Estatísticas da Wikipédia português

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Articles per size range / Records per namespace / Most edited articles / Zeitgeist
 
  Dec 2017: WMF Analytics Team is happy to announce the first release of Wikistats 2
  

  Wikistats has been redesigned for architectural simplicity, faster data processing, and a more dynamic and interactive user experience. The data used in the reports will also be made available for external processing.  

  First goal is to match the numbers of the current system, and to provide the most important reports, as decided by the Wikistats community (see survey).  
  Over time, we will continue to migrate reports and add new ones that you find useful. We can also analyze the data in new and interesting ways, and look forward to hearing your feedback and suggestions.  

  You can go directly to Wikipedia português

  

Most metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.

Some metrics have been collected from the full archive dump which runs on lower frequency than the usual monthly cycle.
These metrics are columns F,I,J,K,M,N,O,P,Q,R from the first table.


See also metrics definitions


 
Monthly counts & Quarterly rankings: março 2018
 
DataWikipedistasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
mar 20180% +5%+22%0% +16%    +28%      0%
fev 20180% -12%-14%0% -26%    -21%      0%
jan 2018+1% +5%-0%0% +47%    +1%      0%
dez 2017+1% +5%+1%0% -6%    -10%      +1%
nov 2017+1% +2%-1%0% +11%    -6%      +1%
out 20170% -3%+4%0% +27%    +25%      0%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P____Q____R____S__
mar 2018532032531512234996 k 12935,5   200 k      767 k
fev 2018529502441444192992 k 11135,5   157 k      764 k
jan 2018527063041639223989 k 15035,4   199 k      762 k
dez 2017524022961559224985 k 10235,4   197 k      759 k
nov 2017521062851489221982 k 10935,3   220 k      755 k
out 2017518212251455223978 k 9835,2   233 k      751 k
set 2017515963321499215975 k 7735,1   187 k      748 k
ago 2017512642551417208973 k 8735   199 k      746 k
jul 2017510092811536212970 k 9534,9   207 k      744 k
jun 2017507282551432205967 k 9234,8   169 k      741 k
mai 2017504732901535206965 k 9134,7   167 k      739 k
abr 2017501833741590219962 k 11834,6   190 k      737 k
mar 2017498093101551214958 k 18334,5   202 k      734 k
fev 2017494993101471203952 k 13034,5   176 k      731 k
jan 2017491893871718223949 k 12134,5   199 k      729 k
dez 2016488023241577204945 k 13234,4   171 k      725 k
nov 2016484783131536210941 k 18934,4   184 k      723 k
out 2016481653021534193935 k 12334,4   177 k      719 k
set 2016478633051481184932 k 12934,3   186 k      717 k
ago 2016475582841403206928 k 14534,3   194 k      714 k
jul 2016472743491574210923 k 14134,2   196 k      711 k
jun 2016469253451518191919 k 16734,2   207 k      708 k
mai 2016465802931498194914 k 10734,1   201 k      706 k
abr 2016462872521375190910 k 12434   191 k      703 k
mar 2016460353101454178907 k 16734   203 k      700 k
fev 2016457252681405189902 k 12433,9   227 k      697 k
jan 2016454573501541211898 k 22833,8   211 k      692 k
dez 2015451072841450190891 k 19033,9   203 k      687 k
nov 2015448232991378183885 k 10833,9   221 k      683 k
out 2015445243051448176882 k 11433,7   191 k      680 k
set 2015442192591343178878 k 13833,7   208 k      677 k
ago 2015439603251500187874 k 12133,6   193 k      673 k
jul 2015436353951599194870 k 12633,5   194 k      670 k
jun 2015432403781574179866 k 11133,4   189 k      667 k
mai 2015428623211519183863 k 11233,3   191 k      664 k
abr 2015425413161506204860 k 10833,2   192 k      661 k
mar 2015422253281565200856 k 8133,1   175 k      658 k
fev 2015418973781606181854 k 11333   166 k      656 k
jan 2015415194151681204851 k 12633   176 k      654 k
dez 2014411043011530178847 k 26032,9   170 k      651 k
nov 2014408033341523165839 k 17533   239 k      648 k
out 2014404692931390166833 k 11832,9   178 k      636 k
set 2014401763111452159830 k 20232,9   162 k      629 k
ago 2014398654081634160824 k 12732,9   182 k      626 k
jul 2014394573241540156820 k 10032,9   150 k      624 k
jun 2014391333351492150817 k 11632,8   195 k      621 k
mai 2014387982981407154813 k 9132,7   183 k      619 k
abr 2014385002771370169810 k 9032,6   181 k      616 k
mar 2014382233211503177808 k 9732,5   194 k      613 k
fev 2014379022491376177805 k797 k11932,4239689%32%163 k2,9 Gb350 M18,3 M79 k65 k2,2 M611 k
jan 2014376533241514187801 k794 k27532,3239289%32%173 k2,9 Gb347 M18,2 M79 k64 k2,2 M608 k
dez 2013373292431364168793 k785 k22332,4238889%32%229 k2,8 Gb342 M18,0 M77 k63 k2,2 M604 k
nov 2013370862171319151786 k778 k7132,4237688%32%157 k2,8 Gb337 M17,8 M76 k62 k2,0 M601 k
out 2013368692361325151784 k776 k8632,3237488%32%143 k2,8 Gb334 M17,7 M76 k61 k2,0 M598 k
set 2013366332201346160781 k774 k12532,2236688%32%155 k2,7 Gb331 M17,6 M76 k61 k2,0 M595 k
ago 2013364132351403195777 k770 k20132,2235988%31%164 k2,7 Gb328 M17,5 M74 k60 k2,0 M592 k
jul 2013361783191540207771 k764 k14732,2235588%31%200 k2,7 Gb325 M17,4 M79 k59 k1,9 M590 k
jun 2013358593241566195767 k759 k9932,2234788%31%221 k2,6 Gb321 M17,2 M82 k57 k1,9 M587 k
mai 2013355354041682218764 k756 k16232234188%31%252 k2,6 Gb318 M17,1 M87 k56 k1,9 M584 k
abr 2013351313251621204759 k751 k13531,9234088%31%265 k2,6 Gb315 M17,0 M93 k54 k1,8 M580 k
mar 2013348063181582190755 k747 k11831,7233388%31%746 k2,6 Gb311 M16,9 M206 k53 k1,8 M577 k
fev 2013344882741522199751 k743 k11530,9232988%31%272 k2,7 Gb308 M16,8 M7,4 M52 k1,8 M574 k
jan 2013342143251765215748 k740 k14230,6232288%30%307 k2,7 Gb305 M16,7 M7,3 M51 k1,8 M571 k
dez 2012338893131547211743 k736 k13830,4231588%30%283 k2,7 Gb301 M16,5 M7,2 M50 k1,7 M567 k
nov 2012335762651515186739 k731 k11030,2231087%30%240 k2,6 Gb298 M16,4 M7,1 M48 k1,7 M564 k
out 2012333112691476183736 k728 k11430230687%30%283 k2,6 Gb295 M16,3 M7,0 M47 k1,7 M561 k
set 2012330422941510189732 k725 k13929,7230087%30%251 k2,6 Gb292 M16,2 M6,9 M47 k1,7 M559 k
ago 2012327482741562201728 k722 k17829,6229587%29%309 k2,5 Gb289 M16,1 M6,8 M46 k1,6 M557 k
jul 2012324743391704226723 k714 k18829,4228887%29%304 k2,5 Gb285 M15,9 M6,7 M45 k1,6 M554 k
jun 2012321353231662209717 k708 k12529,2228087%29%251 k2,5 Gb281 M15,7 M6,6 M43 k1,6 M549 k
mai 2012318123401640222713 k705 k13229227387%29%270 k2,4 Gb278 M15,6 M6,5 M42 k1,5 M546 k
abr 2012314722981589199709 k700 k10128,8226587%29%258 k2,4 Gb275 M15,4 M6,4 M42 k1,5 M543 k
mar 2012311742851561218706 k698 k10528,5225687%28%250 k2,4 Gb272 M15,3 M6,3 M41 k1,5 M541 k
fev 2012308893101611216703 k694 k12828,3224787%28%306 k2,4 Gb269 M15,2 M6,2 M40 k1,5 M538 k
jan 2012305793371715259699 k690 k12328223386%28%303 k2,3 Gb266 M15,1 M6,2 M38 k1,4 M536 k
dez 2011302423361639217695 k686 k12927,7221986%28%258 k2,3 Gb262 M14,9 M6,1 M38 k1,4 M534 k
nov 2011299062801466190691 k682 k10727,5220886%28%247 k2,3 Gb258 M14,8 M6,0 M37 k1,4 M531 k
out 2011296262741542214688 k679 k13027,3220186%27%250 k2,3 Gb256 M14,7 M5,9 M35 k1,4 M528 k
set 2011293522911603216684 k675 k12127,1219486%27%250 k2,2 Gb252 M14,5 M5,9 M34 k1,3 M525 k
ago 2011290613181639235680 k672 k12326,9218386%27%280 k2,2 Gb249 M14,4 M5,8 M33 k1,3 M522 k
jul 2011287433431709245676 k668 k12826,6217286%27%308 k2,2 Gb246 M14,3 M5,8 M31 k1,3 M519 k
jun 2011284003441665203672 k664 k10526,3215886%27%271 k2,1 Gb243 M14,1 M5,7 M30 k1,3 M517 k
mai 2011280563181583213669 k661 k11826214486%26%301 k2,1 Gb240 M14,0 M5,6 M29 k1,3 M515 k
abr 2011277383101598216666 k657 k12825,7213386%26%313 k2,1 Gb237 M13,9 M5,5 M28 k1,2 M512 k
mar 2011274283361648211662 k653 k15825,4212386%26%290 k2,1 Gb234 M13,7 M5,4 M27 k1,2 M510 k
fev 2011270923801691231657 k648 k16625,1211585%26%260 k2,0 Gb230 M13,6 M5,3 M26 k1,2 M507 k
jan 2011267124051933266652 k643 k21524,9210785%26%326 k2,0 Gb227 M13,5 M5,2 M25 k1,2 M504 k
dez 2010263074111741241646 k636 k84624,7209885%25%311 k2,0 Gb223 M13,3 M5,2 M24 k1,1 M500 k
nov 2010258963331638210619 k610 k56925,2212385%26%280 k1,9 Gb217 M13,0 M5,1 M23 k1,1 M495 k
out 2010255633441601202602 k592 k16425,5212484%26%245 k1,9 Gb211 M12,7 M5,0 M22 k1,0 M492 k
set 2010252193601613228597 k587 k19325,3211784%25%259 k1,8 Gb208 M12,5 M4,9 M21 k1,0 M489 k
ago 2010248593661683219591 k581 k40525,1211284%25%303 k1,8 Gb205 M12,4 M4,8 M21 k981 k486 k
jul 2010244934081741229579 k568 k23425,1211284%25%276 k1,8 Gb200 M12,1 M4,7 M19 k933 k483 k
jun 2010240853661667205572 k561 k19724,9210484%25%294 k1,7 Gb196 M11,9 M4,6 M17 k908 k480 k
mai 2010237194111819218566 k555 k59524,7209884%25%404 k1,7 Gb193 M11,8 M4,5 M16 k887 k477 k
abr 2010233084461843239547 k536 k26624,8212483%25%328 k1,6 Gb188 M11,4 M4,4 M15 k848 k472 k
mar 2010228624321775236539 k528 k27124,5212483%25%305 k1,6 Gb184 M11,2 M4,3 M14 k824 k467 k
fev 2010224304291775228531 k519 k23124,3212083%24%281 k1,6 Gb180 M11,0 M4,2 M14 k799 k463 k
jan 2010220014421887239524 k512 k24024,1211683%24%289 k1,5 Gb176 M10,8 M4,2 M14 k777 k459 k
dez 2009215594241678204517 k504 k24723,9211482%24%280 k1,5 Gb172 M10,6 M4,1 M13 k755 k455 k
nov 2009211353751615192509 k496 k29023,7211182%24%260 k1,5 Gb168 M10,4 M4,0 M13 k734 k450 k
out 2009207603981743189501 k487 k18723,6211682%24%313 k1,4 Gb165 M10,2 M3,9 M12 k711 k446 k
set 2009203624251769214495 k481 k17423,2211082%23%267 k1,4 Gb161 M10,0 M3,9 M12 k692 k442 k
ago 2009199374411883229489 k476 k25522,9209882%23%290 k1,4 Gb159 M9,9 M3,8 M12 k676 k438 k
jul 2009194964761863234482 k468 k23122,7208382%23%261 k1,4 Gb155 M9,7 M3,7 M12 k655 k433 k
jun 2009190204061701223474 k461 k22422,5206581%23%262 k1,3 Gb151 M9,5 M3,6 M11 k634 k427 k
mai 2009186144241779216468 k454 k21622,3204681%23%269 k1,3 Gb148 M9,3 M3,6 M10 k615 k423 k
abr 2009181904091663206461 k448 k20122203081%22%248 k1,3 Gb144 M9,1 M3,5 M8,9 k597 k418 k
mar 2009177814121677219455 k442 k21721,8201081%22%243 k1,2 Gb141 M8,9 M3,4 M7,5 k581 k414 k
fev 2009173693891641207448 k435 k24821,6199581%22%251 k1,2 Gb138 M8,8 M3,4 M5,6 k564 k410 k
jan 2009169804811804242441 k428 k23421,3197881%22%262 k1,2 Gb135 M8,6 M3,3 M4,6 k544 k405 k
dez 2008164993791576223434 k421 k20721,1195781%21%246 k1,2 Gb131 M8,4 M3,2 M2,8 k521 k399 k
nov 2008161203971582208428 k415 k20320,8193781%21%257 k1,1 Gb128 M8,2 M3,1 M1,1 k504 k393 k
out 2008157233741600194422 k409 k23620,5192081%21%254 k1,1 Gb125 M8,0 M3,1 M26 k488 k389 k
set 2008153494191659197414 k403 k18220,3190181%20%306 k1,1 Gb122 M7,8 M3,0 M24 k461 k384 k
ago 2008149304381702221409 k397 k23619,8187880%20%272 k1,0 Gb119 M7,7 M2,9 M100 k446 k380 k
jul 2008144924961855234401 k391 k24019,5186280%20%262 k1,0 Gb116 M7,5 M2,8 M97 k430 k375 k
jun 2008139964461718213394 k384 k91819,2184480%19%305 k1016 Mb112 M7,2 M2,7 M95 k413 k369 k
mai 2008135504671813224366 k355 k21819,8188079%20%295 k954 Mb107 M6,8 M2,5 M93 k390 k350 k
abr 2008130834891732220360 k348 k19319,3185979%20%250 k926 Mb103 M6,6 M2,4 M91 k370 k345 k
mar 2008125944161659219354 k342 k21118,9183778%20%261 k900 Mb101 M6,5 M2,3 M89 k357 k341 k
fev 2008121784781671203347 k336 k22818,5182278%19%268 k876 Mb98,0 M6,3 M2,3 M88 k345 k335 k
jan 2008117005201795222341 k329 k22618,1180478%19%255 k853 Mb95,2 M6,2 M2,2 M86 k332 k326 k
dez 2007111804471599203334 k321 k23517,7178478%19%232 k826 Mb92,2 M6,0 M2,1 M86 k319 k320 k
nov 2007107334721667186327 k314 k22017,4177377%18%229 k804 Mb89,5 M5,8 M2,1 M84 k306 k313 k
out 2007102614881708219320 k308 k146717,1174977%18%323 k778 Mb86,5 M5,7 M2,0 M81 k293 k307 k
set 200797734511589200274 k263 k20418,7178975%20%238 k664 Mb75,9 M4,8 M1,8 M78 k204 k300 k
ago 200793224281475189268 k257 k19118,2177074%19%251 k642 Mb73,3 M4,7 M1,7 M75 k193 k295 k
jul 200788944261516191262 k251 k23717,7175074%19%237 k620 Mb70,7 M4,5 M1,7 M77 k184 k261 k
jun 200784684311497190255 k243 k23417,3173074%19%205 k595 Mb67,9 M4,3 M1,6 M75 k174 k234 k
mai 200780374671544186248 k237 k20516,9171573%18%264 k573 Mb65,4 M4,2 M1,6 M72 k166 k216 k
abr 200775704831520165242 k230 k19816,3171878%18%203 k558 Mb63,2 M4,0 M1,5 M72 k158 k209 k
mar 200770874481490179236 k224 k18315,8169878%18%232 k538 Mb60,9 M3,9 M1,4 M67 k150 k205 k
fev 200766393631266150230 k218 k18515,2167977%17%184 k518 Mb58,6 M3,8 M1,4 M64 k143 k191 k
jan 200762763871298191225 k213 k70614,8166077%17%257 k499 Mb56,4 M3,6 M1,3 M60 k137 k180 k
dez 200658894431303188203 k190 k37815,1167575%18%325 k456 Mb51,7 M3,2 M1,2 M55 k129 k175 k
nov 200654463821248176191 k178 k25014,3166174%18%221 k423 Mb48,2 M3,0 M1,1 M52 k123 k74 k
out 200650644291250158184 k172 k18513,7163474%17%210 k401 Mb45,5 M2,8 M1,1 M47 k116 k69 k
set 200646354061238158178 k166 k29212,9159973%16%180 k382 Mb43,0 M2,7 M1,0 M44 k107 k65 k
ago 200642294201197162169 k159 k35812,6158273%16%193 k359 Mb40,2 M2,5 M982 k41 k101 k60 k
jul 200638093921119150158 k148 k32412,2152972%15%187 k326 Mb36,3 M2,3 M918 k31 k87 k55 k
jun 20063417327979128148 k138 k34911,8149871%15%184 k298 Mb33,3 M2,1 M836 k27 k80 k50 k
mai 20063090320945128138 k127 k32811,3149470%15%152 k276 Mb30,9 M1,9 M758 k25 k74 k46 k
abr 20062770293859124128 k118 k21011147868%14%168 k254 Mb28,4 M1,8 M709 k22 k62 k42 k
mar 20062477296853127121 k110 k18110,2144168%14%133 k236 Mb26,3 M1,7 M628 k20 k56 k39 k
fev 20062181315807114116 k105 k2129,6140067%13%117 k220 Mb24,3 M1,6 M567 k18 k51 k35 k
jan 20061866266689101110 k99 k6169136067%12%160 k202 Mb22,3 M1,5 M534 k16 k46 k31 k
dez 200516001645008891 k80 k2029,2141861%13%91 k169 Mb19,2 M1,2 M469 k13 k39 k27 k
nov 200514361424206984 k74 k1268,8139559%13%69 k155 Mb17,6 M1,1 M430 k11 k35 k24 k
out 200512941234006781 k70 k1218,3136558%12%66 k145 Mb16,3 M1,1 M398 k11 k32 k22 k
set 20051171993344877 k67 k1627,9132657%12%52 k134 Mb15,1 M983 k356 k9,3 k29 k20 k
ago 200510721133546172 k62 k4097,7131657%12%71 k125 Mb14,0 M914 k341 k8,6 k27 k19 k
jul 20059591273566559 k50 k1368,1136153%13%62 k104 Mb12,1 M747 k293 k7,6 k24 k16 k
jun 20058321032956055 k46 k1577,6119052%12%80 k86 Mb9,9 M651 k263 k5,8 k19 k14 k
mai 2005729942685450 k39 k3696,7113251%11%65 k75 Mb8,6 M583 k240 k4,3 k17 k12 k
abr 2005635942565239 k29 k1467116941%13%42 k59 Mb7,0 M428 k198 k3,3 k15 k9,4 k
mar 2005541681843634 k25 k786,7114740%13%29 k51 Mb6,1 M370 k176 k2,4 k12 k7,7 k
fev 2005473551712932 k23 k736,3110937%12%27 k45 Mb5,4 M329 k164 k2,0 k10 k6,6 k
jan 2005418501533630 k21 k625,8107535%11%20 k41 Mb4,9 M296 k148 k1,8 k9,1 k5,7 k
dez 2004368641573528 k19 k615,599733%11%24 k37 Mb4,3 M262 k141 k1,5 k7,7 k4,9 k
nov 2004304631453026 k17 k62592930%10%23 k32 Mb3,7 M232 k128 k8796,1 k4,0 k
out 200424131992824 k16 k584,486328%9%17 k28 Mb3,2 M201 k121 k7265,1 k3,2 k
set 200421037972523 k14 k282480425%8%25 k25 Mb2,8 M172 k112 k4734,1 k2,6 k
ago 200417325752214 k8,2 k544,699635%11%14 k17 Mb2,1 M134 k36 k3783,3 k2,2 k
jul 200414841772112 k6,6 k1304,293333%9%16 k14 Mb1,8 M105 k31 k3332,6 k1,8 k
jun 20041071351138,4 k4,8 k504,2103335%10%9,9 k11 Mb1,3 M73 k21 k3052,0 k1,2 k
mai 2004942451136,9 k3,9 k543,798434%10%7,5 k8,6 Mb1,0 M54 k15 k2401,6 k889
abr 200470204285,2 k2,6 k323,497033%10%5,2 k6,4 Mb750 k38 k8,2 k841,2 k686
mar 200450173364,3 k2,0 k58390031%9%5,5 k5,1 Mb559 k28 k5,6 k76763534
fev 20043371532,5 k1,4 k353113737%12%3,9 k3,8 Mb398 k18 k4,0 k26574375
jan 20042641111,4 k86282,4147037%16%9022,5 Mb274 k11 k2,0 k16408257
dez 20032236 1,2 k72712,1177741%17%2632,2 Mb251 k8,9 k65010311153
nov 200319   1,2 k705 1,9179441%17% 2,2 Mb245 k8,6 k19910323146
out 20031911 1,2 k70511,9179441%17%1282,2 Mb245 k8,6 k19910323146
set 200318   1,1 k68021,9179741%17%1182,1 Mb238 k8,4 k15410321139
ago 2003181311,1 k65471,8176741%17%5032,0 Mb224 k7,7 k882278136
jul 20031714 86346231,7193337%18%1951,8 Mb184 k5,9 k733254124
jun 20031627 76340331,7203037%19%1841,6 Mb172 k5,2 k563235116
mai 20031415 66934641,7186936%17%1841,3 Mb140 k4,4 k511203111
abr 20031312 55627221,7189333%16%981,0 Mb114 k3,6 k51 17394
mar 200312 3 50325811,7192634%16%51948 kb112 k3,5 k51 16187
fev 20031215 48024431,6176233%16%127855 kb99 k3,2 k51 15784
jan 20031133 40420231,6186232%17%148765 kb90 k2,9 k51 15076
dez 2002811 31615911,6203934%17%67640 kb78 k2,3 k5 10964
nov 2002711 28413611,6214532%17%35599 kb74 k2,2 k1 10760
out 2002611 25912511,6216333%18%42568 kb69 k2,1 k1 9160
set 2002511 23610911,6218932%19%29521 kb64 k1,9 k1 8257
ago 20024   214107 1,6219335%21%29506 kb63 k1,9 k1 8253
jul 20024   20410411,5226335%21%24495 kb62 k1,9 k1 8247
jun 20024 1 1879911,5227437%22%42476 kb60 k1,8 k1 7146
mai 2002411 16088 1,5257839%26%21463 kb59 k1,8 k1 6943
abr 20023   14684 1,5285843%29%6461 kb58 k1,7 k1 6938
mar 20023   14184 1,6287945%30%16459 kb58 k1,7 k1 6938
fev 20023   13379 1,5270644%29%10419 kb53 k1,6 k  6236
jan 20023   12774 1,5256243%28%6388 kb47 k1,5 k  4536
dez 20013   12472 1,5257242%28%12373 kb46 k1,5 k  4535
nov 20013 1 1187011,5267142%30%35371 kb46 k1,5 k  4532
out 2001312 995621,4230938%26%108270 kb33 k1,2 k  2727
set 200121  2315 1,4108239%26%1346 kb3,9 k94  74
ago 20011 1 1613 1,2105144%31%1226 kb3,0 k75  62
jul 20011   54 1,6103960%60%27,5 kb1,2 k31  21
jun 200111  33 299267%67%65,1 kb79024  21
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
The following table ranks this project in relation to projects in other languages with 1000+ articles
jan 2018101091014 1229   14      277
out 20179991014 1531   13      277
jul 201791191014 1932   13      277
abr 20179891014 1732   12      277
jan 20179891114 1532   13      277
out 20168991114 1633   13      277
jul 20168991014 1533   13      277
abr 20168991114 1835   13      277
jan 20168991114 1134   14      277
out 20158891114 2235   10      277
jul 20158991114 1934   10      277
abr 20158991114 1638   12      277
jan 20158991114 1537   12      277
out 20148991114 1540   15      277
jul 20148991114 2147   16      277
abr 20148991114 2248   12      277
jan 20148991114136494432451410111013397277
out 201389911141319504338421410111014397277
jul 20138991112111851463543151091012397277
abr 201389911111019534434431099911397277
jan 2013899111091860412946139997417277
out 2012899111091963433045129997417277
jul 2012899111091766423043109997427277
abr 2012899111091869422742119997427277
jan 2012889101091867422841109997427277
out 201189911109166842283998897437277
jul 2011889111091670432640108887457277
abr 201188910108197443244388887447277
jan 20118889971174422741108887447277
out 201088810108136140264098887457277
jul 2010889109895941244098987478277
abr 2010888109895738284289987518277
jan 201088999995539244491010107539277
out 20098891199135438254281010107539277
jul 20098810119995235214791010107539277
abr 200988101199104836234610101097569277
jan 200978910891145362244910997729276
out 2008781011881045352144910997369274
jul 2008889108810483522421010997139273
abr 2008879108812423322419109971310273
jan 20089791088104333224210109971310269
out 2007971010881413321427109971310267
jul 2007981111889232926348109971311262
abr 20079791388142530143310109971311257
jan 2007991110882232813349109971311254
out 200697910881019291632910997139251
jul 200697911987243217379109971410238
abr 200610810129910253019379991071511233
jan 2006109912993373218488991081412215
out 20051010101299103530264710991081511213
jul 200510101011899292426319991081411202
abr 2005111010129107282840271111111171911195
jan 20051110111291011272635241211111082013191
out 20041215131191011352836281111111082613189
jul 20041491210121662520272210151314222815159
abr 2004161114131620102815241413171418293615142
jan 20041818182420252525415926201821353222126
out 20031524342217192918211532161517331918101
jul 200314231821151620151515152214141630171488
abr 200313212014141516131313132313131422211371
jan 20031110131112121299991411111115151059
out 2002111111911129888811889189944
jul 2002109107109788881088865835
abr 20029810699877771177734720
jan 20028912587933331266622618
out 200156525552222433321413
jul 20016442544222254442138
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
 WikipedistasArtigosBase de dadosLigações

Nota: os valores para os primeiros meses estão muito baixos. O histórico de revisões nem sempre era preservado nos primeiros tempos.

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikipedistas (usuários registrados)
A = Wikipedistas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikipedistas que editaram pelo menos dez vezes desde que chegaram
C = Wikipedistas que contribuíram cinco vezes ou mais este mês
D = Wikipedistas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Artigos que contêm pelo menos uma ligação interna e 200 caracteres de texto legível, não contando códigos wiki e html,
      ligações ocultas, etc.; títulos também não contam (outras colunas são baseadas no método oficial de contagem)
G = Novos artigos por dia no mês passado
H = Número médio de revisões por artigo
I = Tamanho médio dos artigos em bytes
J = Porcentagem de artigos com pelo menos 0,5 kb de texto legível (veja F)
K = Porcentagem de artigos com pelo menos 2 kb de texto legível (veja F)

Base de dados
L = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
M = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
N = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
O = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
P = Total de ligações para outras wikipédias
Q = Total de imagens apresentadas
R = Total de ligações para outros sítios
S = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  2500  10000  25000  5  10  100  1000  10000  100000  1  3  5  10  25  100  250  1000  2500  5  10  100  1000  10000  100000  1  3  5  10  25  100  250  1000  2500  10000  5  10  100  1000  10000 
mar 20185119224515129615332341021651 8863  941351237157854824337722  181066947629316663272  13135  
fev 201847202137144492248719279112  101072  782310203139804116218641  149459640527016057243  14144  
jan 2018514223541639102155922395164  7652  8353612301418239182 6531  1641650441306183642521 13123  
dez 201747942209155994051222499116  101072  872359232150913816417631  150261042129217464231  14144  
nov 20174891216214899455192211071571 101072  9213652521589343244 7731  173474756739420357254  12125  
out 2017464820991455922527223105154117764  1006365253159913718526642  18487395012971747325731121251 
set 20174639213814999775262159214211776   861349233137793316429851  1671627424285168592541 13134  
ago 201745642048141789750320810292117762  85231522214285371442774   1667649467311173672311 12123  
jul 201747922191153696153721211518211111063  8383412381589040235 6531  1617664468319198773021 15145  
jun 20174713207514329275182059781  11104   8953912651789438214 8731  164477758941221668241  15123  
mai 2017507122331535956521206104101  985   871351253158964522416631  171269550233718355162  15144  
abr 2017479522441590103957221996164  7642  891388271170964827316631  166564346731817668232  14134  
mar 2017522922521551988553214100173  995   1071390269175102442041774   207075749733117465223  15144  
fev 201747322124147196751520389122  111073  11163972611701074919415531  19796824683041655722   151421 
jan 2017549425381718107559922399173  996   114145631719710947213 6531  210077654334620574263  15153  
dez 201648462224157796753120488101  7762  1034442294181103441731653   184974652535019676252  14144  
nov 201650762255153694251421099173  10981  10984032741769941184 7532  205581259443624967172  15143  
out 201650072213153494951819385162  876   1041366235148953419715532  187469446629315452171  13132  
set 201651762153148188647718494182  7662  10913812451438537186 6631  15776184312921576218   14122  
ago 201650582092140386048920689204  8863  9883522361509643176 7731  1567605435278156531531 131341 
jul 201653462326157493651421099152  8764  10483792421579140185 663   1906658436288175651732 14144  
jun 201652122315151891748319188142  88651 11153992561549038146 6632  190668848733619150163  12122  
mai 201653432295149890748319497205  9863  10124042691621004118416631  187862742327515253194  13122  
abr 201652102093137583946019090182  8863  98536025816610147164 7741  177858940225914551143  14144  
mar 201651872203145486747517882156  9873  107141427917010746265 663   181358840226915955182  13122  
fev 201646882013140583544318994185118753  91437026015799472131663   172458140727317058183  11102  
jan 201652582259154197252121199195  9964  10854142681649949214 663   1611642462333198641932 1081  
jan 2018514223541639102155922395164  7652  8353612301418239182 6531  1641650441306183642521 13123  
out 2017464820991455922527223105154117764  1006365253159913718526642  18487395012971747325731121251 
jul 201747922191153696153721211518211111063  8383412381589040235 6531  1617664468319198773021 15145  
abr 2017479522441590103957221996164  7642  891388271170964827316631  166564346731817668232  14134  
jan 2017549425381718107559922399173  996   114145631719710947213 6531  210077654334620574263  15153  
out 201650072213153494951819385162  876   1041366235148953419715532  187469446629315452171  13132  
jul 201653462326157493651421099152  8764  10483792421579140185 663   1906658436288175651732 14144  
abr 201652102093137583946019090182  8863  98536025816610147164 7741  177858940225914551143  14144  
jan 201652582259154197252121199195  9964  10854142681649949214 663   1611642462333198641932 1081  
out 201549292154144886545617681152  9963  11194022721628842195 553   156359238925314242161  882  
jul 2015548823661599100950419494172  9862  11553952631589943203 7731  152853036923415451181  973  
abr 2015528722721506925474204106153  9972  101440328117610445246 77442 146055338426514761163  111141 
jan 2015533724701681100652620498131  121294  9363882591669938133 7631  142857842428516064234  12112  
out 201450162147139083743816680181  121296  9023462221357236145 8843  15025723662351224716   882  
jul 20145137230715409454811567181  10954  8593562391247335193 1110643 1541560369222103416   981  
abr 201446882049137084144016980164  98631 937366237149863116317631  14645443792261133492  971  
jan 201446912193151495150018785162  111183  9183932761729339163 10941  142561142127815558153  1292  
out 201342311955132581742615170102  5541  836322228139773110316641  130551837322712844151  1061  
jul 201342732146154096651020793162  121192  94842729718711644194110951  157565547931718859161  131351 
abr 201346272326162197352120485163  16151273 958404290187964821429842  168767349330918165223  1713641
jan 20134829244117651095612215991451 464336133 98046132419510840144 7741  164672954434520367243  3531168 
out 201243422118147691152718379101  504432114 90740027216610338122 76421 14995953982651425314   3330174 
jul 2012472023831704109462522694141  575235153 109651735722412740153 6632111631694486330180712511 3534175 
abr 2012466022801589101356919982133  585335103 104344132321511343152198521 147659041327815559292  3832154 
jan 2012487924291715107162525993122  605839164 117354138423112840171 10862  160172954235618062261  3230145 
out 2011452321981542983564214104122  525038112 105046432521810936112 4321  13985984242761585719   3531176 
jul 20114871242017091086606245105101  544637174 10884893452171164113  54221 145266847431117261221  3430133 
abr 20114682225115981009550216941021 585539176 102747232720110246243 7642  144363645229015657252  3836125 
jan 20115331271519331197658266116171  645840184 120353337323813549233 55321 1518669483333209873021 3531176 
out 2010462722881601100153420296141  615733141 9403982651871134417  4432  138156238726815867221  4035163 
jul 20104863242117411121605229104153  615941152 9754493142021084513  3321  143160444229816758192  3330173 
abr 20105488269818431136615239117192  666041183 112448134021913255201 7743  155862345531119266281  3229154 
jan 20105444273218871167657239111123  635843202 122250335221512548172 7764  159468046929618564203  3531152 
out 2009522325191743106256218995205  575640203 110545332319210644171 2221  15526494332821526017   2623152 
jul 20095269261218631176590234115134  55503718  11495223492171275322  4321  162265145729718173251  2624132 
abr 2009494923741663103552720698154  55533618  112247330719812452202 3311  162863644828615968271  2724142 
jan 20094947255218041099593242108181  494734181 123853737924013858241 4333  173676652433820283411  2725142 
out 2008491023331600951467194102193  59574417  109748531921412656193 109521 1462621440282177793121 3227163 
jul 20084936255918551165616234106154  55544217  124455439225415156233 74441 159068351435022093301  28231131
abr 20084798250117321071537220103172  40382915  128957337823113451193 55411 154668149133018667273  17131031
jan 20084641248317951088576222115174  393729131 127560342628014962297122221 163874952835521180314  211841 
out 2007466323891708103753721991196  413625113 12835973862331375428426532  1592727521332195743131 20179  
jul 200738262092151693952619185112  33322582 102049035521611639173 22221 125760746230317070241  121173 
abr 200742212142152093047316580122  32312192 122253735219610948243133211 136960641026114759252  1715122 
jan 200731451764129886049019182133  28262172 100448634121812541232 22211 124959444330515771252  141121 
out 20063227177012507904251587791  25241261 9183962731688941238 111   124851736023513447191  7622 
jul 200625561513111973842015066112  19161262 7883862851819339193143211 10965133702521465119   864  
abr 200620741175859555307124667   1010962 6012861921337730164 111   90541828719111737151  4431 
jan 20061598927689463262101561121 14131072 5182611871187030153 1     7363572401589137171  773  
out 2005935542400251150672981  1110831 354157104654122132       4231921377943157   442  
jul 2005779471356253136653561  121284  2901611188041146  11    3591791399355208   651  
abr 200553232925617499522771  7532  1961088153301051       235129955936144   321  
jan 20053402081531056836182   431   14786634626141        15182604735134   322  
out 200420113799704628193   1     874935281741        9152433119102        
jul 200413291776943211341  1     61382823142         783931191141        
abr 2004815342331886    21    261614952         362115821         
jan 20042215116311    11    611            8433           
out 200362111                          2              
jul 2003175421           1              1              
abr 20037321                           21             
jan 200373333           2              3              
out 20026211                           1              
jul 200231                            1              
abr 2002                                             
jan 200222                                           
out 200163222                          211            
jul 20011                                            

