Estatísticas da Wikipédia kirundi

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Articles per size range / Records per namespace / Most edited articles / Zeitgeist
 
Jan 31, 2019: This is the final release of Wikistats-1 dump-based reports. Part of these data are available in the first release of Wikistats 2. Read more here

 

Most metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.

Some metrics have been collected from the full archive dump which runs on lower frequency than the usual monthly cycle.
These metrics are columns F,I,J,K,M,N,O,P,Q,R from the first table.


See also metrics definitions


 
Monthly counts & Quarterly rankings: dezembro 2018
 
DataWikipedistasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
dez 20180%   +1%           () 0%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P____Q____R____S__
dez 201820   698  10,7   13    ( ) 125
nov 201820   693  10,8        ( ) 125
out 201820   693  10,8        ( ) 125
set 201820   693  10,8   7    ( ) 125
ago 201820   692  10,8   1    ( ) 125
jul 201820   692  10,8        ( ) 125
jun 201820   692  10,8   3    ( ) 125
mai 201820   692  10,8        ( ) 125
abr 201820   692  10,8   7    ( ) 125
mar 201820 1 690  10,8   14    ( ) 125
fev 201820 1 689  10,8   56    ( ) 125
jan 201820   688  10,7   3    ( ) 125
dez 201720 21688 510,7   224    ( ) 125
nov 201720   541  13,2   6    ( ) 124
out 201720   541 113,2   47    ( ) 124
set 201720   519  13,7   2    ( ) 124
ago 201720   519  13,7   5    ( ) 124
jul 201720 1 519  13,7   8    ( ) 124
jun 2017201  519  13,7   24    ( ) 124
mai 201719 1 519  13,6   18    ( ) 124
abr 201719   518  13,6        ( ) 124
mar 201719   518  13,6   5    ( ) 124
fev 201719   516  13,6   1    ( ) 124
jan 201719   516  13,6   14    ( ) 124
dez 201619   514  13,7   7    ( ) 124
nov 20161911 511  13,7   8    ( ) 124
out 20161811 510  13,7   24    ( ) 124
set 201617   510  13,7   1    ( ) 124
ago 20161712 510  13,7   16    ( ) 124
jul 201616   509  13,7   5    ( ) 122
jun 201616   509  13,7   2    ( ) 122
mai 201616   509  13,7        ( ) 122
abr 201616   509  13,7   3    ( ) 122
mar 201616   508  13,7   4    ( ) 121
fev 201616   506  13,7   1    ( ) 121
jan 20161611 506  13,7   18    ( ) 121
dez 201515   504  13,8   2    ( ) 121
nov 201515 32504 313,8   320    ( ) 119
out 201515   411  16,1   3    ( ) 114
set 201515   411  16,1   3    ( ) 114
ago 201515   410  16,1        ( ) 114
jul 201515 1 410 116,1   29    ( ) 114
jun 201515   394  16,7   3    ( ) 112
mai 201515   391  16,8   4    ( ) 112
abr 20151511 391  16,8   24    ( ) 112
mar 201514 1 379  17,3   83    ( ) 111
fev 201514   371  17,4        ( ) 108
jan 201514   371  17,4   1    ( ) 108
dez 201414   371  17,4   2    ( ) 108
nov 201414   371  17,4   2    ( ) 107
out 201414   370  17,5   2    ( ) 107
set 201414   370  17,4   12    ( ) 107
ago 201414 1 368  17,5   25    ( ) 106
jul 201414 11367 117,5   245    ( ) 102
jun 20141411 330 118,7   33    ( ) 81
mai 201413   314  19,6   7    ( ) 80
abr 201413   314  19,5   7    ( ) 80
mar 201413   314  19,5   5    ( ) 79
