flamengo , 18 11 Witness (álbum de Katy Perry) , 19 11 Raven's Home , 20 11 Mulher-Maravilha (filme) , 21 11 Harry Styles , 22 11 Romelu Lukaku , 23 11 Márcio Rodrigues Araújo , 24 11 Sociedade Esportiva Palmeiras , 25 11 São Paulo (estado)

ago 2017: 1 21 A Força do Querer , 2 18 Reinaldo Rueda , 3 18 Neymar , 4 17 Pabllo Vittar , 5 16 Mortes em agosto de 2017 , 6 15 Atentados na Catalunha em 2017 , 7 15 Game of Thrones , 8 15 Paris Saint-Germain Football Club , 9 15 Luiz Inácio Lula da Silva , 10 14 José Paulo Bezerra Maciel Junior , 11 13 Dilma Rousseff , 12 12 Sua Cara , 13 12 Descendants 2 , 14 12 Novo Mundo (telenovela) , 15 12 Ousmane Dembélé , 16 12 João Doria , 17 12 Paulo Silvino , 18 12 Fernando Pimentel , 19 11 Miss Brasil 2017 , 20 11 Joanne World Tour , 21 11 Liga dos Campeões da UEFA de 2017–18 , 22 11 Patriota (Brasil) , 23 11 NSC TV , 24 11 Michel Temer , 25 11 Luiz Melodia

set 2017: 1 27 Marcelo Rezende , 2 23 A Fazenda: Nova Chance , 3 20 A Força do Querer , 4 18 Furacão Irma , 5 17 Mortes em setembro de 2017 , 6 15 Rogéria , 7 14 Pega Pega , 8 14 Copa Libertadores da América de 2017 , 9 14 A Fazenda , 10 13 Tempo de Amar (telenovela) , 11 12 Polícia Federal: A Lei É para Todos , 12 12 Patriota (Brasil) , 13 12 Baltimore Ravens , 14 11 Exathlon Brasil , 15 11 Raven's Home , 16 11 Eliminatórias da Copa do Mundo FIFA de 2018 , 17 11 Farah Jorge Farah , 18 11 Santander Cultural , 19 11 Seleção Brasileira de Futebol , 20 11 Santos Futebol Clube , 21 11 Cassini-Huygens , 22 10 Look What You Made Me Do , 23 10 Raquel Dodge , 24 10 Liga dos Campeões da UEFA de 2017–18 , 25 10 Ouro Verde (telenovela)

out 2017: 1 24 O Outro Lado do Paraíso , 2 21 Catalunha , 3 19 A Fazenda: Nova Chance , 4 16 Eliminatórias da Copa do Mundo FIFA de 2018 , 5 16 Clube de Regatas do Flamengo , 6 14 Mortes em outubro de 2017 , 7 14 Governo Michel Temer , 8 14 Tom Petty , 9 14 Brasil , 10 13 Reconhecimento internacional da independência da Catalunha , 11 13 Tiroteio de Las Vegas Strip em 2017 , 12 13 A Força do Querer , 13 12 República Catalã (2017) , 14 12 Incêndios florestais em Portugal de outubro de 2017 , 15 12 Massacre de Janaúba , 16 12 Eliminatórias da Copa do Mundo FIFA de 2018 - Europa , 17 11 Estação Ferroviária de Cachoeira Paulista , 18 11 Copa do Mundo FIFA Sub-17 de 2017 , 19 11 Copa Intercontinental , 20 11 Santos Futebol Clube , 21 11 15 de outubro , 22 10 Onda conservadora , 23 10 Referendo sobre a independência da Catalunha em 2017 , 24 10 Witness: The Tour , 25 10 Papá a toda madre

nov 2017: 1 25 Mortes em novembro de 2017 , 2 18 Robert Mugabe , 3 17 A Fazenda: Nova Chance , 4 15 Márcia Cabrita , 5 15 William Waack , 6 13 Golpe de Estado no Zimbabwe em 2017 , 7 13 Copa Libertadores da América de 2018 , 8 12 Campeonato Brasileiro de Futebol de 2017 - Série B , 9 12 Black Friday , 10 11 Eliminatórias da Copa do Mundo FIFA de 2018 - Europa (segunda fase) , 11 11 O Outro Lado do Paraíso , 12 11 Stranger Things , 13 11 Flávia Viana , 14 11 Liga da Justiça (filme) , 15 11 Colin Kâzım-Richards , 16 11 Sport Club Corinthians Paulista , 17 10 ARA San Juan (S-42) , 18 10 Sismo de Kermanshah de 2017 , 19 10 Rodrigo José , 20 10 Raven's Home , 21 10 A Força do Querer , 22 10 Governo Michel Temer , 23 10 Copa Libertadores da América de 2017 , 24 10 Thor: Ragnarok , 25 10 Canal do Otário