 

Distribuição de edições de artigos por wikipedistas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikipedistasEdições total
1300,866100.0%17,227,334100.0%
3111,25537.0%16,930,44598.3%
1053,20217.7%16,599,48096.4%
3220,9797.0%16,057,79693.2%
1008,6822.9%15,394,33589.4%
3163,7911.3%14,555,85584.5%
10001,6720.6%13,392,07277.7%
31627290.2%11,733,58368.1%
100002820.1%9,263,51153.8%
31623880.0%5,880,81434.1%
100000160.0%2,291,34213.3%

 

50 wikipedistas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdições 
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
 agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
YanguasUC1 0279,8704,436199,1861,690mai 31, 200643212,78555--
Nice poaUC2 0202,40014471,44829abr 04, 200643781,520---
LuizdlUC3 0192,235316,4433nov 30, 200834072,397---
Renato de carvalho ferreiraUC4 0158,4114,88625,485919abr 08, 201029134,765101--
Kaktus KidUC7 0138,44375422,255182mai 31, 2007395611,654119--
Jbribeiro1UC8 0125,9801,34248,694909jun 13, 201028475,18248--
Vitor MazucoUC9 0118,5745140,351-mar 14, 200836682,4072--
Eric DuffUC10+4117,57010,57350,394421nov 14, 200641544,88799--
RafaAzevedoUC12-1112,879944,914-nov 06, 200737971,488---
Umberto BotturaUC13 0112,5824,08510,236351jun 13, 20112482704--
VanthornUC15 0106,79634730,086162set 19, 20083479106---
DantaddUC16 0102,9752823,294-dez 04, 200544992,9242--
HVLUC17 087,49722133,811136out 17, 200930868251--
ChronusUC18 084,64674846,962717ago 05, 200738901,4358--
GRS73UC20+181,48141290,821313mai 22, 200643305714--
HyjuUC23 078,3931,18319,00473fev 23, 200933224552--
Marcos Elias de Oliveira JúniorUC24 076,2986929,68635out 08, 20093095377---
ColtsfanUC25 074,75893911,19778dez 19, 200833881,5168--
DarwInUC26 072,5581,35894,7714,718fev 07, 200933381,03022--
SturmUC27 070,4126714,40028fev 12, 2005479411,6024--
JotaCartasUC28 065,73277,3332jan 23, 20093353293---
ZoldyickUC29 065,50425246,35746nov 01, 2011234174310--
ZdtrlikUC30+264,4702,63638,528315abr 21, 200739964,56571--
StegopUC32-163,38629744,401307out 29, 200930742,05023--
AngrenseUC33 060,4431222,3425mar 29, 200547494,5856--
TittlesUC34 058,57524210,50119ago 18, 2013168517,36141--
Hermógenes Teixeira Pinto FilhoUC35 058,43292550,416600abr 27, 200739903,18943--
StuckkeyUC36 057,3411,97661,2953,723set 23, 2010274552--
O revolucionário aliadoUC37+155,7861,47455,4601,068ago 06, 2014133269---
MschlindweinUC38+255,3461,49338,13715mai 22, 200450601,21092--
DbastroUC39-255,27376246,3191,345dez 21, 200930211,332181--
Jonas kamUC40-154,47030813,52165jul 12, 200642792,0283--
Carlos Luis M C da CruzUC41+154,0541,0627,3191mai 09, 200547082,54121--
João CarvalhoUC42-153,8716469,51231mar 27, 200547513,3027--
CléééstonUC45 051,5276198,138104mar 30, 200740186734--
JoãofcfUC47+148,7539117,07021mar 21, 200740271,15714--
LuanUC49 048,66348539,7711,256abr 16, 200643665138--
Joao4669UC51+146,34633516,926287jul 19, 200931762214--
GeanUC53 045,7817310,677-jan 23, 20093353992---
Felipe PUC55 043,5799041,62478mai 27, 200643252,0422--
EamaralUC56 043,035112,238-ago 07, 2008352238---
JMagalhãesUC58 042,87025636,234203abr 16, 201125405963--
JoseolgonUC60 042,0712683,0019nov 14, 200545199082--
FSogumoUC61 041,17629840,557338abr 13, 20064369325---
ÉricoUC62+140,03365855,5761,269abr 06, 201029151,400223--
Braz LemeUC63-140,0304085,90441nov 13, 200641553782--
RobertogilneiUC65 038,7508819,63243out 20, 200641791,4324--
BorowskkiUC67 037,03397,9661jan 08, 200933685221--
Alexandre M. B. BerwangerUC68+136,9379322,61934out 30, 2005453418816--
StegoUC70+135,81036428,964376fev 16, 20093329209---

 

20 wikipedistas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
  Primeira ediçãoúltima edição
 posiçãototaldatadias
atrás
datadias
atrás
Fabiano TatschUC5151,733abr 13, 20083638ago 27, 2016580
LeonardoRob0tUC6141,987out 02, 20044927jul 23, 20083537
LeoslsUC11117,270ago 26, 20102773fev 01, 201857
OS2WarpUC14111,637mai 13, 20054704abr 09, 20151086
BisbisUC1982,583set 04, 20064225jun 26, 2017277
LijealsoUC2181,072jul 17, 20054639fev 26, 201832
VítorUC2279,756set 29, 20141278mar 16, 2016744
NH~ptwikiUC3163,800ago 04, 20044986dez 19, 20102658
BiantezUC4352,747abr 02, 20083649out 31, 2015881
ReynaldoUC4451,579mar 22, 20064391out 22, 20102716
LeslieUC4649,093fev 10, 20054796fev 01, 20102979
Leonardo.stabileUC4848,745dez 18, 20054485jul 11, 20102819
Rei-arturUC5047,544jan 23, 20054814mai 11, 20151054
Nuno TavaresUC5246,265dez 26, 20044842nov 20, 2017130
ChristianHUC5444,038mai 11, 20083610fev 28, 201830
CerestaUC5742,935dez 12, 20073761dez 01, 2017119
BurmeisterUC5942,481out 07, 20073827nov 08, 2016507
Rui SilvaUC6438,974mai 26, 20045056dez 30, 2015821
ViniciusmcUC6637,643nov 23, 20093049nov 12, 20131599
Luckas BladeUC6936,424dez 12, 20064126ago 10, 2015963

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 9.492.129 edições foram feitas por usuários anônimos, de um total de 35.419.056 edições ( 26e %)
  


50 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições 
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
 datadias
atrás
datadias
atrás
EmausBotUC1790,922abr 24, 20102897mar 31, 2018-5201
Rei-botUC2601,483mai 21, 20064331set 04, 2010276461,680-
Luckas-botUC3454,589jun 05, 20083585jul 03, 20122096--
XqbotUC4352,454jan 15, 20093361mar 29, 201811-
KLBot2UC5291,352jun 06, 20122123jul 08, 201317261-
SieBotUC6284,535jan 17, 20074090jan 25, 20112621--
SalebotUC7284,132set 22, 20083476fev 22, 2018363-
MerlIwBotUC8256,202abr 07, 20112549ago 09, 20131694--
TXiKiBoTUC9245,384jan 04, 20074103jan 09, 20131906--
Thijs!botUC10239,526mai 13, 20064339out 17, 201219902-
FMTbotUC11231,659abr 21, 20073996nov 13, 2014123344,917-
ZéroBotUC12224,968jun 05, 20102855mar 07, 20131849--
VolkovBotUC13205,452jan 12, 20074095mar 07, 20131849--
RobotQuistnixUC14186,186jan 19, 20054818jan 22, 201318935-
LijeBotUC15181,865jan 03, 20064469jan 01, 2015118417,045-
ArthurBotUC16176,407out 10, 20083458nov 05, 20121971--
Alch BotUC17155,465out 17, 20093086mar 31, 2018-4374
EscarbotUC18150,355jun 04, 20064317mar 30, 2018-21
NTBotUC19139,245dez 29, 20044839mai 11, 200643411-
CommonsDelinkerUC20128,710set 24, 20064205mar 31, 2018-29613
LeoBotUC21126,908set 14, 20073850mai 23, 2010286815,831-
AddbotUC22110,042mar 26, 20131830ago 22, 20131681--
YurikBotUC23103,052jul 31, 20054625set 04, 20064225--
LuanbotUC2491,024jun 09, 20102851fev 23, 20151131--
LegobotUC2589,267mar 10, 20131846abr 08, 20131817--
WikitanvirBotUC2686,662set 28, 20102740mai 16, 20122144--
LaaknorBotUC2785,979jun 23, 20083567mar 07, 20131849--
RedBotUC2881,014jun 13, 20093212ago 25, 20122043--
JAnDbotUC2975,703ago 03, 20064257jul 03, 20131731--
YFdyh-botUC3075,624jun 17, 20122112fev 28, 20131856--
DarwinBotUC3174,083fev 26, 20102954mar 16, 20112571--
WaldirBotUC3274,024jan 29, 20074078jun 29, 2014137036-
Danilo.botUC3369,918nov 25, 20093047nov 21, 2017129170-
AlexbotUC3469,694jan 12, 20083730out 08, 20121999--
FlaBotUC3568,855out 10, 20054554dez 14, 201026638-
Numbo3-botUC3662,197mai 16, 20083605nov 28, 20093044--
Lucia BotUC3759,954set 21, 20083477abr 08, 20112548--
ChuispastonBotUC3858,961set 16, 20102752abr 28, 20122162--
RibotBOTUC3953,681fev 28, 20093317jan 26, 20131889--
RodrigolopesbotUC4052,309jan 31, 20141519nov 10, 2015871--
MystBotUC4151,184jul 14, 20083546mar 08, 20122213--
AlleborgoBotUC4250,424mai 10, 20073977ago 09, 20102790--
RjbotUC4350,398set 02, 20093131set 07, 20122030--
LucienBOTUC4448,157fev 25, 20093320fev 23, 20131861--
Makecat-botUC4544,583jun 16, 20122113mar 06, 20131850--
Aleth BotUC4644,069ago 03, 20112431mar 06, 20182422-
PtbotgourouUC4742,472ago 03, 20083526mar 06, 20131850--
KamikazeBotUC4836,744jun 15, 20102845jan 27, 20131888--
Idioma-botUC4932,933dez 03, 20064135mar 07, 20131849--
TobeBotUC5032,174ago 10, 20093154set 14, 20102754--

 

Artigos que contêm pelo menos uma ligação interna e .. caracteres de texto legível, não contando códigos wiki e html,
ligações ocultas, etc.; títulos também não contam  (excluindo páginas de redirecionamento)

DataArtigos
 < 32 ch< 64 ch< 128 ch< 256 ch< 512 ch< 1 k ch< 2 k ch< 4 k ch< 8 k ch< 16 k ch< 32 k ch< 64 k ch
mar 20120.0%0.1%1.5%5.9%15.8%46.2%73.1%87.9%95.2%98.4%99.6%100.0%
fev 20120.0%0.1%1.6%6.0%15.9%46.4%73.3%88.0%95.3%98.5%99.7%100.0%
jan 20120.0%0.1%1.6%6.1%16.1%46.7%73.5%88.1%95.3%98.5%99.6%100.0%
dez 20110.0%0.1%1.7%6.2%16.3%47.0%73.7%88.2%95.3%98.4%99.5%99.9%
nov 20110.0%0.1%1.7%6.3%16.5%47.3%74.0%88.4%95.5%98.6%99.7%100.0%
out 20110.0%0.1%1.6%6.2%16.4%47.4%74.1%88.4%95.4%98.5%99.6%100.0%
set 20110.0%0.1%1.6%6.2%16.5%47.6%74.3%88.5%95.5%98.5%99.6%99.9%
ago 20110.0%0.1%1.6%6.2%16.5%47.7%74.4%88.5%95.4%98.4%99.5%99.8%
jul 20110.0%0.1%1.6%6.3%16.7%48.0%74.7%88.7%95.6%98.6%99.7%100.0%
jun 20110.0%0.1%1.7%6.4%16.9%48.3%75.0%88.9%95.7%98.6%99.6%99.9%
mai 20110.0%0.1%1.7%6.4%16.9%48.4%75.1%88.9%95.6%98.5%99.5%99.8%
abr 20110.0%0.1%1.7%6.5%17.1%48.8%75.4%89.1%95.8%98.7%99.7%100.0%
mar 20110.0%0.1%1.7%6.5%17.1%48.9%75.5%89.1%95.7%98.5%99.5%99.8%
fev 20110.0%0.1%1.8%6.6%17.3%49.3%75.9%89.4%95.9%98.7%99.7%100.0%
jan 20110.0%0.1%1.8%6.6%17.3%49.4%75.9%89.3%95.8%98.6%99.6%99.9%
dez 20100.0%0.1%1.8%6.7%17.4%49.7%76.1%89.4%95.8%98.6%99.6%99.9%
nov 20100.0%0.1%1.9%7.0%18.1%48.6%75.6%89.2%95.8%98.6%99.6%99.9%
out 20100.0%0.1%1.9%7.1%18.3%49.2%75.8%89.0%95.6%98.4%99.4%99.7%
set 20100.0%0.1%2.0%7.3%18.6%49.6%76.2%89.3%95.9%98.7%99.7%100.0%
ago 20100.0%0.1%2.0%7.3%18.6%49.8%76.3%89.3%95.8%98.6%99.6%99.9%
jul 20100.0%0.1%2.0%7.4%18.9%50.3%76.3%89.3%95.8%98.6%99.6%99.9%
jun 20100.0%0.1%2.0%7.4%18.9%50.5%76.5%89.4%95.9%98.7%99.7%100.0%
mai 20100.0%0.1%2.0%7.4%19.0%50.8%76.8%89.6%96.0%98.7%99.7%100.0%
abr 20100.0%0.1%2.1%7.7%19.6%50.1%76.6%89.5%96.0%98.8%99.8%100.0%
mar 20100.0%0.1%2.1%7.8%19.9%50.3%76.8%89.6%96.0%98.7%99.7%100.0%
fev 20100.0%0.1%2.2%7.9%20.0%50.3%76.9%89.6%96.0%98.7%99.7%100.0%
jan 20100.0%0.1%2.2%7.9%20.1%50.6%77.1%89.7%96.0%98.6%99.5%99.8%
dez 20090.0%0.1%2.3%8.1%20.4%51.0%77.5%90.0%96.2%98.8%99.7%100.0%
nov 20090.0%0.1%2.4%8.3%20.7%51.4%77.7%90.1%96.3%98.9%99.8%100.0%
out 20090.0%0.1%2.4%8.3%20.8%51.6%77.6%90.0%96.2%98.8%99.7%100.0%
set 20090.0%0.1%2.5%8.4%21.0%51.9%77.8%90.1%96.2%98.7%99.6%99.9%
ago 20090.0%0.1%2.5%8.4%21.1%52.2%78.0%90.2%96.2%98.7%99.6%99.9%
jul 20090.0%0.1%2.4%8.3%21.0%52.4%78.3%90.4%96.4%98.9%99.8%100.0%
jun 20090.0%0.1%2.4%8.4%21.2%52.7%78.5%90.4%96.3%98.8%99.7%99.9%
mai 20090.0%0.1%2.4%8.4%21.2%52.8%78.6%90.5%96.3%98.7%99.5%99.7%
abr 20090.0%0.1%2.4%8.5%21.4%53.2%79.0%90.8%96.6%99.0%99.8%100.0%
mar 20090.0%0.1%2.4%8.4%21.4%53.3%79.1%90.8%96.5%98.9%99.7%99.9%
fev 20090.0%0.1%2.4%8.5%21.5%53.4%79.2%90.8%96.5%98.8%99.6%99.8%
jan 20090.0%0.1%2.4%8.6%21.7%53.8%79.5%91.0%96.6%98.9%99.7%99.9%
dez 20080.0%0.1%2.5%8.7%21.9%54.2%79.8%91.1%96.7%99.0%99.8%100.0%
nov 20080.0%0.1%2.5%8.7%22.0%54.4%80.0%91.2%96.7%98.9%99.7%99.9%
out 20080.0%0.1%2.4%8.7%22.1%54.6%80.3%91.3%96.7%98.9%99.6%99.8%
set 20080.0%0.1%2.3%8.6%22.0%54.8%80.9%91.6%96.9%99.1%99.8%100.0%
ago 20080.0%0.1%2.3%8.6%22.1%55.0%81.1%91.7%96.9%99.0%99.7%99.9%
jul 20080.0%0.1%2.3%8.5%22.1%55.2%81.4%91.9%97.0%99.1%99.8%100.0%
jun 20080.0%0.1%2.2%8.4%22.2%55.7%81.8%92.1%97.2%99.3%100.0%100.0%
mai 20080.0%0.1%2.4%8.9%23.2%54.1%80.8%91.5%96.8%98.9%99.6%99.8%
abr 20080.0%0.1%2.5%9.1%23.5%54.5%81.2%91.7%96.9%99.0%99.7%99.9%
mar 20080.0%0.1%2.5%9.2%24.0%54.8%81.5%91.9%97.0%99.1%99.8%100.0%
fev 20080.0%0.1%2.6%9.3%24.4%55.1%81.7%92.0%97.0%99.1%99.8%100.0%
jan 20080.0%0.1%2.8%9.6%24.7%55.5%82.1%92.2%97.1%99.1%99.8%100.0%
dez 20070.0%0.1%2.9%9.7%24.9%55.7%82.3%92.2%97.1%99.1%99.8%100.0%
nov 20070.0%0.1%2.9%9.7%25.0%55.9%82.6%92.4%97.2%99.1%99.7%99.9%
out 20070.0%0.1%2.9%9.7%25.2%56.2%82.9%92.6%97.3%99.2%99.8%100.0%
set 20070.0%0.1%3.1%10.7%28.0%58.6%81.3%91.5%96.8%98.9%99.6%99.8%
ago 20070.0%0.1%3.2%10.8%28.3%59.0%81.6%91.7%96.9%99.0%99.7%99.9%
jul 20070.0%0.1%3.2%10.9%28.6%59.6%82.1%92.0%97.1%99.2%99.9%100.0%
jun 20070.0%0.1%3.3%11.0%28.9%60.0%82.4%92.1%97.1%99.1%99.7%99.9%
mai 20070.0%0.1%3.2%10.7%28.8%60.2%82.6%92.1%97.0%99.0%99.6%99.8%
abr 20070.0%0.2%3.4%10.8%24.6%60.0%82.8%92.4%97.2%99.2%99.8%100.0%
mar 20070.0%0.2%3.5%10.7%24.6%60.3%83.1%92.5%97.2%99.1%99.7%99.9%
fev 20070.0%0.2%3.6%10.8%24.8%60.8%83.5%92.7%97.3%99.2%99.8%100.0%
jan 20070.1%0.3%3.8%11.0%25.0%61.3%83.9%92.9%97.4%99.2%99.8%100.0%
dez 20060.1%0.3%4.1%11.8%26.8%65.2%83.2%92.6%97.3%99.2%99.8%100.0%
nov 20060.1%0.3%4.3%12.2%27.6%66.3%83.2%92.6%97.3%99.2%99.8%100.0%
out 20060.1%0.3%4.2%12.1%28.0%67.6%83.6%92.9%97.5%99.3%99.9%100.0%
set 20060.1%0.3%4.4%12.3%28.4%68.6%84.4%93.2%97.6%99.4%100.0%100.0%
ago 20060.1%0.4%3.3%11.4%28.1%69.5%84.8%93.4%97.7%99.4%99.9%100.0%
jul 20060.1%0.4%3.5%11.9%29.4%71.2%85.2%93.5%97.6%99.3%99.8%99.9%
jun 20060.1%0.4%3.6%12.1%30.2%72.2%86.0%93.8%97.8%99.4%99.9%100.0%
mai 20060.1%0.4%3.6%12.2%31.1%72.3%86.1%93.9%97.8%99.4%99.9%100.0%
abr 20060.1%0.4%3.6%12.4%32.4%73.3%86.4%94.1%98.0%99.5%100.0%100.0%
mar 20060.1%0.4%3.7%13.3%33.0%74.1%86.9%94.3%98.0%99.5%100.0%100.0%
fev 20060.1%0.4%4.2%13.6%33.5%75.3%87.6%94.6%98.1%99.5%100.0%100.0%
jan 20060.1%0.4%4.3%13.9%33.8%76.5%88.2%94.8%98.2%99.5%99.9%100.0%
dez 20050.1%0.4%5.3%16.1%39.3%75.0%87.3%94.4%98.0%99.4%99.9%100.0%
nov 20050.1%0.4%5.7%16.4%41.0%75.6%87.4%94.3%97.9%99.2%99.7%99.8%
out 20050.1%0.5%6.0%16.8%42.3%76.7%88.1%94.7%98.1%99.4%99.8%99.9%
set 20050.2%0.6%6.3%17.3%43.2%77.7%88.8%95.2%98.4%99.6%100.0%100.0%
ago 20050.2%0.6%6.6%18.1%43.7%78.0%89.1%95.2%98.4%99.6%100.0%100.0%
jul 20050.2%0.6%7.3%20.1%47.7%75.7%87.8%94.6%98.1%99.4%99.9%100.0%
jun 20050.3%0.8%7.8%20.3%48.6%77.0%88.7%95.0%98.3%99.5%99.9%100.0%
mai 20050.4%0.8%7.6%26.8%48.8%77.9%88.9%95.1%98.3%99.5%99.9%100.0%
abr 20050.5%1.0%8.2%31.2%59.6%75.0%87.4%94.5%98.2%99.6%100.0%100.0%
mar 20050.7%1.2%8.8%32.7%60.6%75.4%87.3%94.4%98.0%99.3%99.7%99.8%
fev 20050.4%0.9%8.6%33.5%62.5%76.8%88.1%94.8%98.2%99.5%99.9%100.0%
jan 20050.5%1.1%9.3%35.3%64.6%78.2%88.7%94.8%98.1%99.4%99.8%99.9%
dez 20040.6%1.2%9.9%37.3%67.4%80.0%89.6%95.2%98.3%99.5%99.9%100.0%
nov 20040.5%1.1%10.2%39.0%69.9%81.7%90.6%95.7%98.5%99.5%99.9%100.0%
out 20040.5%1.1%10.4%40.4%72.6%83.9%91.5%96.1%98.5%99.5%99.9%100.0%
set 20040.5%1.0%10.7%42.4%75.0%85.9%92.3%96.4%98.7%99.6%100.0%100.0%
ago 20040.8%1.6%5.4%47.2%64.4%80.5%89.6%95.2%98.3%99.4%99.9%100.0%
jul 20041.0%1.9%5.8%51.8%66.9%81.9%90.8%95.7%98.5%99.6%100.0%100.0%
jun 20042.1%3.4%8.6%47.5%64.5%80.1%89.9%95.0%98.1%99.4%100.0%100.0%
mai 20042.3%3.7%8.8%49.3%66.5%80.6%90.8%95.4%98.2%99.3%99.9%100.0%
abr 20041.6%3.1%9.3%54.2%65.8%79.9%90.3%95.1%98.4%99.5%100.0%100.0%
mar 20041.0%2.7%9.7%56.4%68.0%80.1%90.8%95.7%98.6%99.6%100.0%100.0%
fev 20041.4%3.9%13.5%45.5%60.6%73.2%87.8%94.0%97.9%99.2%100.0%100.0%
jan 20041.7%4.8%18.8%37.9%56.9%70.4%81.7%90.3%96.7%98.9%99.9%99.9%
dez 20032.0%4.4%13.7%27.8%47.3%63.6%77.4%88.3%96.2%98.9%100.0%100.0%
nov 20031.8%4.3%13.9%27.8%46.6%63.2%77.1%87.8%95.8%98.9%99.9%99.9%
out 20031.8%4.3%13.9%27.8%46.6%63.2%77.1%87.8%95.8%98.9%99.9%99.9%
set 20031.9%4.5%14.3%28.5%47.7%64.3%77.5%87.9%95.9%99.0%100.0%100.0%
ago 20031.9%4.4%14.0%28.4%47.5%64.5%77.8%87.9%96.2%98.9%100.0%100.0%
jul 20032.6%5.5%16.8%33.6%50.9%65.0%75.7%86.0%95.4%98.6%100.0%100.0%
jun 20033.1%6.0%17.9%34.3%50.4%64.1%74.5%84.7%95.3%98.2%100.0%100.0%
mai 20033.5%7.0%18.7%35.0%51.9%66.9%77.5%86.3%95.7%98.0%99.9%99.9%
abr 20033.9%6.5%19.0%37.7%54.3%68.3%78.7%86.8%95.6%97.7%100.0%100.0%
mar 20034.3%7.0%19.7%38.9%56.2%69.4%79.4%86.2%94.8%97.5%99.9%99.9%
fev 20034.4%7.5%20.6%40.3%57.8%70.3%80.0%86.4%95.0%97.8%100.0%100.0%
jan 20036.5%9.7%23.3%41.7%59.5%70.8%78.9%85.7%94.1%97.3%99.9%99.9%
dez 20026.1%8.6%23.4%42.7%57.9%71.0%79.2%84.1%93.5%96.8%100.0%100.0%
nov 20026.8%9.5%25.9%45.1%59.7%71.6%78.4%83.0%92.6%96.3%100.0%100.0%
out 20027.8%10.7%27.7%45.2%59.8%71.0%78.3%83.2%92.9%96.8%100.0%100.0%
set 20028.5%11.7%29.8%48.4%60.6%70.7%77.1%83.0%92.6%96.9%100.0%100.0%
ago 20028.1%11.3%29.6%48.4%60.8%71.0%77.5%83.4%92.5%96.8%100.0%100.0%
jul 20027.3%9.5%28.6%47.1%60.0%70.7%76.9%82.5%92.1%96.6%100.0%100.0%
jun 20027.2%9.6%29.5%48.8%59.6%69.8%75.8%81.8%92.0%96.2%99.8%99.8%
mai 20025.6%8.4%26.7%45.7%57.0%66.2%71.8%78.8%90.8%95.7%99.9%99.9%
abr 20025.5%8.6%22.0%41.7%51.9%62.1%68.4%76.3%89.7%95.2%99.9%99.9%
mar 20025.6%8.8%22.3%41.3%51.6%61.9%68.2%76.1%89.6%95.2%100.0%100.0%
fev 20025.8%9.1%23.1%42.9%53.6%63.5%69.3%77.6%90.8%95.8%99.9%99.9%
jan 20025.2%8.7%23.5%44.4%54.8%65.2%70.4%79.1%91.3%96.5%100.0%100.0%
dez 20014.5%8.1%23.3%44.7%55.4%65.2%70.6%79.5%91.1%96.5%100.0%100.0%
nov 20014.7%7.5%23.4%44.0%55.2%64.5%69.2%78.5%90.6%96.2%99.9%99.9%
out 20014.5%6.8%25.0%47.7%59.1%68.2%72.7%81.8%92.0%96.5%99.9%99.9%
set 200113.6%18.1%31.7%49.9%59.0%72.6%72.6%90.8%99.9%99.9%99.9%99.9%
ago 200111.8%17.7%23.6%47.1%58.9%70.7%70.7%94.2%100.0%100.0%100.0%100.0%
jul 200133.3%50.0%50.0%50.0%50.0%50.0%50.0%100.0%100.0%100.0%100.0%100.0%
jun 200125.0%50.0%50.0%50.0%50.0%50.0%50.0%100.0%100.0%100.0%100.0%100.0%

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.