fev 201413   31446 19,52399%3%1160 kb13 k45735(1)1779
jan 20141311131446419,52399%3%197160 kb13 k45535(1)1779
dez 201312   20246 29,332614%4%4149 kb12 k37341(1)1869
nov 201312 1 20246 29,332614%4%9149 kb12 k37341(1)1869
out 201312   20246 29,333214%4% 153 kb12 k38556(1)1969
set 201312   20246 29,333214%4% 153 kb12 k38556(1)1969
ago 201312   20246 29,333214%4%2153 kb12 k38556(1)1969
jul 201312   20246 29,333214%4%5157 kb12 k385183(1)1969
jun 201312   20246 29,233114%4%7157 kb12 k384183(1)1969
mai 201312   20045 29,533214%4%2157 kb12 k367224(1)1969
abr 201312   19945 29,633314%5%6157 kb12 k365225(1)1969
mar 201312   19844 29,732614%4%234154 kb12 k365232( )1869
fev 201312   19643 28,932813%4%92477 kb12 k36313 k( )1367
jan 201312 1 19643 28,432813%4%108475 kb12 k36313 k( )1367
dez 201212   18741 29,231313%4%97447 kb11 k36213 k( )1367
nov 201212   18741 28,731313%4%102445 kb11 k36213 k( )1367
out 201212 1 18740 28,131213%4%120443 kb11 k35713 k( )1367
set 201212 1 18440 27,931413%4%134436 kb11 k29112 k( )1367
ago 201212 1 18440 27,231413%4%104435 kb11 k29112 k( )1367
jul 201212   18440 26,629813%4%90429 kb10 k29012 k( )1367
jun 201212   18340 26,329813%4%159420 kb10 k29012 k( )1367
mai 201212   18340 25,429813%4%153418 kb10 k29012 k( )1367
abr 201212   18240 24,729913%4%129415 kb10 k28912 k(2)1367
mar 201212 1 18240 2429913%4%128413 kb10 k28812 k(2)1367
fev 201212   18140 23,430013%4%165408 kb10 k28712 k(2)1367
jan 201212   17740 2330314%4%97404 kb10 k28512 k(2)1367
dez 201112   17740 22,530314%4%120401 kb10 k28512 k(2)1367
nov 201112   17740 21,830314%4%195400 kb10 k28512 k(2)1367
out 201112   17740 20,730314%4%174397 kb10 k28512 k(2)1367
set 201112   17640 19,830414%4%160390 kb10 k28411 k(2)1367
ago 201112   17640 18,930414%4%119387 kb10 k28411 k(2)1367
jul 201112   17640 18,230414%4%164385 kb10 k28411 k(2)1267
jun 201112   17539 17,430514%4%175382 kb10 k27711 k(3)1367
mai 201112   17539 16,430514%4%133379 kb10 k27711 k(3)1367
abr 20111211 17539 15,630514%4%154376 kb10 k27711 k(3)1367
mar 201111 1 16738 15,531114%4%161349 kb10,0 k26510 k(3)1367
fev 20111124 15235 15,933714%5%165325 kb9,6 k2499,4 k(1)1356
jan 20119 1 14632 15,529613%5%195306 kb7,8 k2449,3 k(1)1050
dez 2010912 14127114,625913%4%391292 kb6,5 k1629,1 k(1)1042
nov 20108 1 10612115,82177%3%283176 kb4,3 k1065,6 k(1)537
out 20108   6412 21,727411%5%38119 kb3,4 k762,9 k(1)526
set 20108   6412 21,127411%5%29119 kb3,4 k762,9 k(1)526
ago 20108   6412 20,627411%5%52118 kb3,4 k762,9 k(1)526
jul 201081116412119,823311%5%151112 kb2,9 k762,9 k(2)526
jun 20107   4012 27,943718%8%3288 kb2,8 k652,1 k(2)35
mai 2010722 3911127,832715%5%11080 kb2,0 k642,1 k(2)35
abr 2010511 2110 46,552324%10%5163 kb1,8 k481,7 k(2)33
mar 20104   209 46,250120%10%3861 kb1,6 k461,7 k(2)33
fev 20104   209 44,448820%10%2161 kb1,6 k461,7 k(1)23
jan 20104   199 45,650921%11%3057 kb1,6 k461,6 k(1)23
dez 20094   199 4450821%11%2756 kb1,6 k461,6 k(1)23
nov 20094   199 42,650821%11%2456 kb1,6 k461,6 k(3)23
out 20094   199 41,350821%11%4456 kb1,6 k461,6 k(6)23