dez 2017: 1 22 Copa Libertadores da América de 2018 , 2 21 O Outro Lado do Paraíso , 3 21 Copa do Mundo de Clubes da FIFA de 2017 , 4 16 A Fazenda: Nova Chance , 5 15 Celebridade (telenovela) , 6 15 Movimento Democrático Brasileiro (1980) , 7 15 Grêmio Foot-Ball Porto Alegrense , 8 14 Deus Salve o Rei , 9 14 Mortes em dezembro de 2017 , 10 14 Flávia Viana , 11 14 Eva Todor , 12 14 Coritiba Foot Ball Club , 13 13 Vai Malandra , 14 13 Star Wars: Episódio VIII - Os Últimos Jedi , 15 12 Copa do Brasil de Futebol de 2018 , 16 12 A Força do Querer , 17 12 Pabllo Vittar , 18 12 August Ames , 19 11 Luiz Cezar Fernandes , 20 11 Melhores do Ano de 2017 , 21 11 Camila (álbum) , 22 11 Romarinho , 23 11 Antoine Griezmann , 24 11 Róger Guedes , 25 11 Marcelo Grohe

jan 2018: 1 24 Copa São Paulo de Futebol Júnior de 2018 , 2 23 Mortes em janeiro de 2018 , 3 22 Luiz Inácio Lula da Silva , 4 21 Copa São Paulo de Futebol Júnior , 5 20 Deus Salve o Rei , 6 20 Big Brother Brasil 18 , 7 19 O Outro Lado do Paraíso , 8 18 Dolores O'Riordan , 9 17 Yerry Mina , 10 17 2018 , 11 16 Cristiane Brasil , 12 14 Processos e investigações envolvendo Luiz Inácio Lula da Silva , 13 14 Philippe Coutinho , 14 13 Marlos Moreno , 15 13 George Weah , 16 13 Big Brother Brasil , 17 12 Júnior Bake Off Brasil , 18 12 Pega Pega , 19 12 Anderson Martins , 20 11 Jojo Maronttinni , 21 11 Copa Libertadores da América de 2018 , 22 11 Harry Kane , 23 11 Pierre-Emerick Aubameyang , 24 11 Partido Social Liberal , 25 10 Halsey (cantora)

fev 2018: 1 20 Big Brother Brasil 18 , 2 18 Mortes em fevereiro de 2018 , 3 18 Jojo Maronttinni , 4 17 Resultados do Carnaval do Rio de Janeiro em 2018 , 5 16 O Outro Lado do Paraíso , 6 15 Copa do Brasil de Futebol de 2018 , 7 14 Tesla Roadster de Elon Musk , 8 12 Intervenção federal no Rio de Janeiro em 2018 , 9 12 Campeonato Carioca de Futebol de 2018 , 10 11 Resultados do Carnaval de São Paulo em 2018 , 11 11 Copa Libertadores da América de 2018 , 12 11 Tempo de Amar (telenovela) , 13 11 Eclipse lunar de 31 de janeiro de 2018 , 14 11 Henrique Dourado , 15 11 Jogos Olímpicos de Inverno de 2018 , 16 11 El Chavo del Ocho , 17 10 Que Tiro Foi Esse , 18 10 Deus Salve o Rei , 19 10 Recopa Sul-Americana de 2018 , 20 10 Simone & Simaria , 21 10 Associação Atlética Aparecidense , 22 10 Billy Graham , 23 9 MC Loma , 24 9 RuPaul's Drag Race: All Stars (3.ª temporada) , 25 9 Pabllo Vittar

mar 2018: 1 44 Marielle Franco , 2 27 O Mecanismo , 3 22 Tônia Carrero , 4 19 Mortes em março de 2018 , 5 18 Copa do Brasil de Futebol de 2018 , 6 18 Big Brother Brasil 18 , 7 17 Assassinato de Marielle Franco , 8 16 RuPaul's Drag Race: All Stars (3.ª temporada) , 9 14 MC Loma , 10 14 Oscar 2018 , 11 14 Lauren Jauregui , 12 14 Davide Astori , 13 12 Liga dos Campeões da UEFA de 2017–18 , 14 11 O Outro Lado do Paraíso , 15 11 Pedro Pablo Kuczynski , 16 11 USS Lexington (CV-2) , 17 11 Carlos Eduardo Miranda , 18 11 Grenal , 19 11 Rinoceronte-branco , 20 11 Ciro Gomes , 21 11 Partido Socialismo e Liberdade , 22 11 Santos Futebol Clube , 23 10 Campeonato Carioca de Futebol de 2018 , 24 10 Henrique Dourado , 25 10 41.º batalhão (PMERJ)