See also Category Overview Complete (15 Mb!), Concise (239 kb)
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110GifJpgOggOgvPdfPngSvgTifWebmWebp
mar 20181,8 M122 k90 k49 k1,8 k76 k315311 k21 k 298    64435 k1,1 k24111 k155111
fev 20181,8 M121 k90 k48 k1,8 k75 k314310 k21 k 295    62535 k1,1 k24111 k154111
jan 20181,8 M120 k89 k47 k1,8 k75 k314307 k21 k 293    62434 k1,1 k24111 k153111
dez 20171,7 M119 k88 k47 k1,8 k74 k314303 k20 k 282    62334 k1,1 k24111 k150111
nov 20171,7 M119 k88 k46 k1,8 k74 k314300 k20 k 278    61934 k1,1 k24111 k149111
out 20171,7 M118 k88 k46 k1,8 k74 k314296 k20 k 276    61833 k1,1 k24110 k148111
set 20171,7 M117 k87 k45 k1,8 k73 k314290 k20 k 272    59133 k1,1 k24110,0 k147111
ago 20171,7 M116 k87 k44 k1,8 k73 k314283 k20 k 270    58533 k1,1 k2419,7 k14711 
jul 20171,7 M115 k86 k44 k1,8 k72 k314281 k20 k 269    58232 k1,0 k2419,6 k1451  
jun 20171,7 M115 k86 k43 k1,8 k72 k314277 k20 k 269    58232 k1,0 k2419,5 k1451  
mai 20171,7 M114 k85 k43 k1,8 k72 k314274 k20 k 269    57732 k1,0 k2419,4 k1451  
abr 20171,7 M113 k85 k43 k1,8 k71 k314272 k19 k 269    57632 k1,0 k2419,2 k1441  
mar 20171,7 M112 k84 k42 k1,8 k71 k313269 k19 k 268    56931 k1,0 k2419,1 k1441  
fev 20171,7 M111 k84 k42 k1,8 k70 k313265 k19 k 267    56931 k9972418,9 k1431  
jan 20171,7 M110 k84 k41 k1,8 k70 k312263 k18 k 265    55831 k9962418,8 k1391  
dez 20161,7 M108 k83 k41 k1,7 k69 k311260 k18 k 263    55130 k9952418,5 k1381  
nov 20161,7 M107 k83 k40 k1,7 k69 k310258 k17 k 261    53330 k9872418,1 k1371  
out 20161,7 M106 k82 k39 k1,7 k68 k310257 k16 k 261    53030 k9862418,0 k1371  
set 20161,6 M105 k82 k39 k1,7 k68 k310256 k15 k 259    52630 k9832417,9 k1361  
ago 20161,6 M104 k81 k39 k1,7 k68 k310255 k15 k 258    52429 k9802417,6 k1361  
jul 20161,6 M104 k81 k38 k1,7 k66 k310252 k15 k 257    52429 k9782417,5 k1341  
jun 20161,6 M103 k81 k38 k1,7 k66 k310250 k15 k 253    50529 k9742417,2 k1321  
mai 20161,6 M101 k80 k37 k1,7 k66 k310247 k15 k 251    46428 k9692416,9 k1321  
abr 20161,6 M100 k80 k37 k1,7 k66 k310243 k15 k 237    46228 k9662416,8 k1301  
mar 20161,6 M99 k80 k36 k1,7 k65 k309239 k15 k 230    46128 k9642416,7 k1291  
fev 20161,6 M98 k79 k36 k1,7 k65 k309237 k15 k 228    45928 k9582416,6 k1291  
jan 20161,6 M97 k79 k35 k1,7 k65 k308233 k15 k 226    45327 k9472416,3 k1291  
dez 20151,6 M97 k79 k35 k1,7 k64 k308228 k14 k 226    44627 k9402416,1 k1281  
nov 20151,6 M96 k78 k34 k1,7 k63 k308224 k14 k 226    44327 k9352416,0 k1281  
out 20151,6 M95 k78 k34 k1,7 k63 k308222 k14 k 211    43826 k9312415,8 k1271  
set 20151,6 M94 k77 k33 k1,7 k63 k307220 k14 k 207    43126 k9252415,5 k1271  
ago 20151,5 M94 k77 k33 k1,7 k62 k302217 k14 k 205    42626 k9232415,2 k1271  
jul 20151,5 M93 k77 k32 k1,7 k62 k302213 k14 k 204    41526 k9212414,6 k1271  
jun 20151,5 M92 k77 k31 k1,7 k62 k301209 k14 k 203    40226 k9112414,3 k1261  
mai 20151,5 M91 k76 k31 k1,7 k61 k301207 k14 k 203    39725 k8962414,3 k1251  
abr 20151,5 M91 k76 k31 k1,7 k61 k299203 k14 k 203    39525 k8922414,2 k1231  
mar 20151,5 M90 k75 k31 k1,7 k61 k298200 k14 k 201    39325 k8802414,2 k1221  
fev 20151,5 M89 k75 k30 k1,7 k60 k298198 k14 k 199    39225 k8692414,1 k1211  
jan 20151,5 M88 k74 k30 k1,7 k60 k298194 k13 k 199    38724 k8602414,0 k1211  
dez 20141,5 M88 k74 k30 k1,7 k60 k298190 k13 k 193    38724 k8392414,0 k1211  
nov 20141,5 M87 k73 k29 k1,7 k59 k298187 k13 k 191    38024 k8252413,9 k1211  
out 20141,5 M86 k72 k29 k1,7 k58 k298185 k13 k 190    37524 k8212413,8 k1211  
set 20141,5 M85 k72 k28 k1,7 k58 k298183 k13 k 187    36523 k8162413,8 k1211  
ago 20141,4 M85 k72 k28 k1,7 k57 k297181 k13 k 185    36423 k8142413,7 k1211  
jul 20141,4 M84 k71 k28 k1,7 k57 k296179 k13 k 174    36223 k8102413,7 k1171  
jun 20141,4 M83 k71 k27 k1,7 k57 k294178 k13 k 174    36222 k7962413,6 k1131  
mai 20141,4 M82 k71 k27 k1,7 k56 k294177 k13 k 172    35922 k7832413,6 k1091  
abr 20141,4 M81 k70 k27 k1,6 k55 k294175 k13 k 169    35622 k7792413,5 k1061  
mar 20141,4 M80 k70 k26 k1,6 k55 k293173 k13 k 168    35422 k7702413,5 k981  
fev 20141,4 M80 k69 k26 k1,6 k55 k293170 k13 k 168   9882534721 k7662413,4 k971  
jan 20141,4 M79 k69 k26 k1,6 k54 k293167 k13 k 168   10764534221 k7342413,3 k961  
dez 20131,4 M78 k69 k25 k1,6 k54 k293164 k13 k 166   10152733821 k7202413,2 k941  
nov 20131,4 M78 k68 k25 k1,6 k53 k293162 k13 k 163   8406733320 k7192413,2 k941  
out 20131,4 M77 k68 k25 k1,6 k53 k289161 k13 k 162   8568133320 k7092413,1 k881  
set 20131,4 M77 k67 k24 k1,6 k52 k288159 k12 k 157   9037532920 k7032413,0 k871  
ago 20131,4 M76 k67 k24 k1,6 k52 k287157 k12 k 156   9600432420 k6912413,0 k871  
jul 20131,4 M76 k66 k24 k1,6 k51 k284155 k12 k 155   11090932120 k6742412,9 k851  
jun 20131,4 M75 k65 k23 k1,6 k51 k273154 k12 k 153   11671031819 k6572412,9 k811  
mai 20131,3 M75 k65 k22 k1,6 k51 k268152 k12 k 151   12727231318 k6352412,9 k80   
abr 20131,3 M74 k64 k22 k1,6 k50 k265151 k11 k 144   11284830518 k6252412,8 k77   
mar 20131,3 M73 k63 k21 k1,6 k50 k265150 k11 k 142   11315229617 k6002412,7 k71   
fev 20131,3 M72 k62 k20 k1,6 k49 k262148 k11 k 140   10722529016 k5752412,6 k71   
jan 20131,3 M71 k61 k19 k1,6 k48 k261147 k11 k 134   13591928316 k5682412,5 k68   
dez 20121,3 M70 k60 k19 k1,6 k48 k261145 k11 k 133   11342625015 k5532412,4 k56   
nov 20121,3 M70 k60 k18 k1,6 k47 k260143 k11 k 129   9444224015 k5382412,3 k53   
out 20121,3 M69 k60 k17 k1,6 k46 k259142 k10 k 126   9511423714 k5332412,3 k52   
set 20121,3 M69 k59 k17 k1,5 k46 k259141 k10 k 123   10046122814 k5282412,2 k52   
ago 20121,3 M68 k58 k16 k1,5 k46 k258139 k10 k 121   11683122213 k5162412,2 k52   
jul 20121,3 M68 k58 k16 k1,5 k45 k258137 k9,9 k 118   12265521613 k4952412,1 k51   
jun 20121,3 M67 k57 k15 k1,5 k44 k258133 k9,6 k 115   10947320112 k4832412,0 k48   
mai 20121,3 M66 k56 k14 k1,5 k43 k258131 k9,4 k 113   11931219312 k4582411,9 k47   
abr 20121,3 M66 k56 k14 k1,5 k43 k258130 k9,3 k 112   10751518011 k4112411,8 k44   
mar 20121,2 M66 k55 k13 k1,5 k42 k258127 k9,1 k 111   10435417411 k3382411,8 k44   
fev 20121,2 M65 k54 k13 k1,5 k42 k258124 k9,0 k 107   11366816811 k3222411,7 k41   
jan 20121,2 M65 k54 k13 k1,5 k41 k257122 k9,0 k 106   11936616410 k3132411,7 k41   
dez 20111,2 M64 k53 k12 k1,5 k41 k257120 k8,9 k 101   11576614610 k3002411,6 k36   
nov 20111,2 M64 k52 k12 k1,5 k40 k257117 k8,7 k 94   1050341369,6 k2862211,4 k35   
out 20111,2 M63 k52 k11 k1,4 k40 k257116 k8,6 k 88   1075531329,3 k2771911,4 k35   
set 20111,2 M63 k51 k11 k1,4 k39 k257114 k8,5 k 86   1113761329,0 k2521911,3 k35   
ago 20111,2 M62 k51 k10 k1,3 k38 k256113 k8,4 k 86   1269991228,6 k2261711,3 k35   
jul 20111,2 M62 k50 k9,8 k1,3 k38 k256112 k8,3 k 85   1160511188,2 k2011111,2 k35   
jun 20111,2 M62 k50 k9,1 k1,3 k37 k255110 k8,2 k 84   96195987,6 k166711,2 k35   
mai 20111,2 M61 k49 k8,7 k1,3 k37 k255109 k8,1 k 81   106646947,2 k137611,2 k34   
abr 20111,2 M61 k48 k8,2 k1,3 k37 k253107 k8,0 k 80   114847896,8 k102611,1 k34   
mar 20111,2 M60 k48 k7,5 k1,3 k36 k250106 k7,8 k 77   127899816,2 k86511,1 k33   
fev 20111,2 M60 k47 k7,0 k1,3 k36 k248103 k7,4 k 75   122180775,8 k78211,1 k33   
jan 20111,2 M60 k47 k6,5 k1,2 k35 k246101 k7,3 k 74   140429745,3 k712 99233   
dez 20101,1 M59 k46 k5,5 k1,2 k35 k22098 k7,1 k 73   127147564,5 k581 85828   
nov 20101,1 M59 k46 k4,5 k1,2 k34 k22095 k6,9 k 71   111650463,7 k46  75626   
out 20101,1 M58 k45 k3,9 k1,2 k34 k21992 k6,5 k 63   107355343,1 k41  67025   
set 20101,1 M58 k45 k3,0 k1,2 k33 k21990 k6,2 k 49   115643262,5 k22  48820   
ago 20101,1 M58 k44 k61,2 k33 k21488 k6,0 k 46   113698 5   1    
jul 20101,1 M57 k44 k 1,2 k31 k21184 k5,8 k 46   126607          
jun 20101,1 M57 k43 k 1,2 k31 k20883 k5,7 k 46   124480          
mai 20101,0 M57 k43 k 1,2 k30 k20881 k5,6 k 42   141837          
abr 20101,0 M56 k42 k 1,2 k29 k20679 k5,5 k 38   137666          
mar 20101,0 M55 k42 k 1,0 k28 k20277 k5,2 k 36   139277          
fev 2010994 k55 k41 k 1,0 k27 k20175 k4,9 k 34   135790          
jan 2010983 k54 k41 k 1,0 k27 k19673 k4,8 k 33   129970          
dez 2009971 k54 k40 k 97626 k19571 k4,8 k 31   126927          
nov 2009959 k53 k40 k 96725 k19068 k4,5 k 29   110438          
out 2009946 k53 k40 k 96025 k18967 k4,3 k 20   127435          
set 2009936 k52 k39 k 95525 k18865 k4,1 k 15   124017          
ago 2009927 k52 k39 k 88624 k18263 k4,0 k 11   133208          
jul 2009914 k51 k38 k 88423 k18262 k3,9 k 5   133930          
jun 2009901 k51 k37 k 85622 k18061 k3,7 k 5   122891          
mai 2009890 k50 k36 k 79022 k17459 k3,3 k 4   128289          
abr 2009879 k49 k36 k 77421 k17257 k2,4 k 1   118737          
mar 2009868 k49 k35 k 70220 k17156 k2,4 k 1   115275          
fev 2009857 k48 k34 k 66220 k17055 k2,2 k 1   110173          
jan 2009846 k47 k34 k 66019 k16952 k2,2 k     129863          
dez 2008833 k47 k32 k 65518 k16450 k1,9 k     128340          
nov 2008820 k46 k32 k 64318 k16448 k1,9 k     115023          
out 2008809 k45 k31 k 62817 k16147 k1,8 k     116088          
set 2008797 k45 k30 k 60017 k15845 k1,8 k     115557          
ago 2008788 k44 k29 k 58716 k15844 k1,8 k     128218          
jul 2008776 k44 k28 k 57616 k15643 k1,7 k     131765          
jun 2008762 k43 k28 k 57515 k15541 k1,5 k     123862          
mai 2008715 k43 k27 k 56915 k15240 k1,4 k     126273          
abr 2008704 k27 k26 k 56914 k15239 k1,3 k     124592          
mar 2008693 k25 k25 k 56914 k15137 k1,2 k     126913          
fev 2008681 k25 k24 k 54513 k15036 k1,2 k     120721          
jan 2008665 k24 k22 k 54312 k15035 k1,0 k     130388          
dez 2007653 k24 k21 k 53312 k15033 k1,0 k     106011          
nov 2007638 k23 k20 k 52812 k15032 k990     116941          
out 2007625 k22 k19 k 51111 k15031 k946     126246          
set 2007573 k22 k18 k 5119,6 k15028 k927     106113          
ago 2007562 k21 k17 k 5079,1 k15027 k880     98433          
jul 2007523 k11 k16 k 5078,4 k15025 k826     104799          
jun 2007489 k11 k15 k 4917,8 k14924 k785     97984          
mai 2007464 k11 k14 k 4847,4 k14823 k681     110274          
abr 2007450 k10,0 k13 k 4777,1 k14722 k609     96351          
mar 2007440 k9,5 k12 k 4446,8 k14720 k597     95438          
fev 2007421 k9,0 k10 k 4336,5 k14419 k553     83816          
jan 2007405 k8,5 k9,6 k 4266,2 k13918 k536     98665          
dez 2006377 k7,9 k8,6 k 3825,4 k13818 k516     147286          
nov 2006265 k7,2 k7,7 k 3705,1 k12216 k502     90179          
out 2006253 k6,7 k7,0 k 3654,7 k12015 k476     85876          
set 2006243 k6,2 k6,2 k 3654,4 k11515 k438     84954          
ago 2006229 k5,8 k5,7 k 3654,1 k10314 k404     88689          
jul 2006213 k5,3 k5,0 k 3613,7 k10013 k363     81189          
jun 2006198 k4,8 k4,3 k 3553,4 k10012 k304     79878          
mai 2006184 k4,3 k3,6 k 3513,1 k9911 k299     77534          
abr 2006169 k3,8 k3,1 k 3492,8 k9910 k287     65399          
mar 2006160 k3,5 k2,6 k 3402,5 k969,7 k266     62908          
fev 2006150 k3,0 k2,0 k 3382,2 k968,8 k245     59643          
jan 2006141 k2,6 k1,5 k 3341,9 k958,0 k109     79472          
dez 2005118 k2,3 k1,0 k 3241,6 k947,1 k90     46725          
nov 2005108 k2,1 k814 3111,5 k906,7 k72     34622          
out 2005103 k1,8 k794 2801,4 k886,1 k67     35292          
set 200597 k1,6 k763 2781,2 k875,8 k56     27366          
ago 200590 k1,5 k749 2181,1 k845,3 k56     40970          
jul 200575 k1,3 k715 203875834,5 k22     35573          
jun 200569 k1,1 k694 155648813,9 k3     32779          
mai 200562 k939562 155511803,4 k2     35949          
abr 200548 k806459 154391802,6 k2     28793          
mar 200542 k682425 154334762,2 k1     18831          
fev 200539 k593309 154242591,9 k1     16618          
jan 200536 k512256 154165541,6 k1     15146          
dez 200433 k426225 154121501,4 k1     16497          
nov 200430 k355203 12789461,2 k1     17157          
out 200428 k294177 12586429881     14642          
set 200425 k254172 12580387821     23081          
ago 200416 k206141 12472346521     11677          
jul 200414 k177130 12357305201     15140          
jun 20049,6 k127121 12047183121     8398          
mai 20047,8 k102112 1204317 1                
abr 20045,9 k74100 102717 1                
mar 20044,8 k5693 101316                  
fev 20042,8 k3768 9212                  
jan 20041,7 k2751 9 10                  
dez 20031,4 k2039 8 9                  
nov 20031,3 k1139   9                  
out 20031,3 k1139   9                  
set 20031,3 k1138   9                  
ago 20031,2 k1138   9                  
jul 20039781134   8                  
jun 20038701133   7                  
mai 20037711128   5                  
abr 20036411025   5                  
mar 2003581924   5                  
fev 2003555823   5                  
jan 2003478722   5                  
dez 2002380621   5                  
nov 2002344621   5                  
out 2002319521   5                  
set 2002293420   5                  
ago 2002267419   5                  
jul 2002251319   5                  
jun 2002233219   5                  
mai 2002203218   5                  
abr 2002184118   5                  
mar 2002179118   5                  
fev 2002169115   5                  
jan 2002163115   5                  
dez 2001159115   5                  
nov 2001150115   5                  
out 2001126112   1                  
set 200127 8   1                  
ago 200118 8   1                  
jul 20016 6   1                  
jun 20014 6   1                  

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

jul 2001: 1 1 Planeta

ago 2001: 1 1 20000 Varuna

set 2001: 1 1 Cristão

out 2001: 1 2 Antraz , 2 1 Fundo genético

nov 2001: 1 1 Design gráfico

dez 2001: 1 1 Programa de computador

jan 2002: 1 1 Spam

fev 2002: 1 1 Teoria dos jogos

mar 2002: 1 1 Viagens no tempo

mai 2002: 1 1 Tamanqueiro

jun 2002: 1 1 Roedores

jul 2002: 1 1 Sociologia

ago 2002: 1 1 World Wide Web

set 2002: 1 1 Roldão de Siqueira Fontes

out 2002: 1 1 Relógio (xadrez)

nov 2002: 1 2 Xadrez , 2 1 Notações do xadrez

dez 2002: 1 1 Red Hat Linux

jan 2003: 1 2 Havaí , 2 2 Unidades SI , 3 2 Filogenia , 4 1 Taxonomia (geral)

fev 2003: 1 1 Inhambu-açu

mar 2003: 1 2 Evolução , 2 2 Cidadania , 3 1 Fogo-fátuo

abr 2003: 1 2 Gato de Schrödinger , 2 1 1929

mai 2003: 1 2 Unix , 2 2 URSS , 3 2 Pecuária , 4 1 Artes visuais

jun 2003: 1 2 Mecânica (desambiguação) , 2 2 Dinâmica , 3 1 Lista de Estados soberanos

jul 2003: 1 2 Forró , 2 1 Mandriva

ago 2003: 1 2 Futebol , 2 2 Versões da língua portuguesa , 3 2 Roger Bacon , 4 2 Rio Mondego , 5 2 Medicina baseada em evidências , 6 2 Zabumba , 7 2 Massa , 8 2 Moçambique , 9 2 Idade Contemporânea , 10 2 Geografia , 11 2 Figueira da Foz , 12 2 Distrito de Coimbra , 13 2 Desporto , 14 1 Fundo genético

set 2003: 1 1 Espiritismo (termo)

out 2003: 1 2 Lista de escritores do Brasil por movimento literário , 2 1 Espiritismo (termo)

dez 2003: 1 2 Wiki , 2 2 Sancho II de Portugal , 3 2 Criptografia , 4 2 América Latina , 5 1 Tamanqueiro

jan 2004: 1 3 Galiza , 2 2 Biologia molecular , 3 2 América do Sul , 4 2 Voyager 2 , 5 2 Rio Grande do Sul , 6 2 Hino Nacional Brasileiro , 7 2 Eucarionte , 8 2 Gato de pelo curto brasileiro , 9 2 Newton (desambiguação) , 10 2 13 de agosto , 11 2 Portugal , 12 2 Plutão , 13 2 Monera , 14 1 Peritónio

fev 2004: 1 5 Brasil , 2 4 Suíça , 3 4 Medicina , 4 3 Cuba , 5 3 Carl Kellner , 6 3 Ordo Templi Orientis , 7 3 Thelema , 8 3 Tailândia , 9 3 Cidade de Deus (filme) , 10 3 Myanmar , 11 3 Israel , 12 3 Índia , 13 3 Reino Unido , 14 3 Rio Grande do Norte , 15 3 Nova Zelândia , 16 3 Mitologia , 17 3 Mato Grosso do Sul , 18 3 República da Irlanda , 19 3 França , 20 3 Europa , 21 3 Argentina , 22 2 Lista de Estados soberanos , 23 2 Espiritismo (termo) , 24 2 Música clássica , 25 2 Estados Federados da Micronésia

mar 2004: 1 5 Candomblé , 2 5 Brasil , 3 4 ReactOS , 4 4 Niterói , 5 4 Lista de clubes de futebol do Brasil , 6 4 Religião , 7 4 Minas Gerais , 8 4 Música , 9 4 Engenharia , 10 4 Bahia , 11 3 Área , 12 3 Concílio de Nicea , 13 3 Tensegridade , 14 3 Martinho Lutero , 15 3 População , 16 3 Simetria , 17 3 Cultura do Japão , 18 3 A , 19 3 Telecomunicação , 20 3 Escravidão , 21 3 Atentados de 11 de março de 2004 em Madrid , 22 3 Diagrama de classes , 23 3 História da Guiné-Bissau , 24 3 Microsoft Excel , 25 3 Oscar Niemeyer

abr 2004: 1 6 Calvin e Hobbes , 2 5 Heroína , 3 5 França , 4 5 Astronomia , 5 4 Espiritismo (termo) , 6 4 Centro de Mídia Independente , 7 4 Revolução de 25 de Abril de 1974 , 8 4 Psicologia , 9 4 Galileu Galilei , 10 4 Biografias , 11 4 Adolf Hitler , 12 3 Design gráfico , 13 3 Propaganda , 14 3 Fernando I de Portugal , 15 3 Ciberdemocracia , 16 3 Franz Schubert , 17 3 Relatividade restrita , 18 3 Oceano , 19 3 São Paulo (desambiguação) , 20 3 Karl Dönitz , 21 3 Condoleezza Rice , 22 3 Cultura de Singapura , 23 3 MPB , 24 3 Chico Buarque , 25 3 Município

mai 2004: 1 8 Brasil , 2 7 Centro de Mídia Independente , 3 6 Príncipe Custódio de Xapanã , 4 6 Portugal , 5 5 Contrato de aprendizagem , 6 5 Estado Novo , 7 5 Jorge Amado , 8 5 Lista de listas , 9 4 Iroko (orixá) , 10 4 Jurema , 11 4 Biografias: G , 12 4 Biografias: C , 13 4 Batuque (religião) , 14 4 Karl Marx , 15 4 18 de maio , 16 4 Jorge Sampaio , 17 4 Candomblé , 18 4 Linguagens de Programação , 19 4 Xadrez , 20 4 Segunda Guerra Mundial , 21 4 Romancistas , 22 4 Cerveja , 23 4 Biografias , 24 3 Música clássica , 25 3 Gás ideal

jun 2004: 1 7 Estados Unidos , 2 6 Língua portuguesa , 3 5 Rio de Janeiro (cidade) , 4 5 Chá , 5 5 José Manuel Durão Barroso , 6 5 Jamaica , 7 5 União Soviética , 8 5 Inglaterra , 9 5 Filosofia , 10 5 Cinema , 11 5 Ludwig van Beethoven , 12 5 Amesterdão , 13 4 HTML , 14 4 Harry Potter , 15 4 Henrique de Borgonha, conde de Portucale , 16 4 Planetologia , 17 4 Marie Curie , 18 4 Fernando Torres (ator) , 19 4 Ana de Sousa , 20 4 Morna , 21 4 Mesopotâmia , 22 4 Língua árabe , 23 4 Caruaru , 24 4 Jurema , 25 4 Jorge Amado

jul 2004: 1 8 Biografias: A , 2 8 2004 , 3 7 Mahatma Gandhi , 4 7 Biografias: R , 5 7 Holocausto , 6 7 1 de janeiro , 7 7 Países Baixos , 8 7 Estados Unidos , 9 7 Brasília , 10 6 Lista de desportos , 11 6 Biografias: T , 12 6 Biografias: P , 13 6 Biografias: M , 14 6 Biografias: J , 15 6 Biografias: H , 16 6 Biografias: G , 17 6 Biografias: F , 18 6 Biografias: B , 19 6 Lista de escritores do Brasil por gênero literário , 20 6 Lista de chefes de governo de Portugal , 21 6 Universidade de São Paulo , 22 6 Oscar Niemeyer , 23 6 Linux , 24 6 Banco de dados , 25 6 Brasil

ago 2004: 1 9 Estados Unidos , 2 8 África do Sul , 3 7 Portugal , 4 7 Getúlio Vargas , 5 6 Cuba , 6 6 Arthur Omar , 7 6 Sibéria , 8 6 Porto Alegre , 9 6 Brunei , 10 6 Brasil , 11 6 Argentina , 12 5 Rio de Janeiro (cidade) , 13 5 Alfabeto fonético internacional , 14 5 Alfabeto latino , 15 5 Estados dos Estados Unidos , 16 5 Língua portuguesa , 17 5 25 de janeiro , 18 5 Banda desenhada , 19 5 Comores , 20 5 Burkina Faso , 21 5 Coreia do Sul , 22 5 Arábia Saudita , 23 5 Moçambique , 24 5 História do Brasil , 25 5 Grécia

set 2004: 1 9 Deserto , 2 8 Hidrogénio , 3 7 Baleia , 4 7 Lista de instituições de ensino superior do Brasil , 5 7 Atenas , 6 6 Regiões do Brasil , 7 6 Biografias: M , 8 6 Judaísmo , 9 6 Grécia , 10 6 Estados Unidos , 11 6 Brasil , 12 6 Alemanha , 13 5 Coluna Prestes , 14 5 Passa Quatro , 15 5 Chechênia , 16 5 Salvador (Bahia) , 17 5 António de Oliveira Salazar , 18 5 Stanley Kubrick , 19 5 Deodoro da Fonseca , 20 5 Lista de escritores de língua portuguesa , 21 5 Biografias: H , 22 5 Quicksort , 23 5 Karl Marx , 24 5 Fernando Henrique Cardoso , 25 5 Copa do Mundo FIFA

out 2004: 1 8 Biografias: A , 2 7 Humberto de Alencar Castelo Branco , 3 7 2004 , 4 6 Maçã , 5 6 Psoríase , 6 6 Mona Lisa , 7 6 4 de outubro , 8 6 Biografias: V , 9 6 Biografias: M , 10 6 Neoliberalismo , 11 6 Lista de imperadores bizantinos , 12 5 Luz , 13 5 The Piper at the Gates of Dawn , 14 5 Che Guevara , 15 5 Fernando Sabino , 16 5 Lauraceae , 17 5 Lyon , 18 5 Anos de chumbo , 19 5 Spock , 20 5 1891 , 21 5 1971 , 22 5 1994 , 23 5 11 de outubro , 24 5 1 de fevereiro , 25 5 Biografias: S

nov 2004: 1 8 São Paulo (cidade) , 2 7 Sebastião Carvalho Leme , 3 7 Yasser Arafat , 4 7 Luiz Inácio Lula da Silva , 5 7 Hidrogénio , 6 6 Espiritismo (termo) , 7 6 Tony Blair , 8 6 ColdFusion , 9 6 Viaduto do Chá , 10 6 Theo van Gogh (cineasta) , 11 6 Serpente , 12 6 Belém (Pará) , 13 6 Aikido , 14 6 Religiões no Brasil , 15 6 Banda desenhada , 16 6 Império Romano , 17 6 Islão , 18 6 Jogo de computador , 19 6 Wiki , 20 6 Brasil , 21 5 The Sims , 22 5 Rede Globo , 23 5 Prostituição , 24 5 Oracle (banco de dados) , 25 5 Netscape

dez 2004: 1 9 Natal , 2 9 Brasil , 3 8 Sismo e tsunami do Oceano Índico de 2004 , 4 8 Tsunami , 5 8 Banda desenhada , 6 8 Leonardo da Vinci , 7 8 2004 , 8 8 Noam Chomsky , 9 8 Aves , 10 7 Biografias: H , 11 7 Biografias: A , 12 7 Friedrich Nietzsche , 13 6 Lost in Space , 14 6 Programa Apollo , 15 6 Sílex , 16 6 Língua polaca , 17 6 Os Simpsons , 18 6 Helena Blavatsky , 19 6 Mauricio de Sousa , 20 6 Carnaval , 21 6 Cambuquira , 22 6 Homossexualidade , 23 6 Biografias: S , 24 6 Linguística , 25 6 Lua

jan 2005: 1 15 Luiz Inácio Lula da Silva , 2 14 Brasil , 3 10 Leonel Brizola , 4 10 Veja , 5 8 Sismo e tsunami do Oceano Índico de 2004 , 6 8 Medicina , 7 7 Tsunami , 8 7 Amália Rodrigues , 9 7 Biografias: B , 10 6 Espiritismo (termo) , 11 6 Harry Potter , 12 6 Cocadaboa , 13 6 Lago Vitória , 14 6 Mir , 15 6 Renato Aragão , 16 6 Foguete espacial , 17 6 2005 , 18 6 Biografias: S , 19 6 Biografias: M , 20 6 Biografias: L , 21 6 Biografias: K , 22 6 Biografias: A , 23 6 Porto Alegre , 24 6 Comunismo , 25 5 Eletrobras Furnas

fev 2005: 1 13 Espiritismo (termo) , 2 12 Luiz Inácio Lula da Silva , 3 8 Chico Xavier , 4 8 Sport Club Corinthians Paulista , 5 7 Antipapa João XXIII , 6 7 Arnold Schwarzenegger , 7 7 Golpe de Estado no Brasil em 1964 , 8 7 Biografias: C , 9 7 Santos Dumont , 10 6 Harry Potter , 11 6 Xuxa , 12 6 Cracker , 13 6 Cannabis sativa , 14 6 Língua portuguesa , 15 6 Black metal , 16 6 Biografias: L , 17 6 Biografias: A , 18 6 Haxixe , 19 6 Club de Regatas Vasco da Gama , 20 6 Brasil , 21 5 Bumerangue , 22 5 Vibrador , 23 5 Sismo de Valdivia de 1960 , 24 5 Calor específico , 25 5 Pato Donald