set 20094   189 41,253122%11%2155 kb1,5 k451,5 k(6)23
ago 20094   189 4053122%11%4054 kb1,5 k451,5 k(8)23
jul 20094   189 37,853122%11%2154 kb1,5 k451,5 k(8)23
jun 20094   189 36,653122%11%2954 kb1,5 k451,5 k(10)23
mai 20094   189 3551422%11%1353 kb1,5 k401,5 k(18)23
abr 20094   189 34,351422%11%2753 kb1,5 k401,5 k(18)23
mar 20094   189 32,851422%11%2852 kb1,5 k401,5 k(19)23
fev 20094   189 31,251422%11%2352 kb1,5 k401,5 k(19)23
jan 2009411 189 29,951422%11%5352 kb1,5 k401,5 k(19)23
dez 20083   158 32,465327%13%1840 kb1,4 k37990(11)22
nov 2008313 157 31,263027%13%5939 kb1,4 k33987(11)22
out 20082 1 157 27,348620%7%3039 kb96238982(11)22
set 20082   157 25,348420%7%1739 kb96037976(11)22
ago 20082   157 24,148420%7%2335 kb96037847(11)22
jul 20082   137 26,150823%8%2034 kb94933841(9)22
jun 20082   127 26,653525%8%1733 kb92232820(8)22
mai 20082   116 27,543718%9%1329 kb69729714(8)12
abr 20082   116 26,343718%9%1628 kb69729709(8)12
mar 20082   116 24,842518%9%1128 kb67629705(8)12
fev 20082   116 23,842518%9%1728 kb67629699(8)12
jan 20082   106 24,542520%10%1224 kb67629693(8)12
dez 20072   106 23,342520%10%1121 kb67629560(8)12
nov 20072 1 106 22,242520%10%2021 kb67629554(8)12
out 20072   106 20,246220%10%2820 kb67429551(8)11
set 20072   106 17,448930%10%2920 kb72730547(7)11
ago 20072   105 14,548520%10%418 kb64530446(7)11
jul 20072 1 105 14,148520%10%718 kb64530446(7)11
jun 20072   105 13,448320%10%718 kb64525446(7)11
mai 20072   105 12,748320%10%317 kb64525446(7)11
abr 20072   105 12,447920%10%517 kb63725445(7)11
mar 20072   105 11,947920%10%1017 kb63725442(7)11
fev 20072   105 10,947920%10%1017 kb63725434(7)11
jan 20072   105 9,946620%10%817 kb62025431(7)11
dez 20062   105 9,146520%10%1416 kb62025427(7)11
nov 20062   95 8,645622%11%111 kb60123306(8)11
out 20062   95 8,445622%11%311 kb60123302(8)11
set 20062   95 8,145422%11%311 kb60123282(8)11
ago 20062   95 7,842222% 110 kb55523280(8)11
jul 20062   95 7,742222% 510 kb55523274(8)11
jun 2006211 95 7,142222% 228,3 kb55521164(8)11
mai 20061   64 758233% 157,3 kb45114151(7)11
abr 20061 1 33 959267% 85,4 kb32710114(3)11
mar 20061   21 9,5157650%  3,6 kb24714( )6 
fev 20061   21 9,5157650%  3,6 kb24714( )6 
jan 20061   21 9,5157650% 93,6 kb24714( )6 
dez 20051   21 538250% 5931 10732( )3 
nov 20051   21 2,538050% 3927 10722( )3 
out 20051   1  2    684    ( )  
set 20051   1  2    684    ( )  
ago 20051   1  2    684    ( )  
jul 20051   1  2    684    ( )  
jun 20051   1  2    684    ( )  
mai 20051   1  2    684    ( )  
abr 20051   1  2    684    ( )  
mar 20051   1  2    684    ( )  
fev 20051   1  2    684    ( )  
jan 20051   1  2    684    ( )  
dez 20041   1  2    684    ( )  
nov 20041   1  2    684    ( )  
out 20041   1  2    684    ( )  
set 20041   1  2    684    ( )  
ago 20041   1  2   1684    ( )  
jul 20041   1  1    624    ( )  
jun 20041   1  1    624    ( )  
mai 20041   1  1    624    ( )  
abr 20041   1  1    624    ( )  
mar 200411  1  1   1624    ( )  
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
 WikipedistasArtigosBase de dadosLigações