abr 2018: 1 28 Luiz Inácio Lula da Silva , 2 21 Big Brother Brasil 18 , 3 19 Avicii , 4 18 Mortes em abril de 2018 , 5 18 O Mecanismo , 6 16 Segundo Sol , 7 15 Prisão de Luiz Inácio Lula da Silva , 8 15 Camila Cabello , 9 15 Big Brother Brasil , 10 14 Aster Petróleo , 11 13 Campeonato Brasileiro de Futebol de 2018 - Série D , 12 13 The Voice Kids (Brasil) , 13 13 Segmentação (processamento de imagem) , 14 12 Copa do Nordeste de Futebol de 2019 , 15 12 Lista dos campeões estaduais de futebol do Brasil em 2018 , 16 12 Paulo Henrique Sampaio Filho , 17 12 2018 , 18 12 Sport Club Corinthians Paulista , 19 11 Bombardeio de Damasco e Homs em 2018 , 20 11 Copa do Brasil de Futebol de 2018 , 21 11 O Outro Lado do Paraíso , 22 11 Facebook , 23 11 Partido Social Liberal , 24 11 Santa Catarina , 25 11 Clube de Regatas do Flamengo

mai 2018: 1 33 Greve dos caminhoneiros no Brasil em 2018 , 2 24 Segundo Sol , 3 23 Meghan Markle , 4 20 Mortes em maio de 2018 , 5 19 Copa Libertadores da América de 2018 , 6 17 As Aventuras de Poliana , 7 17 Henrique, Duque de Sussex , 8 16 Edifício Wilton Paes de Almeida , 9 16 Campeonato Brasileiro de Futebol de 2018 - Série D , 10 15 ImageJ , 11 14 Raffa Moreira , 12 13 Incêndio no Edifício Wilton Paes de Almeida , 13 13 O Outro Lado do Paraíso , 14 12 Convocações para a Copa do Mundo FIFA de 2018 , 15 12 RuPaul's Drag Race (10.ª temporada) , 16 12 Power Couple (3.ª temporada) , 17 12 Avengers 4 , 18 12 Liga dos Campeões da UEFA de 2017–18 , 19 12 Lana Del Rey , 20 12 Partido Social Liberal , 21 12 Sapucaí-Mirim , 22 12 25 de maio , 23 12 Luiz Inácio Lula da Silva , 24 11 Luccas Neto , 25 11 Campeonato Brasileiro de Futebol de 2018 - Série A

jun 2018: 1 21 Copa do Mundo FIFA de 2018 – Grupo F , 2 20 Neymar , 3 20 Seleção Brasileira de Futebol , 4 19 Greve dos caminhoneiros no Brasil em 2018 , 5 19 Copa do Mundo FIFA de 2018 – Grupo G , 6 19 Copa do Mundo FIFA de 2018 – Grupo D , 7 19 Copa do Mundo FIFA de 2018 – Grupo A , 8 18 Mortes em junho de 2018 , 9 18 XXXTentacion , 10 17 Copa do Mundo FIFA de 2018 – Grupo H , 11 16 Copa do Mundo FIFA de 2018 – Fase final , 12 16 Copa do Mundo FIFA de 2018 – Grupo B , 13 16 Copa do Mundo FIFA de 2018 – Grupo C , 14 15 Rodrygo Goes , 15 15 Thiago Silva , 16 15 Itália , 17 14 Segundo Sol , 18 14 Copa do Mundo FIFA de 2018 – Grupo E , 19 14 Pedro Parente , 20 14 Seleção Suíça de Futebol , 21 14 Maria Esther Bueno , 22 13 Campeonato Brasileiro de Futebol de 2018 - Série A , 23 13 Campeonato Brasileiro de Futebol de 2018 - Série D , 24 13 Pedro Sánchez , 25 12 Convocações para a Copa do Mundo FIFA de 2018

Wikipedias are initially ordered by number of speakers of the language

Speakers: Number of speakers of a language is the estimated total of primary and secondary speakers, is in many cases a very rough estimation (based on the page on the English Wikipedia about that language)
Regions are parts of the world where the language is spoken in substantial amounts (compared to total number of speakers). Regions where a language gained presence only by a recent diaspora are generally not included.
Region codes: AF:Africa, AS:Asia, EU:Europe, NA:North America, OC:Oceania, SA:South America, W:World Wide, CL:Constructed Language

Estatísticas geradas em Sábado, 7 de julho 2018 23:10

Dump file ptwiki-20180701-stub-meta-history.xml.gz (edits only), size 3.3 Gb as gz -> 21 Gb
Dump processed till Jun 30, 2018, on server stat1005, ready at Tue-03/07/2018-10:36 after 2 hrs, 48 min, 51 sec.

Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### =
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.