mar 2005: 1 8 Biografias: C , 2 8 José Manuel Durão Barroso , 3 8 Brasil , 4 7 Espiritismo (termo) , 5 7 Exploração espacial , 6 7 Biografias: A , 7 7 Catolicismo , 8 7 Fidel Castro , 9 6 José Rodrigues , 10 6 Doença de Chagas , 11 6 Páscoa , 12 6 José Sócrates , 13 6 Golpe de Estado no Brasil em 1964 , 14 6 Lula , 15 6 Biografias: M , 16 6 Música , 17 6 Luiz Inácio Lula da Silva , 18 6 Sport Club Corinthians Paulista , 19 6 Adolf Hitler , 20 5 Deutsche Welle , 21 5 Caminhão , 22 5 Orangotango , 23 5 Escorpião (desambiguação) , 24 5 Papa Bento XIV , 25 5 Papa Bento XIII

abr 2005: 1 24 Papa Bento XVI , 2 20 Papa João Paulo II , 3 16 Luiz Inácio Lula da Silva , 4 13 Português brasileiro , 5 12 Lista dos papas , 6 12 Papa , 7 9 2005 , 8 9 Brasil , 9 8 Conclave de 2005 , 10 8 Biografias: S , 11 7 Lili Caneças , 12 7 Tratado de Waitangi , 13 7 Cláudio Hummes , 14 7 Escorpião , 15 7 Presidente do Brasil , 16 7 Ceticismo , 17 7 Conclave , 18 7 Biografias: P , 19 7 Biografias: M , 20 7 Pablo Picasso , 21 7 J. R. R. Tolkien , 22 7 Friedrich Nietzsche , 23 7 Microsoft Windows , 24 7 Segunda Guerra Mundial , 25 7 Portugal

mai 2005: 1 15 Brasil , 2 10 Portugal , 3 10 Sebastião José de Carvalho e Melo , 4 9 Tareco , 5 9 Luiz Inácio Lula da Silva , 6 9 Estados Unidos , 7 8 Sport Lisboa e Benfica , 8 8 Reconquista , 9 8 Criacionismo , 10 8 Chico Xavier , 11 8 Montreal , 12 8 Partido dos Trabalhadores , 13 8 Albert Einstein , 14 7 Vitória-régia , 15 7 Volkswagen Gol , 16 7 U-Br , 17 7 Transfusão de sangue , 18 7 Lista de escritores de língua portuguesa , 19 7 Biografias: A , 20 7 Sorocaba , 21 6 Rio de Janeiro (cidade) , 22 6 Espiritismo (termo) , 23 6 Final Fantasy VII , 24 6 John Forbes Nash , 25 6 Franquia

jun 2005: 1 11 Vasco Gonçalves , 2 11 Brasil , 3 10 Espiritismo (termo) , 4 10 Veja , 5 10 Portugal , 6 9 Club de Regatas Vasco da Gama , 7 9 Fernando Henrique Cardoso , 8 8 Eugénio de Andrade , 9 8 Copa das Confederações FIFA de 2005 , 10 8 Futebol Clube do Porto , 11 8 Álvaro Cunhal , 12 8 Linkin Park , 13 8 Tuberculose , 14 8 Candido Portinari , 15 8 Biografias: B , 16 8 Biografias: A , 17 8 São Paulo (cidade) , 18 8 Napoleão Bonaparte , 19 8 Japão , 20 8 Estados Unidos , 21 8 Espanha , 22 7 Olavo de Carvalho , 23 7 English As She Is Spoke , 24 7 Legião da Boa Vontade , 25 7 Aeroporto

jul 2005: 1 18 Luiz Inácio Lula da Silva , 2 16 Brasil , 3 12 Saco de plástico , 4 12 São Paulo Futebol Clube , 5 12 Portugal , 6 10 Partido dos Trabalhadores , 7 10 São Paulo (cidade) , 8 9 Espiritismo (termo) , 9 9 Etimologia dos nomes dos países , 10 9 Escândalo do Mensalão , 11 9 Artur Virgílio Alves dos Reis , 12 9 Liga dos Campeões da UEFA , 13 9 Cinema western , 14 8 Esquizofrenia , 15 8 Masturbação , 16 8 Lista de hinos nacionais e regionais , 17 7 Nu metal , 18 7 Profecia , 19 7 Live 8 , 20 7 Racismo , 21 7 Homossexualidade , 22 7 Pink Floyd , 23 7 Língua portuguesa , 24 7 Biografias: A , 25 7 Testemunhas de Jeová

ago 2005: 1 22 Sistema cooperativo , 2 16 Escândalo do Mensalão , 3 13 Edição radiofônica , 4 13 Partido dos Trabalhadores , 5 12 Luiz Inácio Lula da Silva , 6 12 Brasil , 7 10 Banda desenhada , 8 10 Lista de hinos nacionais e regionais , 9 10 Segunda Guerra Mundial , 10 9 Papa Bento XVI , 11 9 Homossexualidade , 12 9 Biografias: M , 13 9 Orkut , 14 9 Estados Unidos , 15 8 Metrô de São Paulo , 16 8 Friends , 17 8 Gíria sexual , 18 8 Hacker , 19 8 Biografias: P , 20 8 Basquetebol , 21 8 Lista de instituições de ensino superior do Brasil , 22 8 Israel , 23 7 Risorgimento , 24 7 Língua portuguesa , 25 7 Angra (banda)

set 2005: 1 13 São Paulo Futebol Clube , 2 13 Sport Club Corinthians Paulista , 3 10 Sistema cooperativo , 4 10 Microsoft Windows , 5 10 Luiz Inácio Lula da Silva , 6 10 Brasil , 7 8 Sistemas de Correios Eletrônicos , 8 8 Escândalo do Mensalão , 9 8 Biografias: M , 10 8 Biografias: B , 11 8 Biografias: A , 12 8 Cruzeiro Esporte Clube , 13 8 Testemunhas de Jeová , 14 7 Espiritismo (termo) , 15 7 Projeto de workflow , 16 7 Furacão Katrina , 17 7 Severino Cavalcanti , 18 7 2005 , 19 7 Ténis , 20 7 Blumenau , 21 7 Língua portuguesa , 22 6 Wikipédia , 23 6 Harry Potter , 24 6 Anticomunismo , 25 6 Programa Apollo

out 2005: 1 19 Referendo no Brasil em 2005 , 2 14 Apartheid , 3 14 Brasil , 4 13 Gíria sexual , 5 13 Biografias: J , 6 13 Biografias: A , 7 12 Guerra de Secessão , 8 11 Espiritismo (termo) , 9 11 Sport Lisboa e Benfica , 10 11 Biografias: M , 11 10 2005 , 12 10 Sismo de Lisboa de 1755 , 13 10 Biografias: G , 14 10 Biografias: C , 15 10 Biografias: B , 16 10 Luiz Inácio Lula da Silva , 17 9 Biografias: S , 18 9 Biografias: P , 19 9 Biografias: F , 20 9 Aníbal Cavaco Silva , 21 9 História do Brasil , 22 9 Estados Unidos , 23 8 Estatuto do Desarmamento , 24 8 PlayStation 3 , 25 8 Racismo

nov 2005: 1 15 Brasil , 2 13 Biografias: J , 3 13 Martinchel , 4 13 Sport Club Corinthians Paulista , 5 11 Foguete espacial , 6 11 Biografias: L , 7 10 Espiritismo (termo) , 8 10 Sport Lisboa e Benfica , 9 10 Sismo de Lisboa de 1755 , 10 10 Biografias: S , 11 10 Biografias: M , 12 10 Biografias: B , 13 10 Biografias: A , 14 10 Chile , 15 10 Austrália , 16 9 Camaleão , 17 9 Biografias: R , 18 9 Biografias: E , 19 9 Biografias: D , 20 9 Guerra do Paraguai , 21 9 Portugal , 22 8 Febre maculosa , 23 8 Azulejo , 24 8 Ataque a Pearl Harbor , 25 8 Botafogo de Futebol e Regatas

dez 2005: 1 23 Portugal , 2 17 Biografias: M , 3 15 Biografias: S , 4 15 Biografias: C , 5 14 Igreja Universal do Reino de Deus , 6 14 Biografias: J , 7 14 Jesus , 8 14 Sport Club Corinthians Paulista , 9 14 Brasil , 10 13 Harry Potter , 11 13 Luiz Inácio Lula da Silva , 12 12 Biografias: P , 13 12 Biografias: F , 14 11 Copa do Mundo de Clubes da FIFA , 15 11 Sport Lisboa e Benfica , 16 11 Lista de feitiços em Harry Potter , 17 11 Ronaldinho Gaúcho , 18 11 Biografias: D , 19 11 Biografias: A , 20 10 Copa do Mundo FIFA de 2006 , 21 10 Sport Club Internacional , 22 10 Biografias: B , 23 10 Orkut , 24 10 São Paulo Futebol Clube , 25 10 Revolução Francesa

jan 2006: 1 23 Brasil , 2 19 Luiz Inácio Lula da Silva , 3 17 2006 , 4 17 Biografias: C , 5 17 Biografias: A , 6 17 São Paulo Futebol Clube , 7 17 Portugal , 8 17 Adolf Hitler , 9 16 Wikipédia , 10 16 Harry Potter , 11 16 Biografias: F , 12 15 Biografias: M , 13 14 2005 , 14 14 Biografias: R , 15 14 Orkut , 16 14 Chile , 17 14 Sport Club Corinthians Paulista , 18 13 Harry James Potter , 19 13 Copa do Mundo FIFA de 2006 , 20 13 Sociedade Esportiva Palmeiras , 21 13 Biografias: B , 22 12 Denominação cristã , 23 12 Clube Atlético Mineiro , 24 12 Biografias: J , 25 12 São Paulo (cidade)

fev 2006: 1 28 Luiz Inácio Lula da Silva , 2 18 Portugal , 3 17 Wikipédia , 4 17 Sport Club Corinthians Paulista , 5 16 Orkut , 6 15 Brasil , 7 14 Biografias: A , 8 13 Erwin Rommel , 9 13 Biografias: M , 10 13 Biografias: L , 11 13 Biografias: C , 12 13 The Beatles , 13 12 U2 , 14 12 Geraldo Alckmin , 15 12 Veja , 16 12 Segunda Guerra Mundial , 17 11 Piada , 18 11 Morangos com Açúcar , 19 11 Hacker , 20 11 Língua portuguesa , 21 11 Biografias: S , 22 11 São Paulo , 23 11 Juscelino Kubitschek , 24 11 Estados Unidos , 25 11 Angola

mar 2006: 1 34 Brasil , 2 25 Luiz Inácio Lula da Silva , 3 21 Portugal , 4 19 Orkut , 5 19 The Beatles , 6 19 Segunda Guerra Mundial , 7 17 Biografias: M , 8 16 Testemunhas de Jeová , 9 15 2006 , 10 15 Sport Club Corinthians Paulista , 11 14 Adolf Hitler , 12 13 Geraldo Alckmin , 13 13 Biografias: J , 14 12 Rio de Janeiro (cidade) , 15 12 Chuck Norris , 16 12 Marcos Pontes , 17 12 Biografias: G , 18 12 Biografias: C , 19 12 Biografias: A , 20 12 Curitiba , 21 12 Bíblia , 22 11 Igreja Universal do Reino de Deus , 23 11 Pedro I do Brasil , 24 11 Batalha das Termópilas , 25 11 Catarina Eufémia

abr 2006: 1 28 Brasil , 2 22 São Paulo Futebol Clube , 3 22 Portugal , 4 21 Orkut , 5 20 Morangos com Açúcar , 6 20 Luiz Inácio Lula da Silva , 7 19 Marcos Pontes , 8 19 Estados Unidos , 9 16 Sport Club Corinthians Paulista , 10 16 Alemanha , 11 15 Biografias: S , 12 15 Biografias: A , 13 15 São Paulo (cidade) , 14 15 Segunda Guerra Mundial , 15 14 Geraldo Alckmin , 16 14 2006 , 17 14 Biografias: J , 18 13 RedeTV! , 19 13 Britney Spears , 20 12 Wikipédia , 21 12 Sport Lisboa e Benfica , 22 12 Evo Morales , 23 12 Os Cavaleiros do Zodíaco , 24 12 Seleção Brasileira de Futebol , 25 12 Biografias: M

mai 2006: 1 29 Brasil , 2 26 Orkut , 3 25 Copa do Mundo FIFA de 2006 , 4 23 Portugal , 5 22 Sport Club Corinthians Paulista , 6 21 Biografias: A , 7 21 Luiz Inácio Lula da Silva , 8 17 Wikipédia , 9 17 Rede Globo , 10 17 Morangos com Açúcar , 11 17 Argentina , 12 16 Futebol , 13 16 Atos de violência organizada no Brasil em 2006 , 14 16 2006 , 15 16 Sérvia e Montenegro , 16 15 Biografias: L , 17 15 Biografias: J , 18 15 Biografias: C , 19 15 Copa do Mundo FIFA , 20 15 Florianópolis , 21 15 Espanha , 22 14 Lost (série de TV) , 23 14 Seleção Brasileira de Futebol , 24 14 Biografias: M , 25 14 Segunda Guerra Mundial

jun 2006: 1 66 Copa do Mundo FIFA de 2006 , 2 38 Brasil , 3 33 Bussunda , 4 26 Seleção Brasileira de Futebol , 5 26 Orkut , 6 25 Luiz Inácio Lula da Silva , 7 23 Copa do Mundo FIFA , 8 23 Alemanha , 9 21 Futebol , 10 19 Croácia , 11 19 Estados Unidos , 12 18 Casseta & Planeta , 13 18 Seleção Australiana de Futebol , 14 18 2006 , 15 18 Biografias: M , 16 18 Sport Club Corinthians Paulista , 17 17 Wikipédia , 18 17 Rebelde (telenovela) , 19 17 São Paulo (cidade) , 20 17 Gana , 21 17 Portugal , 22 17 Inglaterra , 23 17 Curitiba , 24 16 Trindade e Tobago , 25 15 Morangos com Açúcar

jul 2006: 1 38 Copa do Mundo FIFA de 2006 , 2 37 Brasil , 3 23 Clube de Regatas do Flamengo , 4 22 Zinédine Zidane , 5 21 Orkut , 6 20 Seleção Brasileira de Futebol , 7 20 Geraldo Alckmin , 8 19 RBD , 9 17 Hezbollah , 10 17 Biografias: M , 11 17 Biografias: A , 12 17 Estados Unidos , 13 16 Copa do Mundo FIFA , 14 16 Revolução Francesa , 15 16 Rio de Janeiro , 16 15 Anneliese Michel , 17 15 Linkin Park , 18 15 2006 , 19 15 São Paulo , 20 15 Alemanha , 21 14 Rio de Janeiro (cidade) , 22 14 Futebol , 23 14 Floribella (telenovela portuguesa) , 24 14 Conflito árabe-israelense , 25 14 Simple Plan

ago 2006: 1 27 Orkut , 2 25 Geraldo Alckmin , 3 25 Brasil , 4 22 Luiz Inácio Lula da Silva , 5 21 Hezbollah , 6 21 Sport Club Internacional , 7 21 Estados Unidos , 8 20 Wikipédia , 9 20 Adolf Hitler , 10 18 RBD , 11 18 Elvis Presley , 12 18 Emo , 13 17 Grêmio Foot-Ball Porto Alegrense , 14 17 Israel , 15 16 Paraíso Tropical , 16 16 Eleições gerais no Brasil em 2006 , 17 16 José Serra , 18 16 Plutão , 19 16 Fidel Castro , 20 15 Simple Plan , 21 15 Francisco Louçã , 22 15 Biografias: J , 23 15 Biografias: A , 24 15 São Paulo , 25 14 Rebelde (telenovela)

set 2006: 1 28 Brasil , 2 27 Orkut , 3 20 Eleições gerais no Brasil em 2006 , 4 20 Morangos com Açúcar , 5 19 Faculdade de Tecnologia de Jundiaí , 6 18 Geraldo Alckmin , 7 18 Estados Unidos , 8 17 São Paulo (cidade) , 9 17 Sport Club Corinthians Paulista , 10 16 Steve Irwin , 11 16 2006 , 12 16 Região Sul do Brasil , 13 15 Rebelde (telenovela) , 14 15 Páginas da Vida , 15 15 Biografias: M , 16 15 Biografias: J , 17 15 Biografias: C , 18 15 Santa Catarina , 19 15 Clube de Regatas do Flamengo , 20 14 RSS , 21 14 Grêmio Foot-Ball Porto Alegrense , 22 14 Rio Grande do Sul , 23 14 Segunda Guerra Mundial , 24 14 Portugal , 25 14 Japão

out 2006: 1 50 Brasil , 2 29 Orkut , 3 24 Wikipédia , 4 22 Luiz Inácio Lula da Silva , 5 21 Estados Unidos , 6 19 Eleições gerais no Brasil em 2006 , 7 19 Grêmio Foot-Ball Porto Alegrense , 8 18 Xuxa , 9 18 Sociedade Esportiva Palmeiras , 10 17 Lost (série de TV) , 11 17 Fernando Pessoa , 12 16 RBD , 13 16 Morangos com Açúcar , 14 15 YouTube , 15 15 Partido dos Trabalhadores , 16 15 Fernando Henrique Cardoso , 17 14 Britney Spears , 18 14 São Paulo (cidade) , 19 14 Segunda Guerra Mundial , 20 13 Rebelde (telenovela) , 21 13 Geraldo Alckmin , 22 13 José Serra , 23 13 Partido da Social Democracia Brasileira , 24 13 Sexo , 25 13 Clube Atlético Mineiro

nov 2006: 1 50 Brasil , 2 23 2006 , 3 23 Rio Grande do Sul , 4 21 Orkut , 5 21 Jesus , 6 19 Wikipédia , 7 19 Sistema Brasileiro de Televisão , 8 19 Club de Regatas Vasco da Gama , 9 19 África , 10 18 Morangos com Açúcar , 11 18 Britney Spears , 12 18 Curitiba , 13 17 Região Sul do Brasil , 14 17 Campeonato Brasileiro de Futebol , 15 17 Segunda Guerra Mundial , 16 17 Portugal , 17 16 Campeonato Brasileiro de Futebol de 2006 , 18 16 Japão , 19 16 Itália , 20 16 Sport Club Corinthians Paulista , 21 15 Toronto , 22 14 Kibe Loco , 23 14 Natal , 24 14 Clube Atlético Mineiro , 25 14 São Paulo (cidade)

dez 2006: 1 41 Brasil , 2 26 Saddam Hussein , 3 22 Wikipédia , 4 20 São Paulo (cidade) , 5 18 High School Musical , 6 18 Grêmio Foot-Ball Porto Alegrense , 7 18 Sport Club Internacional , 8 18 Club de Regatas Vasco da Gama , 9 17 2006 , 10 17 Natal , 11 17 Fortaleza , 12 16 Rio de Janeiro (cidade) , 13 15 Copa do Mundo de Clubes da FIFA , 14 15 Copa do Mundo de Clubes da FIFA de 2006 , 15 15 Augusto Pinochet , 16 15 Avril Lavigne , 17 15 Curitiba , 18 14 Rebelde (telenovela) , 19 14 Páginas da Vida , 20 14 RBD , 21 14 James Brown , 22 14 Sport Club Corinthians Paulista , 23 13 Papai Noel , 24 13 Botafogo de Futebol e Regatas , 25 13 Britney Spears

jan 2007: 1 32 Brasil , 2 23 Sport Lisboa e Benfica , 3 23 Daniella Cicarelli , 4 23 2007 , 5 23 Biografias: S , 6 23 Biografias: M , 7 23 Biografias: J , 8 18 Biografias: C , 9 17 Biografias: L , 10 17 Biografias: B , 11 17 Biografias: A , 12 17 São Paulo (cidade) , 13 16 YouTube , 14 16 São Paulo , 15 16 Sport Club Corinthians Paulista , 16 15 Malhação , 17 15 Saddam Hussein , 18 15 Club de Regatas Vasco da Gama , 19 14 Rebelde (telenovela) , 20 14 MTV Brasil , 21 14 Aborto , 22 14 Mona Lisa , 23 14 Biografias: R , 24 14 Biografias: H , 25 14 Luiz Inácio Lula da Silva

fev 2007: 1 15 Sport Lisboa e Benfica , 2 15 Harry Potter , 3 15 Big Brother Brasil , 4 15 Aborto , 5 15 Club de Regatas Vasco da Gama , 6 15 Direito , 7 15 Brasil , 8 14 Naruto , 9 14 2007 , 10 14 Biografias: J , 11 14 Sport Club Corinthians Paulista , 12 14 Aquecimento global , 13 13 Paraíso Tropical , 14 13 Carnaval do Brasil , 15 13 Avatar: The Last Airbender , 16 13 Ilha de São Vicente (Cabo Verde) , 17 13 Carnaval , 18 13 Biografias: A , 19 12 Madonna , 20 12 Futebol Clube do Porto , 21 12 Rede Globo , 22 12 Biografias: M , 23 12 Orkut , 24 12 Portugal , 25 12 Getúlio Vargas

mar 2007: 1 24 Brasil , 2 23 Aquecimento global , 3 20 Paraíso Tropical , 4 18 2007 , 5 18 Catolicismo , 6 17 Sport Lisboa e Benfica , 7 17 Big Brother Brasil , 8 16 Henry Sobel , 9 16 José Sócrates , 10 16 Amazônia , 11 16 Club de Regatas Vasco da Gama , 12 16 Água , 13 15 Sistema Brasileiro de Televisão , 14 15 História do Brasil , 15 15 Curitiba , 16 14 Rio de Janeiro (cidade) , 17 14 Ativismo pedófilo , 18 14 Ben 10 (desenho animado) , 19 14 Santo António de Lisboa , 20 14 Britney Spears , 21 14 São Paulo (cidade) , 22 13 Dia Internacional da Mulher , 23 13 Efeito estufa , 24 13 Sexo , 25 13 George W. Bush

abr 2007: 1 25 Brasil , 2 19 São Paulo Futebol Clube , 3 18 Canadá , 4 17 Rio de Janeiro (cidade) , 5 17 Biografias: A , 6 17 Adolf Hitler , 7 16 Heroes (série de televisão) , 8 16 Paraíso Tropical , 9 16 Campeonato Brasileiro de Futebol , 10 16 Juiz de Fora , 11 15 Fernanda Câncio , 12 15 Portugal , 13 15 Curitiba , 14 14 RecordTV , 15 14 Língua portuguesa , 16 14 Club de Regatas Vasco da Gama , 17 13 Nair Bello , 18 13 José Sócrates , 19 13 António de Oliveira Salazar , 20 13 2007 , 21 13 Universidade Estadual de Campinas , 22 13 Evanescence , 23 13 Revolução Francesa , 24 13 Deus , 25 13 Sport Club Corinthians Paulista

mai 2007: 1 32 Portugal , 2 27 Sistema Brasileiro de Televisão , 3 24 Rio de Janeiro (cidade) , 4 21 Romário , 5 20 São Paulo (cidade) , 6 20 Brasil , 7 19 Papa Bento XVI , 8 18 Eterna Magia , 9 18 Enéas Carneiro , 10 18 Sport Club Corinthians Paulista , 11 17 Greves de 2007 em universidades públicas brasileiras , 12 17 Avatar: The Last Airbender , 13 17 Frei Galvão , 14 17 Grêmio Foot-Ball Porto Alegrense , 15 17 Jesus , 16 16 RecordTV , 17 16 Adolf Hitler , 18 15 Globalização , 19 15 Clube Atlético Mineiro , 20 15 Leonardo da Vinci , 21 15 São Paulo Futebol Clube , 22 14 Shingo Yabuki , 23 14 2007 , 24 14 Sport Club Internacional , 25 14 Efeito estufa

jun 2007: 1 25 Sete Pecados , 2 21 Tríplice coroa , 3 21 Uberlândia , 4 21 Brasil , 5 20 Sistema Brasileiro de Televisão , 6 20 Grêmio Foot-Ball Porto Alegrense , 7 18 Sport Club Internacional , 8 18 Língua portuguesa , 9 17 Eterna Magia , 10 16 Paraíso Tropical , 11 15 Festa junina , 12 15 Região Sul do Brasil , 13 15 São Paulo , 14 14 Pé na Jaca , 15 14 Naruto , 16 14 2007 , 17 14 26 de junho , 18 14 Napoleão Bonaparte , 19 14 Vénus (planeta) , 20 14 Revolução Francesa , 21 14 Paraná , 22 14 Alemanha , 23 13 Rio de Janeiro (cidade) , 24 13 A Pedra do Reino , 25 13 Estádio do Maracanã

jul 2007: 1 82 Voo TAM 3054 , 2 39 Jogos Pan-Americanos de 2007 , 3 32 Brasil , 4 30 Antônio Carlos Magalhães , 5 25 Brasil nos Jogos Pan-Americanos de 2007 , 6 22 2007 , 7 22 Grêmio Foot-Ball Porto Alegrense , 8 21 Harry Potter and the Deathly Hallows , 9 20 Harry Potter , 10 20 Lista de feitiços em Harry Potter , 11 20 Sport Club Internacional , 12 20 Clube de Regatas do Flamengo , 13 19 Jade Barbosa , 14 19 Copa América de 2007 , 15 19 Botafogo de Futebol e Regatas , 16 19 São Paulo Futebol Clube , 17 18 Futebol nos Jogos Pan-Americanos de 2007 , 18 18 Estádio Olímpico João Havelange (Rio de Janeiro) , 19 18 Uberlândia , 20 17 Paraíso Tropical , 21 17 Club de Regatas Vasco da Gama , 22 16 Júlio Redecker , 23 16 Aeroporto de São Paulo-Congonhas , 24 16 Avril Lavigne , 25 16 Portugal

ago 2007: 1 31 Brasil , 2 23 Sistema Brasileiro de Televisão , 3 23 São Paulo Futebol Clube , 4 23 Portugal , 5 20 Sport Lisboa e Benfica , 6 20 Pênis , 7 20 Aquecimento global , 8 18 NX Zero , 9 18 Harry Potter and the Deathly Hallows , 10 18 Avril Lavigne , 11 18 Amor , 12 18 Segunda Guerra Mundial , 13 17 Paraíso Tropical , 14 17 José Sócrates , 15 16 Voo TAM 3054 , 16 16 Caminhos do Coração , 17 16 Folclore , 18 16 Sport Club Corinthians Paulista , 19 15 Amigas & Rivais , 20 15 Zac Efron , 21 15 High School Musical , 22 15 Rebelde (telenovela) , 23 15 Lista de feitiços em Harry Potter , 24 15 Clube Atlético Mineiro , 25 15 São Paulo (cidade)

set 2007: 1 37 Paraíso Tropical , 2 36 São Paulo Futebol Clube , 3 28 Sport Club Corinthians Paulista , 4 25 Avril Lavigne , 5 24 São Paulo (cidade) , 6 22 Rio de Janeiro (cidade) , 7 22 Ashley Tisdale , 8 22 Da Cor do Pecado , 9 22 Sistema Brasileiro de Televisão , 10 22 Naruto , 11 21 Record News , 12 21 Luciano Pavarotti , 13 21 Brasil , 14 20 Duas Caras (telenovela) , 15 20 Malhação , 16 20 2007 , 17 20 Morangos com Açúcar , 18 19 Água , 19 18 Desejo Proibido , 20 18 Sete Pecados , 21 18 Renan Calheiros , 22 18 Britney Spears , 23 17 Futebol , 24 17 RBD , 25 17 Independência do Brasil

out 2007: 1 39 Brasil , 2 38 Duas Caras (telenovela) , 3 26 Paraíso Tropical , 4 25 Sport Club Corinthians Paulista , 5 24 Paulo Autran , 6 24 Da Cor do Pecado , 7 22 Tropa de Elite , 8 22 São Paulo Futebol Clube , 9 21 Malhação , 10 21 São Paulo , 11 20 NX Zero , 12 20 Kimi Räikkönen , 13 20 2007 , 14 20 Portugal , 15 19 Cuba , 16 19 Vale a Pena Ver de Novo , 17 19 Copa do Mundo FIFA de 2014 , 18 19 Naruto , 19 19 Gay , 20 19 Britney Spears , 21 19 São Paulo (cidade) , 22 17 Rio de Janeiro (cidade) , 23 17 Rebelde (telenovela) , 24 17 Batalhão de Operações Policiais Especiais (PMERJ) , 25 17 Leonardo da Vinci

nov 2007: 1 34 Brasil , 2 33 Duas Caras (telenovela) , 3 26 Aníbal Cavaco Silva , 4 26 Belo Horizonte , 5 25 Campeonato Brasileiro de Futebol , 6 24 São Paulo (cidade) , 7 23 Desejo Proibido , 8 22 Coração de Estudante , 9 22 Hugo Chávez , 10 22 Brasília , 11 20 Avril Lavigne , 12 20 Naruto , 13 20 Britney Spears , 14 19 Zac Efron , 15 19 2007 , 16 19 Clube Atlético Mineiro , 17 19 Índice de Desenvolvimento Humano , 18 18 Vale a Pena Ver de Novo , 19 18 Malhação , 20 18 Sport Club Internacional , 21 17 Zumbi dos Palmares , 22 17 Esporte Clube Bahia , 23 17 Europa , 24 16 Centro Universitário Assunção , 25 16 NX Zero

dez 2007: 1 39 Brasil , 2 33 Sport Club Corinthians Paulista , 3 32 São Paulo (cidade) , 4 30 Duas Caras (telenovela) , 5 25 Sete Pecados , 6 24 2007 , 7 23 Clube Atlético Mineiro , 8 20 Gay , 9 19 Sistema Brasileiro de Televisão , 10 18 Malhação , 11 17 Benazir Bhutto , 12 17 Contribuição Provisória sobre Movimentação Financeira , 13 16 RBD , 14 16 Natal , 15 16 Sociedade Esportiva Palmeiras , 16 16 Club de Regatas Vasco da Gama , 17 15 Akatsuki , 18 15 Rede Globo , 19 15 Língua portuguesa , 20 15 Belo Horizonte , 21 14 Rio de Janeiro (cidade) , 22 14 Desejo Proibido , 23 14 Caminhos do Coração , 24 14 Norton Nascimento , 25 14 Naruto

jan 2008: 1 33 Brasil , 2 31 Sasuke Uchiha , 3 26 Duas Caras (telenovela) , 4 25 Sport Club Internacional , 5 23 Big Brother Brasil 8 , 6 20 Rede Globo , 7 19 Sete Pecados , 8 19 Bijuu (Naruto) , 9 19 Luiz Carlos Tourinho , 10 19 Aníbal Cavaco Silva , 11 18 Sport Lisboa e Benfica , 12 18 Heath Ledger , 13 18 São Paulo Futebol Clube , 14 17 NX Zero , 15 17 Ashley Tisdale , 16 16 Desejo Proibido , 17 16 Amigas & Rivais , 18 16 Kakashi Hatake , 19 16 Avril Lavigne , 20 16 Forças Armadas Revolucionárias da Colômbia , 21 16 Naruto , 22 16 2008 , 23 16 Morangos com Açúcar , 24 16 Língua portuguesa , 25 16 Jesus

fev 2008: 1 36 Brasil , 2 29 Kosovo , 3 27 Fidel Castro , 4 25 Sasuke Uchiha , 5 25 Taijutsu (Naruto) , 6 24 São Paulo (cidade) , 7 23 Beleza Pura , 8 23 Sete Pecados , 9 22 Caminhos do Coração , 10 22 Grêmio Foot-Ball Porto Alegrense , 11 21 Rio de Janeiro (cidade) , 12 21 Duas Caras (telenovela) , 13 20 Avril Lavigne , 14 20 2008 , 15 19 Bijuu (Naruto) , 16 19 Albert Einstein , 17 18 Beto Carrero , 18 18 Rede Globo , 19 16 Queridos Amigos , 20 16 Copa Libertadores da América de 2008 , 21 16 Kakashi Hatake , 22 16 Beija-Flor (escola de samba) , 23 16 Pelé , 24 15 Mariah Carey , 25 15 Xuxa

mar 2008: 1 37 Brasil , 2 33 Caminhos do Coração , 3 28 Duas Caras (telenovela) , 4 25 Clube Atlético Mineiro , 5 24 São Paulo (cidade) , 6 21 Taijutsu (Naruto) , 7 21 Itachi Uchiha , 8 20 NX Zero , 9 20 Sistema Brasileiro de Televisão , 10 20 Sport Club Internacional , 11 20 Portugal , 12 19 Imigração japonesa no Brasil , 13 19 Forças Armadas Revolucionárias da Colômbia , 14 19 Rede Globo , 15 18 Big Brother Brasil 8 , 16 18 Tokio Hotel , 17 18 2008 , 18 18 Argentina , 19 17 Jonas Brothers , 20 17 Miley Cyrus , 21 17 Ben 10 (desenho animado) , 22 16 Bill Kaulitz , 23 16 Salvador (Bahia) , 24 16 Mona Lisa , 25 16 Grêmio Foot-Ball Porto Alegrense

abr 2008: 1 53 Brasil , 2 40 Caminhos do Coração , 3 39 Caso Isabella Nardoni , 4 23 Rede Globo , 5 21 Sasuke Uchiha , 6 21 Dengue , 7 21 São Paulo (cidade) , 8 20 Beleza Pura , 9 20 Duas Caras (telenovela) , 10 20 Hannah Montana , 11 20 Sport Club Internacional , 12 19 Miley Cyrus , 13 19 Cabocla (2004) , 14 18 Ciranda de Pedra (2008) , 15 16 Desejo Proibido , 16 16 Sócrates , 17 15 Campeonato Brasileiro de Futebol de 2008 - Série C , 18 15 Taijutsu (Naruto) , 19 15 Sistema Brasileiro de Televisão , 20 15 Xuxa , 21 15 Amor , 22 15 Grêmio Foot-Ball Porto Alegrense , 23 15 1993 , 24 15 Jesus , 25 15 Clube de Regatas do Flamengo

mai 2008: 1 35 Caminhos do Coração , 2 32 A Favorita , 3 25 Beleza Pura , 4 25 Duas Caras (telenovela) , 5 24 Caso Isabella Nardoni , 6 23 Ciranda de Pedra (2008) , 7 23 São Paulo (cidade) , 8 21 2008 , 9 20 Clube de Regatas do Flamengo , 10 18 Avril Lavigne , 11 18 Brasil , 12 17 Desejo Proibido , 13 17 Dia do Trabalhador , 14 17 Cristianismo , 15 16 Lista de alienígenas de Ben 10 , 16 16 Britney Spears , 17 16 Sexo , 18 15 Futebol , 19 15 Jonas Brothers , 20 15 Miley Cyrus , 21 15 Acordo Ortográfico de 1990 , 22 15 Ashley Tisdale , 23 15 Rio de Janeiro , 24 15 Linux , 25 15 Sport Club Corinthians Paulista

jun 2008: 1 51 A Favorita , 2 39 Os Mutantes: Caminhos do Coração , 3 35 Campeonato Europeu de Futebol de 2008 , 4 26 Caminhos do Coração , 5 23 Duas Caras (telenovela) , 6 23 Cabocla (2004) , 7 22 Beleza Pura , 8 21 Sport Club do Recife , 9 20 Ciranda de Pedra (2008) , 10 20 Rede Globo , 11 20 Voleibol , 12 20 Argentina , 13 19 Ruth Cardoso , 14 19 Festa junina , 15 19 Pantanal (telenovela) , 16 18 RecordTV , 17 17 Ashley Tisdale , 18 17 Taijutsu (Naruto) , 19 17 Britney Spears , 20 17 Brasil , 21 16 Futebol , 22 16 Sistema Brasileiro de Televisão , 23 16 Basquetebol , 24 15 Malhação (15.ª temporada) , 25 15 RedeTV!

jul 2008: 1 34 Os Mutantes: Caminhos do Coração , 2 32 Dercy Gonçalves , 3 29 A Favorita , 4 26 Beleza Pura , 5 26 Clube de Regatas do Flamengo , 6 24 Jonas Brothers , 7 23 Povo dos Estados Unidos , 8 19 Ciranda de Pedra (2008) , 9 19 Chamas da Vida , 10 19 Cabocla (2004) , 11 18 Fluminense Football Club , 12 18 Britney Spears , 13 17 Campeonato Brasileiro de Futebol de 2008 - Série A , 14 17 Campeonato Brasileiro de Futebol de 2008 - Série C , 15 17 Vale a Pena Ver de Novo , 16 17 Sistema Brasileiro de Televisão , 17 17 Brasil , 18 16 Gilmar Mendes , 19 16 Íngrid Betancourt , 20 15 Futebol , 21 15 Caminhos do Coração , 22 15 Pantanal (telenovela) , 23 15 Jogos Olímpicos de Verão de 2008 , 24 15 2008 , 25 15 São Paulo (cidade)

ago 2008: 1 49 Jogos Olímpicos de Verão de 2008 , 2 45 Os Mutantes: Caminhos do Coração , 3 43 A Favorita , 4 34 Jonas Brothers , 5 34 Jogos Olímpicos , 6 31 Michael Phelps , 7 28 César Cielo , 8 27 Quadro de medalhas dos Jogos Olímpicos de Verão de 2008 , 9 26 Brasil nos Jogos Olímpicos de Verão de 2008 , 10 24 Beleza Pura , 11 24 Voleibol , 12 23 Sociedade Esportiva Palmeiras , 13 23 Club de Regatas Vasco da Gama , 14 23 Brasil , 15 22 Miley Cyrus , 16 20 Três Irmãs (telenovela) , 17 20 Usain Bolt , 18 20 Britney Spears , 19 20 China (civilização) , 20 20 Clube de Regatas do Flamengo , 21 19 Rede Globo , 22 18 RBD , 23 18 Mulheres Apaixonadas , 24 18 Sistema Brasileiro de Televisão , 25 18 Clube Atlético Mineiro

set 2008: 1 40 Os Mutantes: Caminhos do Coração , 2 37 Três Irmãs (telenovela) , 3 34 A Favorita , 4 28 Grande Colisor de Hádrons , 5 24 Ciranda de Pedra (2008) , 6 24 Beleza Pura , 7 23 Clube Atlético Mineiro , 8 22 Google , 9 21 Machado de Assis , 10 20 Independência do Brasil , 11 19 Mulheres Apaixonadas , 12 18 Club de Regatas Vasco da Gama , 13 17 Negócio da China , 14 17 Clube Atlético Paranaense , 15 17 Brasil , 16 16 Cristiano Ronaldo , 17 16 2008 , 18 16 Região Nordeste do Brasil , 19 16 Cruzeiro Esporte Clube , 20 16 Água , 21 15 Chamas da Vida , 22 15 Jonas Brothers , 23 15 NX Zero , 24 15 Paul Newman , 25 15 Sistema Brasileiro de Televisão

out 2008: 1 36 A Favorita , 2 36 Brasil , 3 26 Negócio da China , 4 26 Três Irmãs (telenovela) , 5 26 Britney Spears , 6 23 Portugal , 7 20 Wikipédia , 8 20 Os Mutantes: Caminhos do Coração , 9 20 Jonas Brothers , 10 20 NX Zero , 11 20 Jesus , 12 19 Fluminense Football Club , 13 19 Clube Atlético Mineiro , 14 19 Adolf Hitler , 15 18 Ciranda de Pedra (2008) , 16 18 Selena Gomez , 17 18 Sociedade Esportiva Palmeiras , 18 17 Íris Stefanelli , 19 17 Toma Lá, Dá Cá , 20 17 2008 , 21 17 Lisboa , 22 16 Malhação (15.ª temporada) , 23 16 Mulheres Apaixonadas , 24 16 Cruzeiro Esporte Clube , 25 16 Brasília

nov 2008: 1 38 A Favorita , 2 33 Barack Obama , 3 28 Os Mutantes: Caminhos do Coração , 4 27 Britney Spears , 5 24 Club de Regatas Vasco da Gama , 6 24 Brasil , 7 22 Negócio da China , 8 20 Lewis Hamilton , 9 19 RBD , 10 19 Portugal , 11 18 Pedro I do Brasil , 12 18 2008 , 13 18 George W. Bush , 14 18 São Paulo (cidade) , 15 17 NX Zero , 16 16 Três Irmãs (telenovela) , 17 16 Fluminense Football Club , 18 15 Rua Maria Antônia , 19 15 Rihanna , 20 15 Avril Lavigne , 21 15 Sociedade Esportiva Palmeiras , 22 15 Clube de Regatas do Flamengo , 23 15 Sport Club Corinthians Paulista , 24 14 Dilma Rousseff , 25 14 Sistema Brasileiro de Televisão

dez 2008: 1 48 A Favorita , 2 33 Grêmio Foot-Ball Porto Alegrense , 3 27 Campeonato Brasileiro de Futebol , 4 27 Club de Regatas Vasco da Gama , 5 26 Os Mutantes: Caminhos do Coração , 6 24 Sociedade Esportiva Palmeiras , 7 23 Sport Club Internacional , 8 23 São Paulo Futebol Clube , 9 22 Rihanna , 10 21 Habbo Hotel , 11 21 Britney Spears , 12 21 Sport Club Corinthians Paulista , 13 20 Copa do Mundo de Clubes da FIFA , 14 20 Três Irmãs (telenovela) , 15 20 NX Zero , 16 20 Fluminense Football Club , 17 20 Portugal , 18 20 Brasil , 19 19 Ronaldo Nazário , 20 18 Madonna , 21 18 Clube Atlético Mineiro , 22 18 Clube de Regatas do Flamengo , 23 16 Revelação (telenovela) , 24 16 Negócio da China , 25 16 Avril Lavigne

jan 2009: 1 39 A Favorita , 2 30 Barack Obama , 3 29 Os Mutantes: Caminhos do Coração , 4 25 Brasil , 5 24 Caminho das Índias , 6 24 Maysa , 7 24 Clube Atlético Mineiro , 8 23 Operação Chumbo Fundido , 9 22 Sport Club Corinthians Paulista , 10 21 Copa São Paulo de Futebol Júnior de 2009 , 11 21 2009 , 12 20 Maysa: Quando Fala o Coração , 13 20 Acordo Ortográfico de 1990 , 14 20 Grêmio Foot-Ball Porto Alegrense , 15 19 Malhação (16.ª temporada) , 16 19 Cristiano Ronaldo , 17 19 São Paulo Futebol Clube , 18 18 Miley Cyrus , 19 18 Sociedade Esportiva Palmeiras , 20 18 Britney Spears , 21 18 Clube de Regatas do Flamengo , 22 17 Santos Futebol Clube , 23 17 Lisboa , 24 16 Big Brother Brasil 9 , 25 16 Ashley Tisdale

fev 2009: 1 30 Brasil , 2 24 Sport Club Corinthians Paulista , 3 23 Os Mutantes: Caminhos do Coração , 4 23 Clube Atlético Mineiro , 5 22 Senhora do Destino , 6 21 Caminho das Índias , 7 20 Sky Brasil , 8 18 NX Zero , 9 18 Lisboa , 10 16 Copa Libertadores da América de 2009 , 11 16 Chamas da Vida , 12 16 Mulheres Apaixonadas , 13 16 Avril Lavigne , 14 16 Sociedade Esportiva Palmeiras , 15 15 Negócio da China , 16 15 Rihanna , 17 15 Sport Club Internacional , 18 14 Big Brother Brasil 9 , 19 14 Cesare Battisti (ativista) , 20 14 Barack Obama , 21 14 Paulínia , 22 14 Club de Regatas Vasco da Gama , 23 14 São Paulo (cidade) , 24 13 Jóhanna Sigurðardóttir , 25 13 Oscar 2009

mar 2009: 1 40 Clodovil Hernandes , 2 37 Ronaldo Nazário , 3 25 Mutantes: Promessas de Amor , 4 25 Big Brother Brasil 9 , 5 25 Os Mutantes: Caminhos do Coração , 6 23 Paraíso (2009) , 7 19 Sociedade Esportiva Palmeiras , 8 18 Naruto Uzumaki , 9 17 Caminho das Índias , 10 17 Acordo Ortográfico de 1990 , 11 17 Clube de Regatas do Flamengo , 12 16 Clube Atlético Mineiro , 13 16 1994 , 14 15 Caras & Bocas , 15 15 Negócio da China , 16 15 Três Irmãs (telenovela) , 17 15 Temporada de Fórmula 1 de 2009 , 18 15 Sport Club Corinthians Paulista , 19 14 Paulo Pimenta , 20 14 Natasha Richardson , 21 14 Guns N' Roses , 22 14 São Paulo Futebol Clube , 23 13 Copa do Brasil de Futebol de 2009 , 24 13 Big Brother Brasil , 25 13 Senhora do Destino

abr 2009: 1 31 Caras & Bocas , 2 29 Gripe suína , 3 27 Pandemia de gripe A de 2009 , 4 25 Ronaldo Nazário , 5 22 Caminho das Índias , 6 22 Clube de Regatas do Flamengo , 7 22 Sport Club Corinthians Paulista , 8 21 Grêmio Foot-Ball Porto Alegrense , 9 20 Susan Boyle , 10 19 Avril Lavigne , 11 18 Cruzeiro Esporte Clube , 12 17 Mutantes: Promessas de Amor , 13 17 Chamas da Vida , 14 17 Rede Globo , 15 17 Clube Atlético Mineiro , 16 16 Campeonato Brasileiro de Futebol de 2009 - Série D , 17 16 2009 , 18 16 Santos Futebol Clube , 19 16 Sociedade Esportiva Palmeiras , 20 15 Acordo Ortográfico de 1990 , 21 15 Fluminense Football Club , 22 15 Sistema Brasileiro de Televisão , 23 15 Nuno Álvares Pereira , 24 15 Língua portuguesa , 25 15 Gato

mai 2009: 1 31 Ronaldo Nazário , 2 30 Pandemia de gripe A de 2009 , 3 30 Clube de Regatas do Flamengo , 4 29 Sport Club Corinthians Paulista , 5 25 Gripe suína , 6 25 Fluminense Football Club , 7 25 Avril Lavigne , 8 25 Grêmio Foot-Ball Porto Alegrense , 9 24 Caras & Bocas , 10 23 Copa Libertadores da América de 2009 , 11 23 Rede Globo , 12 23 Sociedade Esportiva Palmeiras , 13 23 Clube Atlético Mineiro , 14 23 Cruzeiro Esporte Clube , 15 23 São Paulo Futebol Clube , 16 20 Caminho das Índias , 17 19 Mutantes: Promessas de Amor , 18 17 Darwinius masillae , 19 17 Campeonato Brasileiro de Futebol de 2009 - Série A , 20 17 Sport Club Internacional , 21 17 Club de Regatas Vasco da Gama , 22 17 Brasil , 23 16 BRF , 24 16 Poder Paralelo , 25 16 Campeonato Brasileiro de Futebol de 2009 - Série D

jun 2009: 1 71 Michael Jackson , 2 64 Voo Air France 447 , 3 33 Caminho das Índias , 4 33 Copa das Confederações FIFA de 2009 , 5 24 Cristiano Ronaldo , 6 24 Rede Globo , 7 23 Clube de Regatas do Flamengo , 8 21 Vende-se um Véu de Noiva , 9 21 A Fazenda , 10 21 Pedro Luís de Orléans e Bragança , 11 21 Real Madrid Club de Fútbol , 12 21 Sport Club Corinthians Paulista , 13 20 Festa junina , 14 20 Sociedade Esportiva Palmeiras , 15 20 São Paulo Futebol Clube , 16 19 Pandemia de gripe A de 2009 , 17 19 Copa das Confederações FIFA , 18 19 Seleção Brasileira de Futebol , 19 19 Senhora do Destino , 20 19 Sport Club Internacional , 21 19 Club de Regatas Vasco da Gama , 22 18 Caras & Bocas , 23 17 Miley Cyrus , 24 17 Kaká , 25 17 Britney Spears

jul 2009: 1 55 Michael Jackson , 2 33 Bela, a Feia , 3 31 Caras & Bocas , 4 29 Caminho das Índias , 5 25 Clube de Regatas do Flamengo , 6 24 Golpe militar em Honduras em 2009 , 7 23 Som & Fúria , 8 23 Britney Spears , 9 23 Clube Atlético Mineiro , 10 23 Cruzeiro Esporte Clube , 11 22 2009 , 12 22 São Paulo Futebol Clube , 13 22 Sport Club Corinthians Paulista , 14 21 Ronaldo Nazário , 15 21 Sistema Brasileiro de Televisão , 16 19 Sasuke Uchiha , 17 19 Mutantes: Promessas de Amor , 18 19 Real Madrid Club de Fútbol , 19 18 Poder Paralelo , 20 18 Santos Futebol Clube , 21 17 Ilha dos Desafios , 22 17 Rede Globo , 23 17 Sport Club Internacional , 24 17 Sociedade Esportiva Palmeiras , 25 16 Vende-se um Véu de Noiva

ago 2009: 1 39 Michael Jackson , 2 33 Bela, a Feia , 3 33 Caminho das Índias , 4 33 Brasil , 5 28 Ilha dos Desafios , 6 26 RecordTV , 7 26 Clube de Regatas do Flamengo , 8 25 Sistema Brasileiro de Televisão , 9 25 Rede Globo , 10 25 Club de Regatas Vasco da Gama , 11 24 Caras & Bocas , 12 24 Sport Club Corinthians Paulista , 13 23 Viver a Vida (telenovela) , 14 23 Usain Bolt , 15 23 Grêmio Foot-Ball Porto Alegrense , 16 23 São Paulo Futebol Clube , 17 22 Alma Gêmea , 18 21 Pandemia de gripe A de 2009 no Brasil , 19 21 A Fazenda , 20 19 Senhora do Destino , 21 19 Santos Futebol Clube , 22 18 Pandemia de gripe A de 2009 , 23 18 Madonna , 24 18 Sport Club Internacional , 25 18 Clube Atlético Mineiro

set 2009: 1 39 Viver a Vida (telenovela) , 2 39 Caminho das Índias , 3 23 Caras & Bocas , 4 22 Brasil , 5 21 Patrick Swayze , 6 21 Sistema Brasileiro de Televisão , 7 21 2009 , 8 20 Britney Spears , 9 20 Sport Club Corinthians Paulista , 10 19 Grêmio Foot-Ball Porto Alegrense , 11 18 Cama de Gato (telenovela) , 12 18 Camada pré-sal , 13 18 Cruzeiro Esporte Clube , 14 17 Rede Globo , 15 16 Sasuke Uchiha , 16 16 Bela, a Feia , 17 16 Paraíso (2009) , 18 16 Cristiano Ronaldo , 19 16 Santos Futebol Clube , 20 15 Ilha dos Desafios , 21 15 Supernatural (série de televisão) , 22 15 Fluminense Football Club , 23 15 Alma Gêmea , 24 15 Andebol , 25 15 Clube Atlético Mineiro

out 2009: 1 36 Viver a Vida (telenovela) , 2 27 Jogos Olímpicos de Verão de 2016 , 3 26 Maitê Proença , 4 26 Britney Spears , 5 24 Cama de Gato (telenovela) , 6 23 Michael Jackson , 7 22 Rede Globo , 8 21 Pânico na TV , 9 21 Brasil , 10 20 Sport Club Internacional , 11 17 Malhação (16.ª temporada) , 12 17 Mercedes Sosa , 13 17 Sistema Brasileiro de Televisão , 14 17 Clube Atlético Mineiro , 15 17 Portugal , 16 16 São Paulo Futebol Clube , 17 15 Twitter , 18 15 Windows 7 , 19 15 Jonas Brothers , 20 15 Barack Obama , 21 15 Rogério Ceni , 22 15 RecordTV , 23 14 Rio de Janeiro (cidade) , 24 14 Caras & Bocas , 25 14 Ilha dos Desafios

nov 2009: 1 32 Apagão no Brasil e Paraguai em 2009 , 2 31 Daniel Pádua , 3 27 Viver a Vida (telenovela) , 4 22 Malhação (17.ª temporada) , 5 22 Brasil , 6 21 Lady Gaga , 7 21 Naruto , 8 20 Claude Lévi-Strauss , 9 19 Fluminense Football Club , 10 19 São Paulo Futebol Clube , 11 19 Clube de Regatas do Flamengo , 12 18 Caras & Bocas , 13 18 Temporada de Fórmula 1 de 2010 , 14 18 Selena Gomez , 15 18 RecordTV , 16 18 Britney Spears , 17 17 Análise financeira , 18 17 Copa do Mundo FIFA de 2010 , 19 17 Pânico na TV , 20 17 Club de Regatas Vasco da Gama , 21 16 Cine (banda) , 22 16 Cama de Gato (telenovela) , 23 15 Jonas Brothers , 24 15 Celso Pitta , 25 15 Sistema Brasileiro de Televisão

dez 2009: 1 47 Clube de Regatas do Flamengo , 2 27 Campeonato Brasileiro de Futebol , 3 27 Club de Regatas Vasco da Gama , 4 25 Viver a Vida (telenovela) , 5 25 Leila Lopes , 6 24 Caras & Bocas , 7 24 Brittany Murphy , 8 24 Clube Atlético Mineiro , 9 24 Brasil , 10 22 Cinquentinha , 11 22 Copa do Mundo FIFA de 2010 , 12 22 Sistema Brasileiro de Televisão , 13 21 Temporada de Fórmula 1 de 2010 , 14 21 RecordTV , 15 21 2010 , 16 21 São Paulo Futebol Clube , 17 20 Avatar (filme) , 18 18 Tempos Modernos (telenovela) , 19 18 Bela, a Feia , 20 18 Lombardi (locutor) , 21 18 Lady Gaga , 22 18 Supernatural (série de televisão) , 23 18 Sport Club Internacional , 24 17 Copa do Mundo de Clubes da FIFA , 25 17 Campeonato Brasileiro de Futebol de 2009 - Série A

jan 2010: 1 39 Tempos Modernos (telenovela) , 2 36 2010 , 3 34 Zilda Arns , 4 33 Clube de Regatas do Flamengo , 5 28 Partido da imprensa golpista , 6 26 Caras & Bocas , 7 26 Brasil , 8 25 Sismo do Haiti de 2010 , 9 25 Big Brother Brasil 10 , 10 25 Avatar (filme) , 11 24 Burj Khalifa , 12 23 Supernatural (série de televisão) , 13 23 Haiti , 14 23 São Paulo Futebol Clube , 15 22 Viver a Vida (telenovela) , 16 21 Cama de Gato (telenovela) , 17 20 Cristiano Ronaldo , 18 20 Rede Globo , 19 20 Sociedade Esportiva Palmeiras , 20 20 Britney Spears , 21 20 Club de Regatas Vasco da Gama , 22 20 Sport Club Corinthians Paulista , 23 19 Lady Gaga , 24 19 Santos Futebol Clube , 25 18 Copa São Paulo de Futebol Júnior de 2010

fev 2010: 1 27 Big Brother Brasil 10 , 2 26 Clube de Regatas do Flamengo , 3 24 2010 , 4 23 Viver a Vida (telenovela) , 5 22 Rede Globo , 6 22 Santos Futebol Clube , 7 21 Lady Gaga , 8 21 Sport Club Corinthians Paulista , 9 20 Sismo do Chile de 2010 , 10 20 Alma Gêmea , 11 19 Uma Rosa com Amor (2010) , 12 19 Tempos Modernos (telenovela) , 13 19 José Roberto Arruda , 14 19 Beyoncé , 15 19 RecordTV , 16 19 Sociedade Esportiva Palmeiras , 17 18 Total Drama Action , 18 17 Roberto Abbondanzieri , 19 17 Jogos Olímpicos de Inverno de 2010 , 20 17 Botafogo de Futebol e Regatas , 21 17 Cruzeiro Esporte Clube , 22 17 Luiz Inácio Lula da Silva , 23 16 Copa Libertadores da América de 2010 , 24 16 Miley Cyrus , 25 16 Britney Spears

mar 2010: 1 40 Lady Gaga , 2 25 Big Brother Brasil 10 , 3 25 Caso Isabella Nardoni , 4 24 Cama de Gato (telenovela) , 5 23 Rede Globo , 6 22 Viver a Vida (telenovela) , 7 21 Israel , 8 20 Marcelo Dourado , 9 20 Big Brother Brasil , 10 20 Luiz Inácio Lula da Silva , 11 20 Brasil , 12 19 2010 , 13 19 Club de Regatas Vasco da Gama , 14 18 Copa do Brasil de Futebol de 2010 , 15 18 Temporada de Fórmula 1 de 2010 , 16 18 Miley Cyrus , 17 17 Isa TK+ , 18 17 Kesha , 19 17 Isa TKM , 20 17 São Paulo (cidade) , 21 16 Escrito nas Estrelas (telenovela) , 22 16 Sismo do Chile de 2010 , 23 16 Sinhá Moça (2006) , 24 16 Glauco Villas Boas , 25 16 Ronaldo Nazário

abr 2010: 1 27 Viver a Vida (telenovela) , 2 26 Escrito nas Estrelas (telenovela) , 3 26 Rede Globo , 4 21 Naruto , 5 21 José Serra , 6 21 Campeonato Brasileiro de Futebol , 7 20 Tempos Modernos (telenovela) , 8 20 Isa TK+ , 9 20 Sport Club Corinthians Paulista , 10 19 Clube Atlético Mineiro , 11 19 Sol , 12 19 Clube de Regatas do Flamengo , 13 19 Brasil , 14 18 Cama de Gato (telenovela) , 15 18 Copa Libertadores da América de 2010 , 16 18 Lech Kaczyński , 17 18 Botafogo de Futebol e Regatas , 18 18 São Miguel Arcanjo (São Paulo) , 19 18 Portugal , 20 17 Teoria das hidroplacas , 21 17 Bela, a Feia , 22 17 Grêmio Foot-Ball Porto Alegrense , 23 17 Britney Spears , 24 16 Desastres naturais no Rio de Janeiro em abril de 2010 , 25 16 Fluminense Football Club

mai 2010: 1 43 Passione , 2 27 Ribeirão do Tempo , 3 26 Seleção Brasileira de Futebol , 4 23 Restart (banda) , 5 23 Escrito nas Estrelas (telenovela) , 6 21 Bela, a Feia , 7 21 Viver a Vida (telenovela) , 8 21 Grêmio Foot-Ball Porto Alegrense , 9 20 Santos Futebol Clube , 10 19 Tempos Modernos (telenovela) , 11 19 Brasil , 12 18 Ben 10: Supremacia Alienígena , 13 18 Cruzeiro Esporte Clube , 14 17 Wikipédia , 15 17 Sistema Brasileiro de Televisão , 16 17 Futebol Clube do Porto , 17 16 Voo Afriqiyah Airways 771 , 18 16 Copa Libertadores da América de 2010 , 19 16 Ben 10: Alien Force , 20 16 Botafogo de Futebol e Regatas , 21 16 Portugal , 22 15 Ashley Tisdale , 23 15 Lionel Messi , 24 15 Naruto Uzumaki , 25 15 Naruto

jun 2010: 1 80 Copa do Mundo FIFA de 2010 , 2 31 José Saramago , 3 30 Passione , 4 23 Ataque à Flotilha da Liberdade , 5 20 Tempos Modernos (telenovela) , 6 19 Justin Bieber , 7 19 Seleção Brasileira de Futebol , 8 19 Brasil , 9 18 Vuvuzela , 10 18 Rede Globo , 11 18 Cruzeiro Esporte Clube , 12 17 Bela, a Feia , 13 17 Seleção Portuguesa de Futebol , 14 17 Shakira , 15 17 Futebol Clube do Porto , 16 16 Isa TK+ , 17 16 Copa do Mundo FIFA de 2010 – Grupo A , 18 16 Kaká , 19 16 Clube Atlético Mineiro , 20 16 Clube de Regatas do Flamengo , 21 15 Ribeirão do Tempo , 22 15 Escrito nas Estrelas (telenovela) , 23 15 Copa do Mundo FIFA de 2010 – Grupo G , 24 15 Guns N' Roses , 25 15 Copa do Mundo FIFA

jul 2010: 1 49 Copa do Mundo FIFA de 2010 , 2 37 Lady Gaga , 3 37 Seleção Brasileira de Futebol , 4 35 Ti Ti Ti (2010) , 5 30 Copa do Mundo FIFA de 2014 , 6 29 Caso Eliza Samudio , 7 28 Bruno Fernandes de Souza , 8 28 Copa do Mundo FIFA , 9 26 Tempos Modernos (telenovela) , 10 26 Mano Menezes , 11 25 Seleção Espanhola de Futebol , 12 23 Felipe Melo , 13 23 Clube Atlético Mineiro , 14 22 Escrito nas Estrelas (telenovela) , 15 21 João Moutinho , 16 21 Clube de Regatas do Flamengo , 17 21 Brasil , 18 19 Dunga , 19 18 Ribeirão do Tempo , 20 18 Passione , 21 18 Adidas Jabulani , 22 18 ICarly , 23 18 Sistema Brasileiro de Televisão , 24 18 Futebol Clube do Porto , 25 17 Paul (polvo)

ago 2010: 1 31 Ti Ti Ti (2010) , 2 28 Sport Club Internacional , 3 28 Portugal , 4 26 Lady Gaga , 5 24 Total Drama Action , 6 24 Brasil , 7 23 Dilma Rousseff , 8 23 José Serra , 9 22 Neymar , 10 21 Campeonato Brasileiro de Futebol de 2010 - Série A , 11 21 Clube Atlético Mineiro , 12 21 Cruzeiro Esporte Clube , 13 20 Ronaldinho Gaúcho , 14 20 Rede Globo , 15 19 Grêmio Foot-Ball Porto Alegrense , 16 18 Malhação (18.ª temporada) , 17 18 Passione , 18 18 Seleção Brasileira de Futebol , 19 18 Sport Club Corinthians Paulista , 20 17 Escrito nas Estrelas (telenovela) , 21 17 Fluminense Football Club , 22 17 Robinho , 23 16 Cine (banda) , 24 16 Felipe Garcia dos Prazeres , 25 16 Dulce María

set 2010: 1 28 Brasil , 2 25 Clube de Regatas do Flamengo , 3 22 Lady Gaga , 4 21 A Fazenda 3 , 5 21 Rede Globo , 6 21 Portugal , 7 20 Justin Bieber , 8 20 Madonna , 9 20 Clube Atlético Mineiro , 10 20 São Paulo Futebol Clube , 11 20 Sport Club Corinthians Paulista , 12 19 Araguaia (telenovela) , 13 19 Ti Ti Ti (2010) , 14 19 Escrito nas Estrelas (telenovela) , 15 18 Erenice Guerra , 16 18 Fluminense Football Club , 17 18 Grêmio Foot-Ball Porto Alegrense , 18 18 Sport Club Internacional , 19 16 Implantação da República Portuguesa , 20 16 Independência do Brasil , 21 16 Club de Regatas Vasco da Gama , 22 15 Marina Silva , 23 14 Cine (banda) , 24 14 Campeonato Brasileiro de Futebol de 2010 - Série A , 25 14 Neymar

out 2010: 1 49 Dilma Rousseff , 2 29 José Serra , 3 24 Anahí , 4 22 Luiz Inácio Lula da Silva , 5 20 Restart (banda) , 6 20 Marina Silva , 7 20 Clube de Regatas do Flamengo , 8 19 Eleição presidencial no Brasil em 2010 , 9 19 Romeu Tuma , 10 19 Portugal , 11 18 Acidente na mina San José em 2010 , 12 18 Tropa de Elite 2: o Inimigo agora É Outro , 13 18 Cruzeiro Esporte Clube , 14 18 Brasil , 15 17 A Fazenda 3 , 16 17 2010 , 17 16 Santos Futebol Clube , 18 16 Sociedade Esportiva Palmeiras , 19 16 Club de Regatas Vasco da Gama , 20 15 Araguaia (telenovela) , 21 15 Passione , 22 15 Cristiano Ronaldo , 23 15 Mario Vargas Llosa , 24 15 Partido dos Trabalhadores , 25 15 Grêmio Foot-Ball Porto Alegrense

nov 2010: 1 66 Dilma Rousseff , 2 37 Luiz Inácio Lula da Silva , 3 33 Brasil , 4 27 Atos de violência organizada no Rio de Janeiro em 2010 , 5 20 Katy Perry , 6 20 Clube de Regatas do Flamengo , 7 19 Clube Atlético Mineiro , 8 17 Restart (banda) , 9 17 Leslie Nielsen , 10 17 Fluminense Football Club , 11 17 Madonna , 12 17 Botafogo de Futebol e Regatas , 13 17 Esporte Clube Bahia , 14 16 Lista de presidentes do Brasil , 15 16 Michael Jackson , 16 15 Kesha , 17 15 Rede Globo , 18 15 2010 , 19 15 Portugal , 20 15 Sport Club Corinthians Paulista , 21 14 Lista de episódios de iCarly , 22 14 Marina Silva , 23 14 Cher , 24 14 Seleção Brasileira de Futebol , 25 14 Futebol Clube do Porto

dez 2010: 1 47 Campeonato Brasileiro de Futebol , 2 44 Fluminense Football Club , 3 33 Santos Futebol Clube , 4 29 Grêmio Foot-Ball Porto Alegrense , 5 28 Clube Atlético Mineiro , 6 27 Sport Club Corinthians Paulista , 7 26 Clube de Regatas do Flamengo , 8 25 Campeonato Brasileiro de Futebol de 2010 - Série A , 9 25 Copa do Mundo de Clubes da FIFA de 2010 , 10 24 Sociedade Esportiva Palmeiras , 11 24 Club de Regatas Vasco da Gama , 12 22 São Paulo Futebol Clube , 13 20 Justin Bieber , 14 20 Lady Gaga , 15 20 WikiLeaks , 16 19 Cyndi Lauper , 17 19 Sport Club Internacional , 18 19 Cruzeiro Esporte Clube , 19 18 Rede Globo , 20 18 Portugal , 21 17 Julian Assange , 22 17 Anahí , 23 17 Dilma Rousseff , 24 16 Tout Puissant Mazembe , 25 16 Futbol Club Barcelona

jan 2011: 1 60 Dilma Rousseff , 2 42 Ronaldinho Gaúcho , 3 29 Enchentes e deslizamentos de terra no Rio de Janeiro em 2011 , 4 29 Big Brother Brasil 11 , 5 27 Copa São Paulo de Futebol Júnior de 2011 , 6 26 Campeonato Brasileiro de Futebol , 7 25 Grêmio Foot-Ball Porto Alegrense , 8 25 Cruzeiro Esporte Clube , 9 25 Luiz Inácio Lula da Silva , 10 24 Passione , 11 24 Santos Futebol Clube , 12 24 Brasil , 13 23 Lionel Messi , 14 23 Fluminense Football Club , 15 23 Club de Regatas Vasco da Gama , 16 22 Cristiano Ronaldo , 17 22 2011 , 18 22 Portugal , 19 22 Clube de Regatas do Flamengo , 20 21 Hold It Against Me , 21 21 Clube Atlético Mineiro , 22 20 Insensato Coração , 23 20 ICarly , 24 20 Thiago Neves , 25 20 Sport Club Corinthians Paulista

fev 2011: 1 37 Grêmio Foot-Ball Porto Alegrense , 2 30 Ronaldo Nazário , 3 25 Hosni Mubarak , 4 24 Big Brother Brasil 11 , 5 24 Ronaldinho Gaúcho , 6 24 Sport Club Internacional , 7 24 Clube de Regatas do Flamengo , 8 23 Justin Bieber , 9 23 Sport Club Corinthians Paulista , 10 22 Revolução Egípcia de 2011 , 11 22 Liédson , 12 20 Femme Fatale (álbum) , 13 20 Rogério Ceni , 14 20 RecordTV , 15 20 Campeonato Brasileiro de Futebol , 16 19 Lady Gaga , 17 19 Fluminense Football Club , 18 19 Santos Futebol Clube , 19 19 Club de Regatas Vasco da Gama , 20 18 Egito , 21 17 Free step , 22 16 Born This Way (canção) , 23 16 Copa União , 24 16 Katy Perry , 25 16 ICarly

mar 2011: 1 34 Sismo e tsunami de Tohoku de 2011 , 2 28 Big Brother Brasil 11 , 3 26 José Alencar , 4 25 Britney Spears , 5 22 Rebelde (telenovela brasileira) , 6 22 Fluminense Football Club , 7 22 Sport Club Internacional , 8 21 Morde & Assopra , 9 21 Elizabeth Taylor , 10 21 2011 , 11 20 Selena Gomez , 12 20 Sport Club Corinthians Paulista , 13 19 Ti Ti Ti (2010) , 14 19 ICarly , 15 19 Adriano Leite Ribeiro , 16 19 Líbia , 17 18 Rebecca Black , 18 18 Manu Gavassi , 19 17 Sistema operativo , 20 17 Portugal , 21 16 Wikipédia , 22 16 Guerra Civil Líbia (2011) , 23 16 Araguaia (telenovela) , 24 16 Everybody Hates Chris , 25 16 Botafogo de Futebol e Regatas

abr 2011: 1 52 Massacre de Realengo , 2 25 Banda colorida , 3 25 Britney Spears , 4 23 Catarina, Duquesa de Cambridge , 5 22 Sport Club Internacional , 6 21 Cordel Encantado , 7 20 Espiritismo (termo) , 8 20 Portugal , 9 19 Fluminense Football Club , 10 19 Guilherme, Duque de Cambridge , 11 18 Born This Way (canção) , 12 18 Copa Libertadores da América de 2011 , 13 18 Copa do Brasil de Futebol de 2011 , 14 18 Neonazismo , 15 17 Amor e Revolução , 16 17 Campeonato Paulista de Futebol de 2011 , 17 17 Chico Xavier , 18 17 Grêmio Foot-Ball Porto Alegrense , 19 16 Rebelde (telenovela brasileira) , 20 16 ICarly , 21 16 Páscoa , 22 16 Futebol Clube do Porto , 23 16 Brasil , 24 16 Ateísmo , 25 15 Veganismo

mai 2011: 1 57 Osama bin Laden , 2 51 Morte de Osama bin Laden , 3 22 Lionel Messi , 4 20 Grêmio Foot-Ball Porto Alegrense , 5 20 Brasil , 6 19 Ezequiel Miralles , 7 19 Fluminense Football Club , 8 19 Coritiba Foot Ball Club , 9 19 Clube Atlético Mineiro , 10 19 Sport Club Corinthians Paulista , 11 18 Neymar , 12 18 Yahoo! Respostas , 13 18 Botafogo de Futebol e Regatas , 14 18 Portugal , 15 17 Born This Way , 16 17 Santos Futebol Clube , 17 17 Club de Regatas Vasco da Gama , 18 16 Protestos de 2011 na Espanha , 19 16 Copa do Brasil de Futebol de 2011 , 20 16 Ronaldinho Gaúcho , 21 16 2011 , 22 15 Insensato Coração , 23 15 Futebol Clube do Porto , 24 14 Casamento de Guilherme de Gales e Catarina Middleton , 25 14 Campeonato Brasileiro de Futebol de 2011 - Série D

jun 2011: 1 28 Angélico Vieira , 2 25 Santos Futebol Clube , 3 23 Pedro Passos Coelho , 4 21 Club de Regatas Vasco da Gama , 5 18 Copa do Brasil de Futebol de 2011 , 6 17 Fluminense Football Club , 7 17 Ronaldinho Gaúcho , 8 16 Neymar , 9 16 2011 , 10 16 Sporting Clube de Portugal , 11 16 Clube Atlético Paranaense , 12 16 Portugal , 13 15 Gleisi Hoffmann , 14 15 José Sócrates , 15 14 Mortes em junho de 2011 , 16 14 Eleições legislativas portuguesas de 2011 , 17 14 Lucas Rodrigues Moura da Silva , 18 14 Miranda Cosgrove , 19 14 Antonio Palocci , 20 14 Seleção Brasileira de Futebol , 21 14 Botafogo de Futebol e Regatas , 22 14 Chocolate , 23 14 Sport Club Corinthians Paulista , 24 13 Morde & Assopra , 25 13 Insensato Coração

jul 2011: 1 52 Amy Winehouse , 2 32 Sudão do Sul , 3 31 O Astro (2011) , 4 28 Itamar Franco , 5 26 Copa América de 2011 , 6 24 Atentados de 22 de julho de 2011 na Noruega , 7 22 Santos Futebol Clube , 8 21 Neymar , 9 21 Fluminense Football Club , 10 21 Seleção Brasileira de Futebol , 11 20 Harry Potter and the Deathly Hallows – Part 2 , 12 20 Born This Way , 13 19 Portugal , 14 18 Alejandro Martinuccio , 15 18 Clube Atlético Paranaense , 16 17 A Fazenda 4 , 17 17 Campeonato Brasileiro de Futebol de 2011 - Série A , 18 17 Rogério Ceni , 19 17 Sporting Clube de Portugal , 20 16 Harry Potter , 21 16 Copa América , 22 16 Pelé , 23 15 Morde & Assopra , 24 15 Total Drama World Tour , 25 15 Copa do Mundo de Futebol Feminino de 2011

ago 2011: 1 30 Ronaldinho Gaúcho , 2 28 Fina Estampa , 3 27 Tumultos na Inglaterra em 2011 , 4 21 Hiperconjugação , 5 18 Copa do Mundo FIFA Sub-20 de 2011 , 6 18 Fluminense Football Club , 7 18 Sociedade Esportiva Palmeiras , 8 17 O Astro (2011) , 9 17 Insensato Coração , 10 17 Dilma Rousseff , 11 16 Wikipédia , 12 16 Santos Futebol Clube , 13 16 Grêmio Foot-Ball Porto Alegrense , 14 16 Club de Regatas Vasco da Gama , 15 15 Pro Evolution Soccer 2012 , 16 15 A Fazenda 4 , 17 15 Morde & Assopra , 18 15 Malhação (18.ª temporada) , 19 15 Sport Club Internacional , 20 15 São Paulo Futebol Clube , 21 15 Folclore , 22 14 UFC 134 , 23 14 Elenco de Insensato Coração , 24 14 Harry Potter and the Deathly Hallows – Part 2 , 25 14 Futbol Club Barcelona

set 2011: 1 27 Leila Lopes (Miss Universo) , 2 23 A Vida da Gente , 3 23 Fina Estampa , 4 21 Rock in Rio , 5 17 Miss Universo 2011 , 6 17 Rogério Ceni , 7 17 Ataques de 11 de setembro de 2001 , 8 16 São Paulo Futebol Clube , 9 16 Evolução , 10 15 Campeonato Brasileiro de Futebol de 2011 - Série C , 11 15 Leandro Damião , 12 15 Campeonato Brasileiro de Futebol de 2011 - Série A , 13 14 Seleção Brasileira de Futebol , 14 14 São Paulo (cidade) , 15 14 África , 16 13 Lua Blanco , 17 13 Paula Fernandes , 18 13 Neymar , 19 13 Superclássico das Américas , 20 13 Futbol Club Barcelona , 21 13 2011 , 22 13 Santos Futebol Clube , 23 13 Club de Regatas Vasco da Gama , 24 13 Brasil , 25 12 Malhação Conectados

out 2011: 1 28 Steve Jobs , 2 26 Jogos Pan-Americanos de 2011 , 3 24 Neymar , 4 23 Muammar al-Gaddafi , 5 22 Aquele Beijo , 6 20 Rock in Rio , 7 18 Rebelde (telenovela brasileira) , 8 18 Fina Estampa , 9 18 Club de Regatas Vasco da Gama , 10 16 Fluminense Football Club , 11 15 Quadro de medalhas dos Jogos Pan-Americanos de 2011 , 12 15 Lua Blanco , 13 15 Brasil , 14 14 Campeonato Brasileiro de Futebol de 2011 - Série A , 15 14 Copa do Mundo FIFA de 2014 , 16 14 2011 , 17 13 A Vida da Gente , 18 13 O Astro (2011) , 19 13 Born This Way , 20 13 Teleton (Brasil) , 21 13 Ultimate Fighting Championship , 22 13 Mariah Carey , 23 13 Futbol Club Barcelona , 24 12 Brasil nos Jogos Pan-Americanos de 2011 , 25 12 Morde & Assopra

nov 2011: 1 16 Campeonato Brasileiro de Futebol de 2011 - Série A , 2 16 Brasil , 3 15 Beyoncé , 4 14 Neymar , 5 13 Gusttavo Lima , 6 13 Grand Theft Auto V , 7 13 Talk That Talk , 8 13 Copa Libertadores da América de 2012 , 9 13 Lua Blanco , 10 13 Fina Estampa , 11 13 Glee , 12 13 Via Embratel , 13 13 Fluminense Football Club , 14 13 Santos Futebol Clube , 15 13 Belém (Pará) , 16 12 Rebeldes (álbum) , 17 12 Aquele Beijo , 18 12 Campeonato Brasileiro de Futebol de 2011 - Série C , 19 12 Muammar al-Gaddafi , 20 12 Dilma Rousseff , 21 12 Sistema Brasileiro de Televisão , 22 12 Associação Portuguesa de Desportos , 23 11 Mel Fronckowiak , 24 11 Bruno Mars , 25 11 Disney Channel (Brasil)

dez 2011: 1 29 A Privataria Tucana , 2 24 Santos Futebol Clube , 3 23 Sport Club Corinthians Paulista , 4 22 Copa do Mundo de Clubes da FIFA de 2011 , 5 22 Campeonato Brasileiro de Futebol de 2011 - Série A , 6 22 Sócrates (futebolista) , 7 20 Copa Libertadores da América de 2012 , 8 20 Clube Atlético Paranaense , 9 18 Mortes em dezembro de 2011 , 10 17 Fina Estampa , 11 17 Club de Regatas Vasco da Gama , 12 17 Portugal , 13 16 Silvio Santos , 14 15 Fluminense Football Club , 15 15 Cesária Évora , 16 15 Grêmio Foot-Ball Porto Alegrense , 17 15 Campeonato Brasileiro de Futebol , 18 15 Brasil , 19 14 Canal OFF , 20 14 Copa do Brasil de Futebol de 2012 , 21 14 Neymar , 22 14 Futbol Club Barcelona , 23 14 Botafogo de Futebol e Regatas , 24 14 Vasco da Gama , 25 14 São Paulo Futebol Clube

jan 2012: 1 26 Stop Online Piracy Act , 2 24 Fluminense Football Club , 3 24 Santos Futebol Clube , 4 23 Copa São Paulo de Futebol Júnior de 2012 , 5 23 Club de Regatas Vasco da Gama , 6 22 Big Brother Brasil 12 , 7 22 Ai, se Eu Te Pego , 8 22 Osvaldo Filho , 9 21 Sport Club Corinthians Paulista , 10 20 Lionel Messi , 11 20 Vágner Love , 12 19 São Paulo Futebol Clube , 13 18 Protesto contra SOPA e PIPA , 14 18 Costa Concordia , 15 18 Megaupload , 16 17 Jesús Dátolo , 17 17 Thiago Neves , 18 17 Sociedade Esportiva Palmeiras , 19 16 Beyoncé , 20 16 Grêmio Foot-Ball Porto Alegrense , 21 16 Sport Club Internacional , 22 15 Naufrágio do Costa Concordia , 23 15 O Brado Retumbante , 24 15 Clube Atlético Paranaense , 25 15 Brasil

fev 2012: 1 41 Whitney Houston , 2 23 Wando , 3 22 Fox Sports Brasil , 4 21 As Brasileiras , 5 18 Vanderlei Luxemburgo , 6 17 Coritiba Foot Ball Club , 7 16 Mortes em fevereiro de 2012 , 8 16 Amor Eterno Amor , 9 16 Seleção Brasileira de Futebol , 10 16 Software livre , 11 15 Adele , 12 15 Pânico na TV , 13 14 Big Brother Brasil 12 , 14 14 Taça Guanabara de 2012 , 15 14 A Vida da Gente , 16 14 Copa Libertadores da América de 2012 , 17 14 Hernán Barcos , 18 14 Via Embratel , 19 14 Vágner Love , 20 14 Grêmio Foot-Ball Porto Alegrense , 21 14 Club de Regatas Vasco da Gama , 22 13 O Artista , 23 13 Resultados do Carnaval do Rio de Janeiro em 2012 , 24 12 Fina Estampa , 25 12 Joel Santana

mar 2012: 1 36 Avenida Brasil (telenovela) , 2 34 Chico Anysio , 3 23 Fox Sports Brasil , 4 22 Big Brother Brasil 12 , 5 20 Santos Futebol Clube , 6 19 Fina Estampa , 7 18 Millôr Fernandes , 8 17 Copa Libertadores da América de 2012 , 9 15 Claro TV (Brasil) , 10 15 Francisco Xavier do Amaral , 11 15 Brasil , 12 14 Amor Eterno Amor , 13 14 Rebelde (telenovela brasileira) , 14 14 Adriano Leite Ribeiro , 15 14 Pânico na TV , 16 14 Club de Regatas Vasco da Gama , 17 13 Mortes em março de 2012 , 18 13 Vladimir Putin , 19 13 Cruzeiro Esporte Clube , 20 12 Pânico na Band , 21 12 MDNA , 22 12 Lionel Messi , 23 12 Sociedade Esportiva Palmeiras , 24 12 Fortaleza Esporte Clube , 25 11 Método de ensino

abr 2012: 1 27 Itarana , 2 24 Cheias de Charme , 3 22 Santos Futebol Clube , 4 19 Copa Libertadores da América de 2012 , 5 18 Pânico na Band , 6 18 Futbol Club Barcelona , 7 17 MDNA , 8 17 Campeonato Paulista de Futebol de 2012 - Série A1 , 9 16 Rebelde (telenovela brasileira) , 10 15 Gideon Sundbäck , 11 15 MTV Brasil , 12 15 Associação Portuguesa de Desportos , 13 14 Marvel's The Avengers , 14 14 Fluminense Football Club , 15 14 Pânico na TV , 16 14 Esporte Clube Vitória , 17 14 Hacker , 18 14 São Paulo Futebol Clube , 19 13 Reintegração de posse na USP em 2011 , 20 13 Quarta cúpula do BRICS , 21 13 Avenida Brasil (telenovela) , 22 13 Lista de episódios de Julie e os Fantasmas , 23 13 Drama Total: A Vingança da Ilha , 24 13 Lionel Messi , 25 13 Anencefalia

mai 2012: 1 29 Carrossel (telenovela) , 2 25 Copa Libertadores da América de 2012 , 3 24 Campeonato Brasileiro de Futebol de 2012 - Série A , 4 22 Marvel's The Avengers , 5 21 François Hollande , 6 20 Sport Club Corinthians Paulista , 7 19 Campeonato Brasileiro de Futebol de 2012 - Série D , 8 19 Rede Globo , 9 18 Santos Futebol Clube , 10 17 Botafogo de Futebol e Regatas , 11 16 Lista de canções em Glee , 12 16 Club de Regatas Vasco da Gama , 13 15 As Brasileiras , 14 15 Avenida Brasil (telenovela) , 15 15 One Direction , 16 15 Campeonato Brasileiro de Futebol de 2012 - Série B , 17 15 Campeonato Brasileiro de Futebol de 2012 - Série C , 18 15 Copa do Brasil de Futebol de 2012 , 19 15 Fluminense Football Club , 20 15 Robin Gibb , 21 15 Donna Summer , 22 14 O Grito , 23 14 Chelsea Football Club , 24 14 Campeonato Brasileiro de Futebol , 25 13 ICarly (6.ª temporada)

jun 2012: 1 37 Campeonato Europeu de Futebol de 2012 , 2 21 Rio+20 , 3 20 Destituição de Fernando Lugo , 4 19 Romarinho , 5 19 Avenida Brasil (telenovela) , 6 19 Campeonato Brasileiro de Futebol de 2012 - Série A , 7 19 Campeonato Brasileiro de Futebol , 8 18 Clarence Seedorf , 9 18 Alan Turing , 10 17 A Fazenda 5 , 11 17 Manchester United Football Club , 12 17 Ronaldinho Gaúcho , 13 16 Santos Futebol Clube , 14 16 Brasil , 15 15 Cheias de Charme , 16 15 Máscaras (telenovela) , 17 15 Luciana Abreu , 18 13 Mohamed Morsi , 19 13 Mortes em junho de 2012 , 20 13 Gloob , 21 13 Copa Libertadores da América de 2012 , 22 13 Mario Balotelli , 23 13 Fernando Lugo , 24 13 Seleção Portuguesa de Futebol , 25 13 Johnny Depp

jul 2012: 1 33 Sport Club Corinthians Paulista , 2 25 Sociedade Esportiva Palmeiras , 3 24 Avenida Brasil (telenovela) , 4 23 Campeonato Brasileiro de Futebol de 2012 - Série A , 5 23 Fluminense Football Club , 6 22 Esporte Clube Bahia , 7 21 Cheias de Charme , 8 21 Jogos Olímpicos de Verão de 2012 , 9 20 Grêmio Foot-Ball Porto Alegrense , 10 19 Zlatan Ibrahimović , 11 18 Campeonato Brasileiro de Futebol de 2012 - Série C , 12 18 Sebastián Abreu , 13 18 Diego Forlán , 14 18 Copa Libertadores da América , 15 17 Emerson Sheik , 16 16 Anderson Silva , 17 16 Campeonato Europeu de Futebol de 2012 , 18 15 Romarinho , 19 15 Gilmar Mendes , 20 15 Mariah Carey , 21 15 Liédson , 22 15 Club de Regatas Vasco da Gama , 23 15 Televisão , 24 15 Clube de Regatas do Flamengo , 25 14 O Maior Brasileiro de Todos os Tempos

ago 2012: 1 21 Malhação: Intensa como a Vida , 2 21 A Fazenda 5 , 3 21 Brasil nos Jogos Olímpicos de Verão de 2012 , 4 20 Jogos Olímpicos de Verão de 2012 , 5 20 Sport Club Corinthians Paulista , 6 17 Avenida Brasil (telenovela) , 7 17 Campeonato Brasileiro de Futebol de 2012 - Série A , 8 17 Michael Phelps , 9 17 Seleção Brasileira de Futebol , 10 16 Futebol nos Jogos Olímpicos de Verão de 2012 - Masculino , 11 16 Sistema Brasileiro de Televisão , 12 15 Carrossel (telenovela) , 13 15 Celso Russomanno , 14 15 Portugal , 15 14 Quadro de medalhas dos Jogos Olímpicos de Verão de 2012 , 16 14 Arthur Aguiar , 17 14 Cheias de Charme , 18 14 Copa Sul-Americana de 2012 , 19 13 Mortes em agosto de 2012 , 20 13 Mars Science Laboratory , 21 13 Lucas Rodrigues Moura da Silva , 22 13 Taylor Swift , 23 13 Paris Saint-Germain Football Club , 24 13 Maria Montessori , 25 13 Folclore

set 2012: 1 25 Hebe Camargo , 2 18 Lado a Lado , 3 17 Cheias de Charme , 4 16 Guerra dos Sexos (2012) , 5 15 Gangnam Style , 6 15 Celso Russomanno , 7 15 Seleção Brasileira de Futebol , 8 14 ConeCrewDiretoria , 9 14 Hulk (futebolista) , 10 13 Balacobaco (telenovela) , 11 13 ICarly (6.ª temporada) , 12 13 Glee , 13 13 Jogos Paralímpicos de Verão de 2012 , 14 13 Sport Club Corinthians Paulista , 15 12 The Voice Brasil (1.ª temporada) , 16 12 Mortes em setembro de 2012 , 17 12 Carly Rae Jepsen , 18 12 A Fazenda 5 , 19 12 IPhone 5 , 20 12 Michael Clarke Duncan , 21 12 María la del Barrio , 22 12 Diego Forlán , 23 12 Latino (cantor) , 24 12 Botafogo de Futebol e Regatas , 25 12 Santos Futebol Clube

out 2012: 1 49 Avenida Brasil (telenovela) , 2 31 Salve Jorge , 3 25 Guerra dos Sexos (2012) , 4 18 Furacão Sandy (2012) , 5 17 Lady Gaga , 6 17 Lionel Messi , 7 17 Eric Hobsbawm , 8 16 Anderson Silva , 9 16 Fernando Haddad , 10 16 Hebe Camargo , 11 15 Cheias de Charme , 12 15 Neymar , 13 14 Felix Baumgartner , 14 14 ICarly (7.ª temporada) , 15 14 Gangnam Style , 16 14 Alexsandro de Souza , 17 14 Fluminense Football Club , 18 14 Sistema Brasileiro de Televisão , 19 13 Miley Cyrus , 20 13 Luís Fabiano , 21 13 Sporting Clube de Portugal , 22 12 Lado a Lado , 23 12 Elenco de Avenida Brasil (telenovela) , 24 12 Windows 8 , 25 12 José Paulo Bezerra Maciel Junior

nov 2012: 1 21 Neymar , 2 20 Campeonato Brasileiro de Futebol de 2013 - Série A , 3 20 Copa do Brasil de Futebol de 2013 , 4 19 Fazenda de Verão , 5 19 Campeonato Brasileiro de Futebol de 2012 - Série A , 6 18 Marcos Paulo , 7 16 Varg Vikernes , 8 16 Linux Educacional , 9 16 Seleção Brasileira de Futebol , 10 15 Copa do Mundo de Futsal de 2012 , 11 15 Copa Libertadores da América de 2013 , 12 15 Avenged Sevenfold , 13 15 Campeonato Brasileiro de Futebol , 14 15 Brasil , 15 14 Copa Sul-Americana de 2012 , 16 14 Copa do Mundo de Clubes da FIFA de 2012 , 17 14 Pedro Passos Coelho , 18 14 Roberto Carlos , 19 13 Secret Story - Casa dos Segredos (3.ª edição) , 20 13 Salve Jorge , 21 13 Call of Duty: Black Ops II , 22 13 Campeonato Brasileiro de Futebol de 2013 - Série C , 23 13 Campeonato Brasileiro de Futebol de 2013 - Série B , 24 13 Avenida Brasil (telenovela) , 25 13 Sport Club Corinthians Paulista

dez 2012: 1 32 Oscar Niemeyer , 2 29 Sport Club Corinthians Paulista , 3 28 Copa do Mundo de Clubes da FIFA de 2012 , 4 27 Arena do Grêmio , 5 23 Copa do Mundo de Clubes da FIFA , 6 23 São Paulo Futebol Clube , 7 21 Salve Jorge , 8 21 Copa Libertadores da América de 2013 , 9 21 Copa do Brasil de Futebol de 2013 , 10 20 Campeonato Brasileiro de Futebol de 2013 - Série A , 11 19 Avenida Brasil (telenovela) , 12 18 Copa Sul-Americana de 2012 , 13 18 Club de Regatas Vasco da Gama , 14 17 Fluminense Football Club , 15 16 Neymar , 16 16 Sport Club Internacional , 17 15 Fenômeno 2012 , 18 15 Back to Black , 19 15 Fernando Prass , 20 15 Copa Sul-Americana , 21 15 Natal , 22 15 Recife , 23 14 Lucas Rodrigues Moura da Silva , 24 14 Copa das Confederações FIFA de 2013 , 25 14 La usurpadora

jan 2013: 1 55 Incêndio na boate Kiss , 2 27 Big Brother Brasil 13 , 3 26 Sport Club Corinthians Paulista , 4 20 Malhação: Intensa como a Vida , 5 20 Salve Jorge , 6 19 Copa São Paulo de Futebol Júnior de 2013 , 7 19 Avenida Brasil (telenovela) , 8 17 O Canto da Sereia (minissérie) , 9 17 Sport Club Internacional , 10 16 Copa Libertadores da América de 2013 , 11 16 Guerra dos Sexos (2012) , 12 16 Club de Regatas Vasco da Gama , 13 16 São Paulo Futebol Clube , 14 15 Lado a Lado , 15 15 Copa do Brasil de Futebol de 2013 , 16 15 Edir Macedo , 17 14 Aaron Swartz , 18 14 Copa do Nordeste de Futebol de 2013 , 19 14 Raio (meteorologia) , 20 14 Clube Atlético Paranaense , 21 13 Demi Lovato , 22 13 Taylor Swift , 23 13 Avenged Sevenfold , 24 13 Sistema Brasileiro de Televisão , 25 13 2013

fev 2013: 1 30 Papa Bento XVI , 2 26 Incêndio na boate Kiss , 3 18 Salve Jorge , 4 18 Copa Libertadores da América de 2013 , 5 17 2013 , 6 16 Meteoro de Cheliabinsk , 7 16 Copa do Brasil de Futebol de 2013 , 8 16 Central Nacional de Televisão , 9 16 Hernán Barcos , 10 15 Big Brother Brasil 13 , 11 15 PlayStation 4 , 12 14 Futebol Clube do Porto , 13 13 Lado a Lado , 14 13 Paulo Henrique Ganso , 15 13 Marcelo Moreno , 16 13 Unidos de Vila Isabel , 17 13 Seleção Brasileira de Futebol , 18 12 Naldo Benny , 19 12 Larissa Manoela , 20 12 Taylor Swift , 21 12 Clube Atlético Paranaense , 22 12 Sistema Solar , 23 11 Flor do Caribe , 24 11 Pânico na Band , 25 11 Guerra dos Sexos (2012)

mar 2013: 1 88 Papa Francisco , 2 49 Hugo Chávez , 3 30 Chorão (cantor) , 4 28 Big Brother Brasil 13 , 5 28 Charlie Brown Jr. , 6 24 Papa Bento XVI , 7 23 Lista dos papas , 8 23 Papa , 9 21 Marco Feliciano , 10 21 Copa do Brasil de Futebol de 2013 , 11 20 Salve Jorge , 12 20 Madonna , 13 16 Big Brother Brasil , 14 16 2013 , 15 15 Emílio Santiago , 16 15 Porto Alegre , 17 14 Flor do Caribe , 18 14 Copa do Nordeste de Futebol de 2013 , 19 14 Lado a Lado , 20 14 Avenida Brasil (telenovela) , 21 14 Gareth Bale , 22 14 Anderson Silva , 23 14 Clube de Regatas do Flamengo , 24 13 Heart Attack , 25 13 Conclave de 2013

abr 2013: 1 29 Copa do Brasil de Futebol de 2013 , 2 28 Atentado à Maratona de Boston de 2013 , 3 27 Sangue Bom , 4 22 Copa Libertadores da América de 2013 , 5 21 Papa Francisco , 6 20 Margaret Thatcher , 7 19 Anderson Vital da Silva , 8 18 Clube de Regatas do Flamengo , 9 17 Esporte Clube Bahia , 10 17 Sport Club Corinthians Paulista , 11 16 Nicolás Maduro , 12 16 Kristen Stewart , 13 16 Pré-história , 14 15 Wikipédia , 15 15 Coreia do Norte , 16 15 Filosofia , 17 14 Malhação: Intensa como a Vida , 18 14 Guerra dos Sexos (2012) , 19 14 Seleção Brasileira de Futebol , 20 13 Marco Feliciano , 21 13 Neymar , 22 13 Taylor Swift , 23 13 Fluminense Football Club , 24 13 Charlie Brown Jr. , 25 13 Rede Globo

mai 2013: 1 35 Amor à Vida , 2 27 Copa do Brasil de Futebol de 2013 , 3 27 Neymar , 4 24 Sangue Bom , 5 24 Salve Jorge , 6 24 Copa das Confederações FIFA de 2013 , 7 21 Campeonato Brasileiro de Futebol de 2013 - Série A , 8 20 Sport Lisboa e Benfica , 9 20 Cruzeiro Esporte Clube , 10 19 Anitta , 11 19 Copa Libertadores da América de 2013 , 12 19 Mia Couto , 13 18 Clube Atlético Paranaense , 14 17 Marco Feliciano , 15 17 Avenida Brasil (telenovela) , 16 17 Fluminense Football Club , 17 17 Manchester United Football Club , 18 16 Campeonato Brasileiro de Futebol de 2013 - Série D , 19 16 Campeonato Paulista de Futebol de 2013 - Série A1 , 20 16 Fußball-Club Bayern München , 21 16 Futbol Club Barcelona , 22 16 Esporte Clube Bahia , 23 16 Grêmio Foot-Ball Porto Alegrense , 24 16 Club de Regatas Vasco da Gama , 25 16 Sport Club Corinthians Paulista

jun 2013: 1 141 Protestos no Brasil em 2013 , 2 52 Copa das Confederações FIFA de 2013 , 3 45 Cidades participantes dos protestos no Brasil em 2013 , 4 30 Amor à Vida , 5 26 Copa das Confederações FIFA , 6 24 Sangue Bom , 7 23 Seleção Brasileira de Futebol , 8 21 Anitta , 9 20 Saramandaia (2013) , 10 20 Campeonato Brasileiro de Futebol de 2013 - Série A , 11 19 Protestos contra o aumento da passagem de ônibus no Brasil em 2013 , 12 19 Avenida Brasil (telenovela) , 13 19 PlayStation 4 , 14 19 Neymar , 15 19 Movimento Passe Livre , 16 18 Real Madrid Club de Fútbol , 17 17 PEC 37 , 18 17 Copa do Mundo FIFA de 2014 , 19 16 Seleção Taitiana de Futebol , 20 15 Xbox One , 21 15 Carrossel (telenovela) , 22 15 Esporte Clube Bahia , 23 14 A Fazenda 6 , 24 14 Marco Feliciano , 25 14 Anderson Silva

jul 2013: 1 29 Protestos no Brasil em 2013 , 2 29 Cruzeiro Esporte Clube , 3 26 MC Daleste , 4 22 Anderson Silva , 5 21 A Fazenda 6 , 6 21 Sangue Bom , 7 20 Chiquititas (2013) , 8 20 Cory Monteith , 9 20 Kristen Stewart , 10 19 Amor à Vida , 11 19 Copa do Brasil de Futebol de 2013 , 12 19 Copa das Confederações FIFA de 2013 , 13 18 Copa Libertadores da América de 2013 , 14 18 Futbol Club Barcelona , 15 18 Clube Atlético Mineiro , 16 17 Jorge de Cambridge , 17 17 Avenida Brasil (telenovela) , 18 16 Anitta , 19 16 Malhação Casa Cheia , 20 16 Final da Copa Libertadores da América de 2013 , 21 16 Copa Sul-Americana de 2013 , 22 16 Alexandre Pato , 23 16 Association Sportive de Monaco Football Club , 24 16 Guilherme, Duque de Cambridge , 25 16 Kaká

ago 2013: 1 18 Copa Sul-Americana de 2013 , 2 16 O Cravo e a Rosa , 3 15 Sangue Bom , 4 14 Gareth Bale , 5 13 Roar , 6 13 Amor à Vida , 7 13 Copa do Brasil de Futebol de 2013 , 8 13 Jesús Dátolo , 9 13 Cannabis (psicotrópico) , 10 12 Isabel dos Santos , 11 12 Eusébio Cup , 12 12 Avenged Sevenfold , 13 12 Esporte Clube Bahia , 14 12 Grêmio Foot-Ball Porto Alegrense , 15 11 Edward Snowden , 16 11 Victor Vinícius Coelho dos Santos , 17 11 One Direction , 18 11 Carrossel (telenovela) , 19 11 Ronaldinho Gaúcho , 20 11 Campeonato Brasileiro de Futebol , 21 11 William Shakespeare , 22 11 São Paulo Futebol Clube , 23 10 Protestos no Brasil em 2013 , 24 10 A Fazenda 6 , 25 10 UFC Fight Night: Shogun vs. Sonnen

set 2013: 1 26 Champignon (músico) , 2 17 A Fazenda 6 , 3 16 Saramandaia (2013) , 4 15 Amor à Vida , 5 15 Gareth Bale , 6 15 Império do Brasil , 7 13 MTV (Brasil) , 8 13 Joia Rara , 9 13 Kaká , 10 13 Charlie Brown Jr. , 11 13 Clube Atlético Paranaense , 12 12 Salve Jorge , 13 12 Copa Sul-Americana de 2013 , 14 12 Campeonato Brasileiro de Futebol de 2013 - Série A , 15 12 Real Madrid Club de Fútbol , 16 11 Tiroteio e sequestro no centro comercial Westgate , 17 11 Protestos no Brasil em 2013 , 18 11 Sangue Bom , 19 11 Chiquititas (2013) , 20 11 Avenida Brasil (telenovela) , 21 11 Matemática , 22 11 Distrito Federal (Brasil) , 23 10 Wrecking Ball (canção de Miley Cyrus) , 24 10 Flor do Caribe , 25 10 Mesut Özil

out 2013: 1 18 Guilherme Briggs , 2 17 MTV Brasil , 3 16 MTV (Brasil) , 4 16 Copa do Mundo FIFA de 2014 , 5 14 Joia Rara , 6 13 Amor à Vida , 7 13 Avenida Brasil (telenovela) , 8 13 Ideal TV , 9 12 Sangue Bom , 10 12 Hernane Vidal de Souza , 11 11 Protestos no Brasil em 2013 , 12 11 Malala Yousafzai , 13 11 Campeonato Brasileiro de Futebol de 2013 - Série A , 14 11 Black bloc , 15 11 Impenetrabilidade , 16 11 ISO/IEC 17799 , 17 10 Mortes em outubro de 2013 , 18 10 Fifth Harmony , 19 10 UFC 166 , 20 10 Salve Jorge , 21 10 Facebook , 22 10 O Cravo e a Rosa , 23 10 Futbol Club Barcelona , 24 9 The Voice Brasil (2.ª temporada) , 25 9 Anitta

nov 2013: 1 23 Clube de Regatas do Flamengo , 2 19 Campeonato Brasileiro de Futebol de 2013 - Série B , 3 18 Copa do Mundo FIFA de 2014 , 4 18 Cruzeiro Esporte Clube , 5 17 Amor à Vida , 6 15 Copa do Brasil de Futebol de 2013 , 7 15 Clube Atlético Mineiro , 8 14 Black Friday , 9 14 Miley Cyrus , 10 13 Copa Libertadores da América de 2014 , 11 13 Copa Sul-Americana de 2013 , 12 12 The Voice Brasil (2.ª temporada) , 13 12 Sangue Bom , 14 12 Títulos do Clube de Regatas do Flamengo no futebol , 15 12 Doris Lessing , 16 12 Fluminense Football Club , 17 12 Pepsi , 18 12 Sociedade Esportiva Palmeiras , 19 11 Talleres de Córdoba Rugby Club , 20 11 Campeonato Brasileiro de Futebol de 2013 - Série A , 21 11 Club de Regatas Vasco da Gama , 22 11 Nazismo , 23 10 Tufão Haiyan (2013) , 24 10 Wikipédia , 25 10 Arena Corinthians

dez 2013: 1 30 Nelson Mandela , 2 29 Paul Walker , 3 26 Copa do Mundo de Clubes da FIFA de 2013 , 4 25 Fluminense Football Club , 5 21 Copa Libertadores da América de 2014 , 6 19 Grêmio Foot-Ball Porto Alegrense , 7 18 Campeonato Mundial de Handebol Feminino de 2013 , 8 18 Campeonato Brasileiro de Futebol de 2014 - Série A , 9 18 Campeonato Brasileiro de Futebol de 2013 - Série A , 10 17 Raja Club Athletic , 11 16 Santa Cruz Futebol Clube , 12 14 Mortes em dezembro de 2013 , 13 14 Artpop , 14 14 Reginaldo Rossi , 15 14 Michael Schumacher , 16 14 2013 , 17 13 Taylor Swift , 18 13 Papai Noel , 19 13 Esporte Clube Bahia , 20 12 Martín Silva , 21 12 José Genoino , 22 12 Sistema Brasileiro de Televisão , 23 12 Botafogo de Futebol e Regatas , 24 11 Leandro Damião , 25 11 Fußball-Club Bayern München

jan 2014: 1 33 Eusébio , 2 24 Em Família (telenovela) , 3 23 Amor à Vida , 4 23 Yudi Tamashiro , 5 22 Big Brother Brasil 14 , 6 20 Amores Roubados , 7 19 Copa São Paulo de Futebol Júnior de 2014 , 8 18 Caras & Bocas , 9 18 Ariel Sharon , 10 18 2014 , 11 16 Grêmio Foot-Ball Porto Alegrense , 12 15 Fluminense Football Club , 13 14 Rolezinho , 14 14 Mortes em janeiro de 2014 , 15 14 Campeonato Paulista de Futebol de 2014 - Série A1 , 16 14 Minas Gerais , 17 13 FIFA Ballon d'Or , 18 13 Dian Fossey , 19 13 Ballon d'Or , 20 13 Slipknot , 21 13 Criciúma Esporte Clube , 22 13 Clube de Regatas do Flamengo , 23 12 Facebook , 24 12 O Cravo e a Rosa , 25 12 Sistema Brasileiro de Televisão

fev 2014: 1 29 Em Família (telenovela) , 2 17 Jogos Olímpicos de Inverno de 2014 , 3 16 Amor à Vida , 4 15 MC Gui , 5 15 Joia Rara , 6 15 Copa do Mundo FIFA de 2014 , 7 14 Rachel Sheherazade , 8 14 Campeonato Brasileiro de Futebol de 2014 - Série A , 9 14 Alfred Russel Wallace , 10 14 Sistema Brasileiro de Televisão , 11 14 Língua portuguesa , 12 13 Big Brother Brasil 14 , 13 13 Campeonato Paulista de Futebol de 2014 - Série A1 , 14 13 Reino Unido , 15 12 Flappy Bird , 16 12 Rolezinho , 17 12 UFC Fight Night: Machida vs. Mousasi , 18 12 Avenida Brasil (telenovela) , 19 12 Facebook , 20 12 Alexandre Pato , 21 12 Túlio Maravilha , 22 12 Renascimento , 23 11 Mortes em fevereiro de 2014 , 24 11 2014 na televisão , 25 11 Lorde (cantora)

mar 2014: 1 24 República Autônoma da Crimeia , 2 20 Voo Malaysia Airlines 370 , 3 20 Em Família (telenovela) , 4 17 Big Brother Brasil 14 , 5 17 Marco Civil da Internet , 6 16 Paulo Goulart , 7 15 Raissa Chaddad , 8 15 Lepo Lepo , 9 15 Campeonato Paulista de Futebol de 2014 - Série A1 , 10 15 Esporte Clube Vitória , 11 14 The Noite com Danilo Gentili , 12 14 Esporte Clube Bahia , 13 14 Inclusão digital , 14 13 2014 na televisão , 15 13 Joia Rara , 16 13 Sporting Clube de Portugal , 17 13 Revolução Industrial , 18 12 Eduardo Schechtel , 19 12 Meu Pedacinho de Chão (2014) , 20 12 Lorde (cantora) , 21 12 Little Mix , 22 12 Futebol Clube do Porto , 23 12 2014 , 24 12 Mona Lisa , 25 12 Ucrânia

abr 2014: 1 31 José Wilker , 2 26 Copa do Brasil de Futebol de 2014 , 3 23 Meu Pedacinho de Chão (2014) , 4 22 Luciano do Valle , 5 21 Amor à Vida , 6 20 Geração Brasil , 7 18 Campeonato Brasileiro de Futebol de 2014 - Série D , 8 18 Nicolas Anelka , 9 17 Rede Globo , 10 17 José de Anchieta , 11 17 Senhora do Destino , 12 16 Clube de Regatas do Flamengo , 13 15 Copa Verde de Futebol de 2014 , 14 15 Marco Civil da Internet , 15 15 Copa do Mundo FIFA de 2014 , 16 15 Tiradentes , 17 15 Segunda Guerra Mundial , 18 14 Em Família (telenovela) , 19 14 Campeonato Brasileiro de Futebol de 2014 - Série A , 20 14 Caras & Bocas , 21 14 Leonardo da Vinci , 22 13 Mortes em abril de 2014 , 23 13 Ross Lynch , 24 13 Fluminense Football Club , 25 13 Gabriel García Márquez

mai 2014: 1 36 EXO , 2 28 Geração Brasil , 3 23 Copa do Mundo FIFA de 2014 , 4 22 Arena Corinthians , 5 20 Campeonato Brasileiro de Futebol de 2014 - Série D , 6 17 Anitta , 7 17 Copa do Brasil de Futebol de 2014 , 8 17 Supernatural (série de televisão) , 9 16 Em Família (telenovela) , 10 16 Fifth Harmony , 11 16 Sport Lisboa e Benfica , 12 14 Avenida Brasil (telenovela) , 13 14 David Luiz , 14 14 Segunda Guerra Mundial , 15 13 Lionel Messi , 16 13 Maria Gaetana Agnesi , 17 12 Sangue Bom , 18 12 Campeonato Brasileiro de Futebol de 2014 - Série A , 19 12 Caras & Bocas , 20 12 Jair Rodrigues , 21 11 Malhação Casa Cheia , 22 11 Chiquititas (2013) , 23 11 Campeonato Brasileiro de Futebol de 2014 - Série B , 24 11 Copa Libertadores da América de 2014 , 25 11 S.M. Entertainment

jun 2014: 1 62 Copa do Mundo FIFA de 2014 , 2 32 Seleção Brasileira de Futebol , 3 24 Kaká , 4 19 Arena Corinthians , 5 16 Copa do Mundo FIFA de 2014 – Grupo A , 6 16 Diego Costa , 7 16 Doncaster Rovers Football Club , 8 16 Fernandão , 9 15 New York City Football Club , 10 15 Frederico Chaves Guedes , 11 15 Seleção Espanhola de Futebol , 12 14 Hulk (futebolista) , 13 14 Guillermo Ochoa , 14 14 Óbidos (Portugal) , 15 14 Filipe VI de Espanha , 16 13 Ultraviolence , 17 13 Copa do Mundo FIFA de 2014 – Fase final , 18 13 Arena Pantanal , 19 13 David Luiz , 20 13 Estádio Joaquim Américo Guimarães , 21 13 Clube de Regatas do Flamengo , 22 12 Geração Brasil , 23 12 Copa do Mundo FIFA de 2014 – Grupo B , 24 12 José Paulo Bezerra Maciel Junior , 25 11 Chiquititas (2013)

jul 2014: 1 42 Seleção Brasileira de Futebol , 2 37 Império (telenovela) , 3 35 Copa do Mundo FIFA de 2014 , 4 27 Brasil 1–7 Alemanha (2014) , 5 27 Em Família (telenovela) , 6 26 James Rodríguez , 7 26 Copa do Mundo FIFA , 8 25 Meu Pedacinho de Chão (2014) , 9 23 Neymar , 10 22 David Luiz , 11 22 Ronaldinho Gaúcho , 12 20 Seleção Alemã de Futebol , 13 20 Real Madrid Club de Fútbol , 14 18 Malhação Sonhos , 15 18 Campeonato Brasileiro de Futebol de 2014 - Série A , 16 18 Ariano Suassuna , 17 17 Geração Brasil , 18 17 Alexandre Padilha , 19 17 Luiz Felipe Scolari , 20 16 Voo Malaysia Airlines 17 , 21 16 Sangue Bom , 22 16 Chiquititas (2013) , 23 16 Eduardo da Silva , 24 16 Cobras & Lagartos , 25 16 Sistema Brasileiro de Televisão

ago 2014: 1 51 Eduardo Campos , 2 31 Miriam Leitão , 3 26 Robin Williams , 4 25 Boogie Oogie , 5 24 Neymar , 6 21 Copa do Brasil de Futebol de 2014 , 7 19 Marina Silva , 8 18 Eleição presidencial no Brasil em 2014 , 9 18 Manchester United Football Club , 10 17 Paulo Baier , 11 17 Fluminense Football Club , 12 16 Malhação Sonhos , 13 15 Campeonato Brasileiro de Futebol de 2014 - Série A , 14 15 Real Madrid Club de Fútbol , 15 14 Surto de ébola na África Ocidental , 16 14 Império (telenovela) , 17 14 Douglas Pereira dos Santos , 18 14 Roger Abdelmassih , 19 14 Ángel Di María , 20 14 Paysandu Sport Club , 21 14 Segunda Guerra Mundial , 22 13 Acidente com o Cessna Citation prefixo PR-AFA em 2014 , 23 13 Meu Pedacinho de Chão (2014) , 24 13 One Direction , 25 13 Robinho

set 2014: 1 25 Neymar , 2 20 Eleição presidencial no Brasil em 2014 , 3 19 Geração Brasil , 4 19 Club de Regatas Vasco da Gama , 5 17 A Fazenda 7 , 6 17 Campeonato Brasileiro de Futebol de 2014 - Série A , 7 16 Boogie Oogie , 8 16 Clube de Regatas do Flamengo , 9 15 Império (telenovela) , 10 15 Posídon , 11 14 Katy Perry , 12 14 Levy Fidelix , 13 14 Sortilegio (telenovela) , 14 14 Manchester United Football Club , 15 14 Santos Futebol Clube , 16 14 11 de setembro , 17 13 Ladies' Code , 18 13 Campeonato Brasileiro de Futebol de 2014 - Série B , 19 13 Campeonato Brasileiro de Futebol de 2014 - Série D , 20 13 Joan Rivers , 21 13 Radamel Falcao García , 22 13 Seleção Brasileira de Futebol , 23 13 Michael Jackson , 24 13 Sporting Clube de Portugal , 25 13 Comunismo

out 2014: 1 34 Eleição presidencial no Brasil em 2014 , 2 28 Aécio Neves , 3 24 Dilma Rousseff , 4 18 Seleção Brasileira de Futebol , 5 18 Avaí Futebol Clube , 6 17 Alto Astral , 7 17 Dia das bruxas , 8 17 Clube de Regatas do Flamengo , 9 16 A Fazenda 7 , 10 16 Campeonato Brasileiro de Futebol de 2014 - Série A , 11 16 Fernando Henrique Cardoso , 12 15 Fifth Harmony , 13 15 Neymar , 14 13 Império (telenovela) , 15 13 Mi pecado , 16 13 Levy Fidelix , 17 13 Corujão (programa de televisão) , 18 13 Portugal , 19 12 Surto de ébola na África Ocidental , 20 12 Boogie Oogie , 21 12 Girls' Generation , 22 12 Lista de presidentes do Brasil , 23 12 Sapo-comum , 24 12 Cristiano Ronaldo , 25 12 Sporting Clube de Portugal

nov 2014: 1 25 Clube Atlético Mineiro , 2 24 Roberto Gómez Bolaños , 3 21 Copa do Brasil de Futebol , 4 20 Alto Astral , 5 20 Império (telenovela) , 6 19 Neymar , 7 19 Dilma Rousseff , 8 16 Copa Libertadores da América de 2015 , 9 16 Campeonato Brasileiro de Futebol de 2014 - Série A , 10 16 Nicki Minaj , 11 16 Lady Gaga , 12 15 Arrow (série de televisão) , 13 15 Rogério Ceni , 14 15 Cruzeiro Esporte Clube , 15 14 Mortes em novembro de 2014 , 16 14 Boogie Oogie , 17 14 Copa do Brasil de Futebol de 2014 , 18 14 Clássico Mineiro , 19 14 Basquetebol , 20 13 Sophia Abrahão , 21 13 Ariana Grande , 22 13 Allianz Parque , 23 13 Danilo Gentili , 24 13 Vênus ao espelho , 25 13 Maite Perroni

dez 2014: 1 28 Clube Atlético Mineiro , 2 21 Copa Libertadores da América de 2015 , 3 21 Gabriel Medina , 4 18 Grêmio Foot-Ball Porto Alegrense , 5 17 Copa do Mundo de Clubes da FIFA de 2014 , 6 17 Maite Perroni , 7 17 Roberto Gómez Bolaños , 8 16 Império (telenovela) , 9 16 Allianz Parque , 10 16 Associação Chapecoense de Futebol , 11 16 Sociedade Esportiva Palmeiras , 12 15 Igreja Universal do Reino de Deus , 13 15 Ariana Grande , 14 15 Facebook , 15 15 Luís Ricardo , 16 14 A Fazenda 7 , 17 14 WhatsApp , 18 14 Lady Gaga , 19 14 Michael Jackson , 20 13 Alto Astral , 21 13 Éverton Ribeiro , 22 13 Jair Bolsonaro , 23 13 Miley Cyrus , 24 13 Frederico Chaves Guedes , 25 13 Dilma Rousseff

jan 2015: 1 31 Massacre do Charlie Hebdo , 2 26 Copa São Paulo de Futebol Júnior de 2015 , 3 25 Império (telenovela) , 4 23 Alto Astral , 5 22 Eduardo Pereira Rodrigues , 6 21 Boogie Oogie , 7 21 Leandro Damião , 8 19 Lucas Silva , 9 18 2015 , 10 17 Big Brother Brasil 15 , 11 16 Caso Marco Archer , 12 16 Charlie Hebdo , 13 16 Amor à Vida , 14 16 Éverton Ribeiro , 15 16 Cobras & Lagartos , 16 16 Real Madrid Club de Fútbol , 17 15 Felizes para Sempre? , 18 15 2015 na televisão , 19 15 Giorgian De Arrascaeta , 20 15 Malhação Sonhos , 21 15 O Rei do Gado , 22 15 Google , 23 14 Florida Cup de 2015 , 24 14 Ricardo Goulart , 25 14 Ricardo Centurión

fev 2015: 1 22 Império (telenovela) , 2 19 Alto Astral , 3 17 Paulo André , 4 17 Matheus Dória Macedo , 5 15 Boogie Oogie , 6 15 Malhação Sonhos , 7 15 Anderson Silva , 8 15 Beyoncé , 9 14 Campeonato Paulista de Futebol de 2015 - Série A1 , 10 14 Babilônia (telenovela) , 11 14 Wanessa Camargo , 12 14 Xuxa , 13 14 Botafogo de Futebol e Regatas , 14 14 Santos Futebol Clube , 15 14 Ilhas Malvinas , 16 14 Sport Club Corinthians Paulista , 17 13 Mortes em fevereiro de 2015 , 18 13 Campeonato Carioca de Futebol de 2015 , 19 13 Sophia Abrahão , 20 13 Tomie Ohtake , 21 12 Birdman ou (A Inesperada Virtude da Ignorância) , 22 12 Copa do Nordeste de Futebol de 2015 , 23 12 Kéfera Buchmann , 24 12 David Martins Miranda , 25 12 RBD

mar 2015: 1 32 Protestos contra o governo Dilma Rousseff , 2 31 Babilônia (telenovela) , 3 27 Boogie Oogie , 4 26 Império (telenovela) , 5 21 Voo Germanwings 9525 , 6 20 Os Dez Mandamentos (telenovela) , 7 20 Sete Vidas , 8 20 Inezita Barroso , 9 18 Alto Astral , 10 18 José Rico , 11 17 Campeonato Paulista de Futebol de 2015 - Série A1 , 12 17 Revolução Industrial , 13 16 Big Brother Brasil 15 , 14 15 Carrossel (telenovela) , 15 15 Arte rupestre , 16 15 2015 , 17 14 Agora É Tarde , 18 14 Leonardo da Silva Moura , 19 14 Santos Futebol Clube , 20 14 São Paulo Futebol Clube , 21 13 Cristian Rodríguez , 22 13 Antonio Anastasia , 23 13 Maria Esperança , 24 13 Jorge Loredo , 25 13 Edir Macedo

abr 2015: 1 25 Babilônia (telenovela) , 2 23 Copa do Brasil de Futebol de 2015 , 3 22 Alto Astral , 4 21 Copa Libertadores da América de 2015 , 5 21 Furious 7 , 6 18 Cristiano Ronaldo , 7 17 I Love Paraisópolis , 8 17 2015 na televisão , 9 17 Pablo Armero , 10 17 Sete Vidas , 11 17 Jorge Jesus , 12 17 Antônio Abujamra , 13 16 Império (telenovela) , 14 16 Avengers: Age of Ultron , 15 16 Fabrício dos Santos Silva , 16 16 Rihanna , 17 15 Sismo do Nepal de 2015 , 18 15 Os Dez Mandamentos (telenovela) , 19 15 Campeonato Paulista de Futebol de 2015 - Série A1 , 20 15 Corazón indomable , 21 15 Zayn , 22 15 Anselmo Ralph , 23 15 David Luiz , 24 15 Pelé , 25 14 Copa do Mundo de Clubes da FIFA

mai 2015: 1 31 I Love Paraisópolis , 2 29 Alto Astral , 3 28 Babilônia (telenovela) , 4 24 Copa Libertadores da América de 2015 , 5 22 Faculdade Cásper Líbero , 6 21 Avengers: Age of Ultron , 7 21 Club de Regatas Vasco da Gama , 8 20 Copa do Brasil de Futebol de 2015 , 9 20 Lista de filmes de maior bilheteria , 10 20 Paolo Guerrero , 11 19 Liga dos Campeões da UEFA , 12 18 Campeonato Brasileiro de Futebol de 2015 - Série A , 13 17 Cristiano Ronaldo , 14 16 Liga dos Campeões da UEFA de 2014–15 , 15 15 Campeonato Brasileiro de Futebol de 2015 - Série D , 16 15 Austin Mahone , 17 15 Ceará Sporting Club , 18 15 Dia do Trabalhador , 19 14 Claudia Leitte , 20 14 TV Gazeta , 21 14 Beyoncé , 22 14 Comunicação audiovisual , 23 14 Robinho , 24 14 Futbol Club Barcelona , 25 14 Grêmio Foot-Ball Porto Alegrense

jun 2015: 1 54 Matala , 2 31 Inferência incerta , 3 30 Cristiano Araújo , 4 28 Copa América de 2015 , 5 24 Verdades Secretas , 6 23 Equol , 7 22 Lista de filmes de maior bilheteria , 8 22 Club de Regatas Vasco da Gama , 9 20 Campeonato Brasileiro de Futebol de 2015 - Série A , 10 17 Sete Vidas , 11 16 Jorge Jesus , 12 16 Paolo Guerrero , 13 16 Leonardo da Silva Moura , 14 16 Sistema Brasileiro de Televisão , 15 16 Seleção Brasileira de Futebol , 16 15 Camila Queiroz , 17 15 I Love Paraisópolis , 18 15 Angola , 19 14 Roberto Firmino , 20 14 Alecsandro , 21 14 Emerson Sheik , 22 13 2015 na televisão , 23 13 Malhação Sonhos , 24 13 5 Seconds of Summer , 25 13 Marco Silva

jul 2015: 1 24 Além do Tempo , 2 24 Babilônia (telenovela) , 3 24 Paolo Guerrero , 4 19 Lista de filmes de maior bilheteria , 5 19 Caminho das Índias , 6 19 Jogos Pan-Americanos de 2015 , 7 19 Iker Casillas , 8 17 2015 na televisão , 9 16 Os Dez Mandamentos (telenovela) , 10 16 Verdades Secretas , 11 16 NGA (cantor) , 12 16 Sete Vidas , 13 16 Club de Regatas Vasco da Gama , 14 15 Corazón indomable , 15 15 Douglas Pereira dos Santos , 16 15 Cúmplices de um Resgate , 17 14 Copa do Mundo FIFA de Futebol de Areia de 2015 , 18 14 I Love Paraisópolis , 19 14 Copa Sul-Americana de 2015 , 20 14 Lucas Barrios , 21 14 La usurpadora , 22 14 Os Simpsons , 23 14 Plutão , 24 13 Cool for the Summer , 25 13 Brasil nos Jogos Pan-Americanos de 2015

ago 2015: 1 40 Aeroporto de Agadir Al Massira , 2 31 Babilônia (telenovela) , 3 29 Campeonato Brasileiro de Futebol de 2015 - Série A , 4 26 A Regra do Jogo (telenovela) , 5 23 Estereoquímica , 6 22 Cúmplices de um Resgate , 7 20 Mastocitose , 8 20 Tensão no Rio , 9 19 Cristiano Ronaldo , 10 18 Shelbie Bruce , 11 18 Grenal , 12 16 Segunda Guerra Mundial , 13 15 I Love Paraisópolis , 14 15 Malhação Sonhos , 15 15 Copa do Brasil de Futebol de 2015 , 16 15 Ronda Rousey , 17 14 Mortes em agosto de 2015 , 18 14 Malhação: Seu Lugar no Mundo , 19 14 Verdades Secretas , 20 14 Caminho das Índias , 21 14 Maisa Silva , 22 13 Xuxa Meneghel (programa de televisão) , 23 13 Minecraft , 24 13 League of Legends , 25 13 Ángel Di María

set 2015: 1 35 A Regra do Jogo (telenovela) , 2 21 Verdades Secretas , 3 18 Campeonato Brasileiro de Futebol de 2015 - Série A , 4 18 Betty Lago , 5 17 Google , 6 16 Monte Galinheiro , 7 16 Ronaldinho Gaúcho , 8 15 Kéfera Buchmann , 9 15 Martha Root , 10 15 17 de setembro , 11 14 A Fazenda 8 , 12 14 I Love Paraisópolis , 13 14 Sport Club do Recife , 14 13 Tensão no Rio , 15 13 Babilônia (telenovela) , 16 13 Futbol Club Barcelona , 17 13 Santos Futebol Clube , 18 13 Marte (planeta) , 19 12 Agostinho Neto , 20 11 Nicki Minaj , 21 11 Oiran , 22 11 Partido dos Trabalhadores , 23 11 Grêmio Foot-Ball Porto Alegrense , 24 11 Budismo , 25 10 Os Dez Mandamentos (telenovela)

out 2015: 1 22 Sporting Clube de Portugal , 2 20 Yoná Magalhães , 3 19 Bang (álbum de Anitta) , 4 19 Além do Tempo , 5 16 A Regra do Jogo (telenovela) , 6 16 Eleições legislativas portuguesas de 2015 , 7 15 A Fazenda 8 , 8 15 I Love Paraisópolis , 9 15 Campeonato Brasileiro de Futebol de 2015 - Série A , 10 15 Simone de Beauvoir , 11 14 Luís Carlos Miele , 12 13 Furacão Patricia (2015) , 13 13 Os Dez Mandamentos (telenovela) , 14 13 Verdades Secretas , 15 13 Copa do Brasil de Futebol de 2015 , 16 13 Empresa de Transportes Braso Lisboa , 17 13 Dia das bruxas , 18 13 2015 , 19 13 Direitos humanos , 20 13 Segunda Guerra Mundial , 21 12 Interruptor unilateral de silício , 22 12 Monte Galinheiro , 23 12 Totalmente Demais (telenovela) , 24 12 Larissa Manoela , 25 12 League of Legends

nov 2015: 1 37 Ataques de novembro de 2015 em Paris , 2 24 Totalmente Demais (telenovela) , 3 23 Rompimento de barragem em Mariana , 4 22 Campeonato Brasileiro de Futebol de 2015 - Série A , 5 21 António Costa , 6 19 I Love Paraisópolis , 7 18 Os Dez Mandamentos (telenovela) , 8 17 George Boole , 9 16 Delcídio do Amaral , 10 16 Sport Club Corinthians Paulista , 11 15 A Regra do Jogo (telenovela) , 12 15 Cúmplices de um Resgate , 13 15 Ditadura militar no Brasil (1964–1985) , 14 14 XXI Governo Constitucional de Portugal , 15 14 Proclamação da República do Brasil , 16 13 A Fazenda 8 , 17 13 Wesley Safadão , 18 13 Pedro Arroja , 19 13 Sporting Clube de Portugal , 20 13 Club de Regatas Vasco da Gama , 21 12 25 (álbum) , 22 12 Pietra di Bismantova , 23 12 Survivor Series (2015) , 24 12 Copa Libertadores da América de 2016 , 25 12 Eliminatórias da Copa do Mundo FIFA de 2018 - América do Sul

dez 2015: 1 21 Processo de impeachment de Dilma Rousseff , 2 21 A Regra do Jogo (telenovela) , 3 20 Star Wars: Episódio VII - O Despertar da Força , 4 20 São Paulo Futebol Clube , 5 18 Copa do Mundo de Clubes da FIFA de 2015 , 6 16 Êta Mundo Bom! , 7 16 Copa Libertadores da América de 2016 , 8 16 Partido dos Trabalhadores , 9 15 Fernando Prass , 10 15 Santos Futebol Clube , 11 15 Club de Regatas Vasco da Gama , 12 14 Copa do Mundo de Clubes da FIFA , 13 14 Marília Pêra , 14 13 Jean Wyllys , 15 13 Jadson , 16 13 Joelma Mendes , 17 13 Fascismo , 18 12 MasterChef Júnior (Brasil) , 19 12 Inês Brasil , 20 12 Nelson Barbosa , 21 12 Eleições presidenciais portuguesas de 2016 , 22 12 Allianz Parque , 23 12 Ricardo Oliveira , 24 12 António Costa , 25 12 Papai Noel

jan 2016: 1 28 Êta Mundo Bom! , 2 25 Mortes em janeiro de 2016 , 3 25 Copa São Paulo de Futebol Júnior de 2016 , 4 24 Eleições presidenciais portuguesas de 2016 , 5 24 Marcelo Rebelo de Sousa , 6 23 Lady Gaga , 7 22 Florida Cup de 2016 , 8 22 Alexandre Pato , 9 20 Primeira Liga do Brasil de 2016 , 10 20 David Bowie , 11 20 Partido dos Trabalhadores , 12 18 2016 , 13 17 Big Brother Brasil 16 , 14 17 A Regra do Jogo (telenovela) , 15 17 Totalmente Demais (telenovela) , 16 17 André Felipe Ribeiro de Souza , 17 16 Wendell Lira , 18 16 Teste nuclear norte-coreano de janeiro de 2016 , 19 16 Os Dez Mandamentos (filme de 2016) , 20 16 Star Wars: Episódio VII - O Despertar da Força , 21 16 Charles Perrault , 22 15 John Boyega , 23 15 Vírus da zica , 24 15 Giovanni Augusto , 25 15 Copa São Paulo de Futebol Júnior

fev 2016: 1 27 Vírus da zica , 2 19 Sporting Clube de Portugal , 3 18 Mortes em fevereiro de 2016 , 4 17 Surto de vírus Zika (2015–presente) , 5 17 A Regra do Jogo (telenovela) , 6 17 Leonardo DiCaprio , 7 17 Albert Einstein , 8 16 Resultados do Carnaval do Rio de Janeiro em 2016 , 9 16 Felipe Neto , 10 16 Sport Club Corinthians Paulista , 11 15 Campeonato Paulista de Futebol de 2016 - Série A1 , 12 15 Deadpool (filme) , 13 15 Carnaval , 14 14 Primeira Liga do Brasil de 2016 , 15 14 Copa Libertadores da América de 2016 , 16 14 2016 na televisão , 17 14 Estação Primeira de Mangueira , 18 14 Acre , 19 13 Big Brother Brasil 16 , 20 13 Chicungunha , 21 13 Lady Gaga , 22 13 Google , 23 13 Lisboa , 24 12 Banda Vingadora , 25 12 Resultados da segunda fase da Copa Libertadores da América de 2016

mar 2016: 1 38 Luiz Inácio Lula da Silva , 2 34 Sérgio Moro , 3 28 Operação Lava Jato , 4 26 Big Brother Brasil 16 , 5 24 Atentados em Bruxelas em março de 2016 , 6 24 Mortes em março de 2016 , 7 23 Velho Chico (telenovela) , 8 20 Totalmente Demais (telenovela) , 9 20 Batman v Superman: Dawn of Justice , 10 20 Where Are You Now , 11 19 Processo de impeachment de Dilma Rousseff , 12 19 Batata , 13 18 Vírus da zica , 14 17 Campeonato Paulista de Futebol de 2016 - Série A1 , 15 17 Copa Libertadores da América de 2016 , 16 17 Deadpool , 17 17 Casa Civil (Brasil) , 18 17 Johan Cruijff , 19 16 Afrikanerbond , 20 16 2016 na televisão , 21 16 Donald Trump , 22 15 Copa do Nordeste de Futebol de 2016 , 23 15 Fifth Harmony , 24 15 Club Penguin , 25 15 Karl Marx

abr 2016: 1 34 Processo de impeachment de Dilma Rousseff , 2 25 Campeonato Paulista de Futebol de 2016 - Série A1 , 3 25 Copa Libertadores da América de 2016 , 4 23 Panama Papers , 5 23 Copa do Brasil de Futebol de 2016 , 6 21 Prince , 7 21 Dilma Rousseff , 8 20 Carlos Alberto Brilhante Ustra , 9 19 Velho Chico (telenovela) , 10 19 Campeonato Brasileiro de Futebol de 2016 - Série D , 11 18 Janaína Paschoal , 12 17 Big Brother Brasil 16 , 13 17 Totalmente Demais (telenovela) , 14 16 Batman v Superman: Dawn of Justice , 15 16 Lady Gaga , 16 16 Globalização , 17 16 4 de abril , 18 16 Cristianismo , 19 15 Capitão América: Guerra Civil , 20 15 Leicester City Football Club , 21 15 Jair Bolsonaro , 22 15 Homem de Ferro , 23 15 Jogos Olímpicos , 24 14 Eduardo (rapper) , 25 14 Tereza Rachel

mai 2016: 1 50 Michel Temer , 2 27 Processo de impeachment de Dilma Rousseff , 3 26 Copa do Brasil de Futebol de 2016 , 4 25 Dilma Rousseff , 5 22 Renato Sanches , 6 22 Haja Coração , 7 21 Capitão América: Guerra Civil , 8 18 Campeonato Brasileiro de Futebol de 2016 - Série D , 9 18 Escrava Mãe , 10 18 Totalmente Demais (telenovela) , 11 18 Leicester City Football Club , 12 17 Campeonato Brasileiro de Futebol de 2016 - Série A , 13 17 Waldir Maranhão , 14 17 Eduardo Cunha , 15 17 Cauby Peixoto , 16 17 Santa Cruz Futebol Clube , 17 16 Paysandu Sport Club , 18 16 Club de Regatas Vasco da Gama , 19 15 Copa Libertadores da América de 2016 , 20 15 X-Men: Apocalipse , 21 15 Ministério da Cultura (Brasil) , 22 15 Zlatan Ibrahimović , 23 15 Liga dos Campeões da UEFA , 24 15 Esporte Clube Bahia , 25 14 Governo Michel Temer

jun 2016: 1 31 Campeonato Europeu de Futebol de 2016 , 2 27 Copa América Centenário , 3 23 Haja Coração , 4 23 Rubén Aguirre , 5 21 Muhammad Ali , 6 19 Dunga , 7 18 Mortes em junho de 2016 , 8 17 Christina Grimmie , 9 17 Pedro Pablo Kuczynski , 10 16 Eduardo Cunha , 11 16 Tite (treinador de futebol) , 12 16 Seleção Brasileira de Futebol , 13 16 Sport Club Corinthians Paulista , 14 15 Massacre de Orlando , 15 15 Renato Sanches , 16 15 Êta Mundo Bom! , 17 15 Campeonato Brasileiro de Futebol de 2016 - Série A , 18 15 Jair Bolsonaro , 19 14 I.O.I , 20 14 Escrava Mãe , 21 14 4Minute , 22 14 Daniel Alves , 23 14 Cristiano Ronaldo , 24 13 Saída do Reino Unido da União Europeia , 25 13 Processo de impeachment de Dilma Rousseff

jul 2016: 1 31 Campeonato Europeu de Futebol de 2016 , 2 21 Copa do Brasil de Futebol de 2016 , 3 21 Pokémon GO , 4 20 Rodrigo Maia , 5 20 Seleção Portuguesa de Futebol , 6 19 Grêmio Foot-Ball Porto Alegrense , 7 18 Atentado de julho de 2016 em Nice , 8 18 Ronaldinho Gaúcho , 9 17 Atentado de julho de 2016 em Munique , 10 17 Gabriel Jesus , 11 17 Guilherme Karam , 12 16 A Terra Prometida , 13 16 Campeonato Brasileiro de Futebol de 2016 - Série D , 14 16 Lady Gaga , 15 16 Cúmplices de um Resgate , 16 16 Club de Regatas Vasco da Gama , 17 15 Theresa May , 18 15 Final do Campeonato Europeu de Futebol de 2016 , 19 15 Campeonato Brasileiro de Futebol de 2016 - Série A , 20 15 Camilo de Oliveira , 21 14 Tentativa de golpe de Estado na Turquia em 2016 , 22 14 Stooge sort , 23 14 Êta Mundo Bom! , 24 14 BTS , 25 14 A Garota da Moto

ago 2016: 1 45 Jogos Olímpicos de Verão de 2016 , 2 24 Thiago Braz , 3 23 Seleção Brasileira de Futebol , 4 22 Futebol nos Jogos Olímpicos , 5 21 Êta Mundo Bom! , 6 21 Arthur Mariano , 7 21 Futebol nos Jogos Olímpicos de Verão de 2016 - Masculino , 8 21 Usain Bolt , 9 21 Lista de medalhas brasileiras nos Jogos Olímpicos , 10 20 Brasil nos Jogos Olímpicos de Verão de 2016 , 11 19 Gabriel Barbosa , 12 18 Mortes em agosto de 2016 , 13 18 BTS , 14 18 EXO , 15 18 Rafaela Silva , 16 17 Futebol nos Jogos Olímpicos de Verão de 2016 - Feminino , 17 17 Cerimônia de abertura dos Jogos Olímpicos de Verão de 2016 , 18 17 Jogos Olímpicos de Verão de 2020 , 19 17 Brasil nos Jogos Olímpicos , 20 17 Michel Temer , 21 16 Black Pink , 22 16 Michael Phelps , 23 15 Justiça (minissérie) , 24 15 Esquadrão Suicida (filme) , 25 15 Futebol nos Jogos Olímpicos de Verão de 2016

set 2016: 1 50 Domingos Montagner , 2 24 BTS , 3 22 Jogos Paralímpicos de Verão de 2016 , 4 20 Processo de impeachment de Dilma Rousseff , 5 20 Madre Teresa de Calcutá , 6 19 Protestos contra o governo Michel Temer , 7 18 Campeonato Brasileiro de Futebol de 2016 - Série A , 8 17 Velho Chico (telenovela) , 9 17 Partido da Social Democracia Brasileira , 10 15 A Lei do Amor , 11 15 Copa do Brasil de Futebol de 2016 , 12 15 Cheias de Charme , 13 15 Pablo Escobar , 14 14 Mortes em setembro de 2016 , 15 14 Justiça (minissérie) , 16 14 Jeon Jung-kook , 17 14 Virada Cultural , 18 14 Pedro I do Brasil , 19 13 Sol Nascente (telenovela) , 20 13 Eleição municipal do Rio de Janeiro em 2016 , 21 13 Eliminatórias da Copa do Mundo FIFA de 2018 - América do Sul , 22 13 Felipe Neto , 23 13 Neymar , 24 13 Magno Malta , 25 13 Jogos Olímpicos de Verão de 2016

out 2016: 1 30 A Lei do Amor , 2 27 Marcelo Crivella , 3 22 Haja Coração , 4 22 João Doria , 5 20 Partido da Social Democracia Brasileira , 6 20 António Guterres , 7 18 Copa Libertadores da América de 2017 , 8 18 Carlos Alberto Torres , 9 16 Furacão Matthew , 10 16 Campeonato Brasileiro de Futebol de 2016 - Série A , 11 15 Mortes em outubro de 2016 , 12 15 Rock Story , 13 15 Shawn Mendes , 14 15 Eleições municipais no Brasil em 2016 , 15 14 TWICE , 16 14 Soy Luna , 17 14 Neymar , 18 14 Bhumibol Adulyadej , 19 14 Bob Dylan , 20 14 2016 , 21 13 Volta Redonda Futebol Clube , 22 13 Sporting Clube de Portugal , 23 13 Fortaleza Esporte Clube , 24 13 Sport Club Corinthians Paulista , 25 12 Sol Nascente (telenovela)

nov 2016: 1 37 Voo LaMia 2933 , 2 34 Associação Chapecoense de Futebol , 3 28 Donald Trump , 4 26 Campeonato Brasileiro de Futebol de 2016 - Série A , 5 21 Rock Story , 6 21 Copa do Brasil de Futebol de 2016 , 7 21 2016 , 8 20 Mortes em novembro de 2016 , 9 20 Marcos Danilo Padilha , 10 20 Fidel Castro , 11 19 RecordTV , 12 18 Copa Libertadores da América de 2017 , 13 16 Black Pink , 14 16 Copa Sul-Americana de 2016 , 15 16 Haja Coração , 16 15 2NE1 , 17 15 Geddel Vieira Lima , 18 15 Sistema Brasileiro de Televisão , 19 14 Novo Regime Fiscal , 20 14 Deva Pascovicci , 21 14 Mário Sérgio Pontes de Paiva , 22 14 Jair Bolsonaro , 23 14 Hillary Clinton , 24 14 Sport Club Internacional , 25 13 Carinha de Anjo

dez 2016: 1 50 Associação Chapecoense de Futebol , 2 34 Copa Libertadores da América de 2017 , 3 26 Voo LaMia 2933 , 4 25 Copa do Mundo de Clubes da FIFA de 2016 , 5 23 Copa do Brasil de Futebol de 2017 , 6 22 Mortes em dezembro de 2016 , 7 21 Sport Club Internacional , 8 20 Copa Sul-Americana de 2016 , 9 20 Carrie Fisher , 10 19 Operação Lava Jato , 11 18 Camila Cabello , 12 18 George Michael , 13 18 Grêmio Foot-Ball Porto Alegrense , 14 17 Sociedade Esportiva Palmeiras , 15 16 Campeonato Brasileiro de Futebol de 2016 - Série A , 16 15 Jakson Follmann , 17 15 Novo Regime Fiscal , 18 15 Mário Sérgio Santos Costa , 19 15 BTS , 20 15 Andrés D'Alessandro , 21 15 Olavo de Carvalho , 22 14 Marcos Danilo Padilha , 23 14 Grupo Oi , 24 13 Atentado de Berlim em 2016 , 25 13 Andrei Karlov

jan 2017: 1 29 Copa São Paulo de Futebol Júnior de 2017 , 2 28 2017 , 3 24 Queda de avião Beechcraft King Air prefixo PR-SOM em 2017 , 4 24 Donald Trump , 5 23 Big Brother Brasil 17 , 6 23 Teori Zavascki , 7 22 Florida Cup de 2017 , 8 22 Associação Chapecoense de Futebol , 9 21 Mário Soares , 10 18 Mortes em janeiro de 2017 , 11 18 Loalwa Braz , 12 18 Sociedade Esportiva Palmeiras , 13 17 Black Pink , 14 17 Eike Batista , 15 17 Copa São Paulo de Futebol Júnior , 16 16 Familicídio em Campinas em 2016 , 17 16 Gabriel Girotto Franco , 18 16 Operação Lava Jato , 19 15 A Lei do Amor , 20 15 Steven Universe , 21 15 Angelina Jolie , 22 15 Manchester United Football Club , 23 14 2017 na televisão brasileira , 24 14 David Neres , 25 14 Eduardo Pereira Rodrigues

fev 2017: 1 28 Marisa Letícia Lula da Silva , 2 18 Alexandre de Moraes , 3 18 Copa do Brasil de Futebol de 2017 , 4 17 Girabola de 2017 , 5 17 Campeonato Paulista de Futebol de 2017 - Série A1 , 6 16 Big Brother Brasil 17 , 7 16 William Pottker , 8 14 Crise da segurança pública no Espírito Santo em 2017 , 9 14 Mortes em fevereiro de 2017 , 10 14 Copa do Nordeste de Futebol de 2017 , 11 14 Processo de impeachment de Dilma Rousseff , 12 14 TWICE , 13 14 Copa Libertadores da América de 2017 , 14 14 Frederico Chaves Guedes , 15 14 2017 , 16 14 Carmen Miranda , 17 13 2017 na televisão brasileira , 18 13 Campeonato Carioca de Futebol de 2017 , 19 13 Gilberto Oliveira Souza Júnior , 20 13 Sociedade Esportiva Palmeiras , 21 13 Luiz Inácio Lula da Silva , 22 12 TRAPPIST-1 , 23 12 A Lei do Amor , 24 12 Rock Story , 25 12 EXO

mar 2017: 1 20 Operação Carne Fraca , 2 20 O Rico e Lázaro , 3 20 Campeonato Paulista de Futebol de 2017 - Série A1 , 4 19 Big Brother Brasil 17 , 5 17 Resultados do Carnaval do Rio de Janeiro em 2017 , 6 17 A Força do Querer , 7 17 Andrés D'Alessandro , 8 16 Copa do Brasil de Futebol de 2017 , 9 16 Jair Bolsonaro , 10 15 Logan (filme) , 11 15 Novo Mundo (telenovela) , 12 15 Governo Michel Temer , 13 15 Seleção Brasileira de Futebol , 14 15 Carmen Miranda , 15 14 Atentado em Westminster de 2017 , 16 14 Mortes em março de 2017 , 17 14 Black Pink , 18 14 Portela (escola de samba) , 19 14 Boa Esporte Clube , 20 14 Didier Drogba , 21 14 Unidos da Tijuca , 22 14 Futbol Club Barcelona , 23 13 Miguel Borja , 24 13 Malhação: Pro Dia Nascer Feliz , 25 13 Lista de personalidades do YouTube

abr 2017: 1 24 A Força do Querer , 2 23 Prova Ciclística 9 de Julho , 3 19 Big Brother Brasil 17 , 4 19 13 Reasons Why , 5 19 Jerry Adriani , 6 18 Campeonato Paulista de Futebol de 2017 - Série A1 , 7 18 Solar da Baronesa , 8 18 Turismo em São Paulo (cidade) , 9 17 Katherine Langford , 10 17 Os Dias Eram Assim , 11 17 Belchior , 12 16 Edifício Esther , 13 16 Avenida da Liberdade (São Paulo) , 14 16 Bruno Fernandes de Souza , 15 15 Brasil Paralelo , 16 15 Capela dos Aflitos , 17 15 Copa do Brasil de Futebol de 2017 , 18 15 Chu Ming Silveira , 19 15 Jair Bolsonaro , 20 15 Museu de Anatomia Veterinária da Faculdade de Medicina Veterinária e Zootecnia da USP , 21 15 Jockey Club de São Paulo , 22 15 Cemitério da Consolação , 23 15 Sala São Paulo , 24 15 Parque Zoológico de São Paulo , 25 15 Viaduto do Chá

mai 2017: 1 20 Atentado na Manchester Arena em 2017 , 2 20 Vinícius Júnior , 3 20 Salvador Sobral , 4 20 Belchior , 5 18 Pega Pega , 6 18 Emmanuel Macron , 7 18 Jair Bolsonaro , 8 18 Esporte Clube Bahia , 9 17 Mortes em maio de 2017 , 10 17 Aécio Neves , 11 16 Governo Michel Temer , 12 16 Campeonato Brasileiro de Futebol de 2017 - Série A , 13 16 Nelson Xavier , 14 14 A Força do Querer , 15 14 Copa Libertadores da América de 2017 , 16 14 Associação Chapecoense de Futebol , 17 13 WannaCry , 18 13 2017 na televisão brasileira , 19 13 Campeonato Paulista de Futebol de 2017 - Série A1 , 20 13 Festival Eurovisão da Canção 2017 , 21 13 Desimpedidos , 22 13 Sérgio Moro , 23 13 Almir Guineto , 24 13 Olavo de Carvalho , 25 13 Futbol Club Barcelona

jun 2017: 1 26 Copa das Confederações FIFA de 2017 , 2 21 Incêndio florestal de Pedrógão Grande em 2017 , 3 21 Pega Pega , 4 17 A Força do Querer , 5 17 Adam West , 6 16 Black Pink , 7 16 Monsta X , 8 15 Pabllo Vittar , 9 15 Mulher-Maravilha (filme) , 10 15 Dragon Ball Super , 11 15 Pretty Little Liars (série de televisão) , 12 15 Estádio Luso Brasileiro , 13 14 Campeonato Brasileiro de Futebol de 2017 - Série D , 14 14 Campeonato Brasileiro de Futebol de 2017 - Série A , 15 14 Anitta , 16 13 Malhação: Viva a Diferença , 17 13 Geuvânio , 18 13 James Rodríguez , 19 13 Rhodolfo , 20 13 Club de Regatas Vasco da Gama , 21 12 Campeonato Brasileiro de Futebol de 2017 - Série B , 22 12 The Leftovers , 23 12 Radar meteorológico , 24 12 Cristiano Ronaldo , 25 12 Sociedade Esportiva Palmeiras

jul 2017: 1 28 Luiz Inácio Lula da Silva , 2 22 Mortes em julho de 2017 , 3 18 Campeonato Brasileiro de Futebol de 2017 - Série A , 4 18 Diego Alves , 5 16 A Força do Querer , 6 16 Spider-Man: Homecoming , 7 16 Anitta , 8 15 Chester Bennington , 9 14 Kard , 10 14 Black Pink , 11 14 Camila Cabello , 12 14 Waldir Peres , 13 13 12.ª reunião de cúpula do G20 , 14 13 Movimento Brasil Livre , 15 13 Red Velvet , 16 13 Steven Universe , 17 13 Fortaleza Esporte Clube , 18 12 A Casa (1.ª temporada) , 19 12 Campeonato Brasileiro de Futebol de 2017 - Série D , 20 12 Copa das Confederações FIFA de 2017 , 21 12 Pretty Little Liars (série de televisão) , 22 12 Clube de Regatas do Flamengo , 23 11 Witness (álbum de Katy Perry) , 24 11 Raven's Home , 25 11 Mulher-Maravilha (filme)

ago 2017: 1 21 A Força do Querer , 2 18 Reinaldo Rueda , 3 18 Neymar , 4 17 José Ricardo Mannarino , 5 17 Pabllo Vittar , 6 16 Mortes em agosto de 2017 , 7 16 Jair Bolsonaro , 8 15 Atentados na Catalunha em 2017 , 9 15 Game of Thrones , 10 15 Paris Saint-Germain Football Club , 11 15 Luiz Inácio Lula da Silva , 12 14 Dragon Ball Super , 13 14 José Paulo Bezerra Maciel Junior , 14 13 Copa do Brasil de Futebol de 2017 , 15 13 Dilma Rousseff , 16 12 Sua Cara , 17 12 Descendants 2 , 18 12 Novo Mundo (telenovela) , 19 12 Ousmane Dembélé , 20 12 João Doria , 21 12 Paulo Silvino , 22 12 Fernando Pimentel , 23 11 Miss Brasil 2017 , 24 11 Joanne World Tour , 25 11 Liga dos Campeões da UEFA de 2017–18

set 2017: 1 27 Marcelo Rezende , 2 23 A Fazenda: Nova Chance , 3 20 A Força do Querer , 4 18 Furacão Irma , 5 17 Mortes em setembro de 2017 , 6 15 Rogéria , 7 14 Pega Pega , 8 14 Copa do Brasil de Futebol de 2017 , 9 14 Copa Libertadores da América de 2017 , 10 14 Campeonato Brasileiro de Futebol de 2017 - Série A , 11 14 A Fazenda , 12 12 Polícia Federal – A Lei É para Todos , 13 12 Partido Ecológico Nacional , 14 12 Baltimore Ravens , 15 11 Exathlon Brasil , 16 11 Raven's Home , 17 11 Eliminatórias da Copa do Mundo FIFA de 2018 , 18 11 Farah Jorge Farah , 19 11 Santander Cultural , 20 11 Seleção Brasileira de Futebol , 21 11 Santos Futebol Clube , 22 10 Look What You Made Me Do , 23 10 2017 na televisão brasileira , 24 10 Liga dos Campeões da UEFA de 2017–18 , 25 10 Ouro Verde (telenovela)

out 2017: 1 24 O Outro Lado do Paraíso , 2 21 Catalunha , 3 19 A Fazenda: Nova Chance , 4 16 Eliminatórias da Copa do Mundo FIFA de 2018 , 5 16 Clube de Regatas do Flamengo , 6 14 Mortes em outubro de 2017 , 7 14 Governo Michel Temer , 8 14 Tom Petty , 9 14 São Paulo Futebol Clube , 10 14 Brasil , 11 13 Reconhecimento internacional da independência da Catalunha , 12 13 Tiroteio de Las Vegas Strip em 2017 , 13 13 A Força do Querer , 14 12 República Catalã (2017) , 15 12 Incêndios florestais em Portugal de outubro de 2017 , 16 12 Massacre de Janaúba , 17 12 Eliminatórias da Copa do Mundo FIFA de 2018 - Europa , 18 12 Campeonato Brasileiro de Futebol de 2017 - Série A , 19 12 Londrina Esporte Clube , 20 12 Cristiano Ronaldo , 21 11 Estação Ferroviária de Cachoeira Paulista , 22 11 Copa do Mundo FIFA Sub-17 de 2017 , 23 11 Dragon Ball Super , 24 11 Copa do Mundo FIFA de 2018 , 25 11 Copa Intercontinental

nov 2017: 1 25 Mortes em novembro de 2017 , 2 18 Copa do Mundo FIFA de 2018 , 3 18 Robert Mugabe , 4 17 A Fazenda: Nova Chance , 5 17 Sport Club Internacional , 6 16 Campeonato Brasileiro de Futebol de 2017 - Série A , 7 15 Márcia Cabrita , 8 15 William Waack , 9 13 Golpe de Estado no Zimbabwe em 2017 , 10 13 Copa Libertadores da América de 2018 , 11 12 Campeonato Brasileiro de Futebol de 2017 - Série B , 12 12 Black Friday , 13 11 Eliminatórias da Copa do Mundo FIFA de 2018 - Europa (segunda fase) , 14 11 O Outro Lado do Paraíso , 15 11 Stranger Things , 16 11 Flávia Viana , 17 11 Liga da Justiça (filme) , 18 11 Colin Kâzım-Richards , 19 11 Sport Club Corinthians Paulista , 20 10 ARA San Juan (S-42) , 21 10 Sismo de Kermanshah de 2017 , 22 10 Rodrigo José , 23 10 Raven's Home , 24 10 A Força do Querer , 25 10 Governo Michel Temer

dez 2017: 1 22 Copa Libertadores da América de 2018 , 2 21 O Outro Lado do Paraíso , 3 21 Copa do Mundo de Clubes da FIFA de 2017 , 4 16 A Fazenda: Nova Chance , 5 15 Celebridade (telenovela) , 6 15 Partido do Movimento Democrático Brasileiro , 7 15 Grêmio Foot-Ball Porto Alegrense , 8 14 Mortes em dezembro de 2017 , 9 14 Flávia Viana , 10 14 Eva Todor , 11 14 Coritiba Foot Ball Club , 12 13 Vai Malandra , 13 13 Deus Salve o Rei , 14 13 Campeonato Brasileiro de Futebol de 2017 - Série A , 15 13 Star Wars: Episódio VIII - Os Últimos Jedi , 16 12 Copa do Brasil de Futebol de 2018 , 17 12 2017 na televisão brasileira , 18 12 A Força do Querer , 19 12 Pabllo Vittar , 20 12 August Ames , 21 12 Kim Jong-hyun (cantor) , 22 11 Luiz Cezar Fernandes , 23 11 Melhores do Ano de 2017 , 24 11 Camila (álbum) , 25 11 Romarinho

jan 2018: 1 24 Copa São Paulo de Futebol Júnior de 2018 , 2 23 Mortes em janeiro de 2018 , 3 22 Luiz Inácio Lula da Silva , 4 21 Copa São Paulo de Futebol Júnior , 5 19 O Outro Lado do Paraíso , 6 18 Dolores O'Riordan , 7 17 Yerry Mina , 8 17 2018 , 9 16 Deus Salve o Rei , 10 16 Campeonato Paulista de Futebol de 2018 - Série A1 , 11 16 Cristiane Brasil , 12 14 Processos e investigações envolvendo Luiz Inácio Lula da Silva , 13 14 Philippe Coutinho , 14 13 Marlos Moreno , 15 13 George Weah , 16 13 Big Brother Brasil , 17 12 Júnior Bake Off Brasil , 18 12 2018 na televisão brasileira , 19 12 Pega Pega , 20 12 Coco (filme) , 21 12 Anderson Martins , 22 11 Jojo Maronttini , 23 11 Copa Libertadores da América de 2018 , 24 11 Felipe Vizeu , 25 11 Harry Kane

fev 2018: 1 18 Mortes em fevereiro de 2018 , 2 18 Jojo Maronttini , 3 17 Resultados do Carnaval do Rio de Janeiro em 2018 , 4 16 O Outro Lado do Paraíso , 5 15 Copa do Brasil de Futebol de 2018 , 6 14 Tesla Roadster de Elon Musk , 7 13 Campeonato Paulista de Futebol de 2018 - Série A1 , 8 12 Intervenção federal no Rio de Janeiro em 2018 , 9 11 Resultados do Carnaval de São Paulo em 2018 , 10 11 Copa Libertadores da América de 2018 , 11 11 Eclipse lunar de 31 de janeiro de 2018 , 12 11 Henrique Dourado , 13 11 Jogos Olímpicos de Inverno de 2018 , 14 11 Gleisi Hoffmann , 15 11 El Chavo del Ocho , 16 10 Que Tiro Foi Esse , 17 10 Recopa Sul-Americana de 2018 , 18 10 Malhação: Viva a Diferença , 19 10 Simone & Simaria , 20 10 Dragon Ball Super , 21 10 Associação Atlética Aparecidense , 22 10 Billy Graham , 23 9 MC Loma , 24 9 La casa de papel , 25 9 RuPaul's Drag Race: All Stars (3.ª temporada)

mar 2018: 1 44 Marielle Franco , 2 25 Stephen Hawking , 3 22 Tônia Carrero , 4 19 Mortes em março de 2018 , 5 18 Copa do Brasil de Futebol de 2018 , 6 18 Campeonato Paulista de Futebol de 2018 - Série A1 , 7 17 Assassinato de Marielle Franco , 8 16 RuPaul's Drag Race: All Stars (3.ª temporada) , 9 14 Orgulho e Paixão , 10 14 MC Loma , 11 14 Oscar 2018 , 12 14 Lauren Jauregui , 13 14 Davide Astori , 14 13 La casa de papel , 15 12 Liga dos Campeões da UEFA de 2017–18 , 16 12 TWICE , 17 11 O Outro Lado do Paraíso , 18 11 Pedro Pablo Kuczynski , 19 11 USS Lexington (CV-2) , 20 11 Carlos Eduardo Miranda , 21 11 Grenal , 22 11 Rinoceronte-branco , 23 11 Ciro Gomes , 24 11 Partido Socialismo e Liberdade , 25 11 Santos Futebol Clube

Wikipedias are initially ordered by number of speakers of the language

Speakers: Number of speakers of a language is the estimated total of primary and secondary speakers, is in many cases a very rough estimation (based on the page on the English Wikipedia about that language)
Regions are parts of the world where the language is spoken in substantial amounts (compared to total number of speakers). Regions where a language gained presence only by a recent diaspora are generally not included.
Region codes: AF:Africa, AS:Asia, EU:Europe, NA:North America, OC:Oceania, SA:South America, W:World Wide, CL:Constructed Language

Estatísticas geradas em Terça-feira, 17 de abril 2018 21:34

Dump file ptwiki-20180401-stub-meta-history.xml.gz (edits only), size 3.2 Gb as gz -> 21 Gb
Dump processed till Mar 31, 2018, on server stat1005, ready at Mon-09/04/2018-08:12 after 2 hrs, 43 min, 2 sec.

Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.