Counts for image links are based on keyword(s) found in the message file for this language: (Image).
Note that image links based on default keyword 'Image' and/or 'File' have been missed. This will be repaired on the next run.

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikipedistas (usuários registrados)
A = Wikipedistas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikipedistas que editaram pelo menos dez vezes desde que chegaram
C = Wikipedistas que contribuíram cinco vezes ou mais este mês
D = Wikipedistas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Artigos que contêm pelo menos uma ligação interna e 200 caracteres de texto legível, não contando códigos wiki e html,
      ligações ocultas, etc.; títulos também não contam (outras colunas são baseadas no método oficial de contagem)
G = Novos artigos por dia no mês passado
H = Número médio de revisões por artigo
I = Tamanho médio dos artigos em bytes
J = Porcentagem de artigos com pelo menos 0,5 kb de texto legível (veja F)
K = Porcentagem de artigos com pelo menos 2 kb de texto legível (veja F)

Base de dados
L = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
M = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
N = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
O = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
P = Total de ligações para outras wikipédias
Q = Total de imagens apresentadas
R = Total de ligações para outros sítios
S = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  5  10  100  1  3  5  10  5  10  1  3  5  10  25  100  250  5  10  100 
dez 20181      21    3222111   
nov 2018                       
out 2018             31        
set 201821     1               
ago 20181      1               
jul 2018       1     1         
jun 20181      1     1         
mai 2018                       
abr 20181            21        
mar 2018211     1               
fev 201811111   111   32        
jan 20181      1     1         
dez 2017222111   2     11        
nov 201721     1     1         
out 20171                      
set 20171                      
ago 201711           2         
jul 2017211           11        
jun 201754  11       31111     
mai 20172111          1      1  
abr 2017       1     1         
mar 2017                       
fev 20171            2         
jan 201771           1         
out 2018             31        
jul 2018       1     1         
abr 20181            21        
jan 20181      1     1         
out 20171                      
jul 2017211           11        
abr 2017       1     1         
jan 201771           1         
out 20162111    1     1         
jul 20162            1         
abr 20161      2     31        
jan 20161111          2         
out 20151                   1  
jul 201511111   1     2         
abr 20151111        223      1  
jan 2015       1     21        
out 20142            3         
jul 2014321111   11    311       
abr 201421           3         
jan 2014211111   2     52        
out 2013       3     61        
jul 201321     2     3         
abr 20131            5      41 
jan 20132111 63 31    2      53 
out 20123111 44 1     61     111
jul 20123   62 3111  8211   33 
abr 20122   74 1     41     41 
jan 20121   65       4      1  
out 20112   94 2     7      107 
jul 20112   95 1     51     41 
abr 20112111166       411    74 
jan 201121111103 2     6111   107 
out 2010    11       5      41 
jul 201022111121 1     21111  41 
abr 20106411          42     41 
jan 201021  1  1     5111   1  
out 2009    2  1     3         
jul 2009    1  1     6         
abr 200911  2        422    1  
jan 20093211 4  2     9222   21 
out 2008511     2     1022    1  
jul 20082   1  1     7         
abr 2008    2        3         
jan 2008    1        3      1  
out 200752  1  2     6         
jul 2007111           2         
abr 200731           1111      
jan 2007    1                  
out 2006                       
jul 20061      1     1         
abr 2006111     2     31        
jan 20062            2         
out 2005             1         
jul 2005                       
abr 2005             2         
jan 2005                       
out 2004                       
jul 2004                       
abr 2004                       

 

Distribuição de edições de artigos por wikipedistas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikipedistasEdições total
1156100.0%2,235100.0%
34629.5%2,07292.7%
101912.2%1,93286.4%
3295.8%1,75878.7%
10063.8%1,62772.8%
31631.9%1,17452.5%

 

1 wikipedistas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdições 
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
 agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
DARIO SEVERIUC6 01001243ago 09, 20168731---

 

20 wikipedistas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
  Primeira ediçãoúltima edição
 posiçãototaldatadias
atrás
datadias
atrás
KmoksyUC1426jul 04, 20103101fev 17, 20161047
SorratUC2385mai 13, 20132057nov 19, 20151137
Frank Earl DallonUC3363jun 16, 20141658nov 14, 20151142
Failstate14UC4178abr 28, 20151342abr 04, 20161000
Firiberi NTIBITANGIRAUC5175jan 24, 20103262dez 27, 2017368
Jose77UC752jul 20, 20064546mai 26, 20103140
X4v13r3shUC845abr 16, 20112815abr 17, 20112814
WolverèneUC934jun 15, 20141659out 16, 2017440
AniragiraUC1029fev 25, 20112865mar 02, 20112860
SebleoufUC1121jul 19, 20083816abr 10, 20093551
Polepole877UC1220out 01, 2016820out 01, 2016820
Imperator-KaiserUC1319dez 22, 20102930dez 22, 20102930
Jerzyjan1UC1417ago 20, 20141593dez 01, 2016759
Umutesi84UC1517jan 24, 20161071jan 24, 20161071
Ionius Mundus~rnwikiUC1615jun 19, 20064577jun 24, 20064572
.snoopy.UC1713mai 17, 20103149mai 17, 20103149
JajajajajajajajajajajajaUC1812abr 21, 20103175abr 21, 20103175
MelosUC1911nov 17, 20083695nov 17, 20083695
JorunnUC209set 26, 20074113out 22, 20083721
Yan~rnwikiUC219fev 08, 20112882fev 11, 20112879

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 445 edições foram feitas por usuários anônimos, de um total de 7481 edições ( 5e %)
  


50 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições 
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
 datadias
atrás
datadias
atrás
EmausBotUC1712jul 10, 20103095abr 16, 20132084--
XqbotUC2588abr 08, 20093553jul 08, 20151271--
Luckas-botUC3371ago 03, 20093436mai 16, 20122419--
MerlIwBotUC4282abr 24, 20112807mai 21, 20132049--
ZéroBotUC5236dez 30, 20102922mar 04, 20132127--
WikitanvirBotUC6190dez 22, 20102930mai 04, 20122431--
AddbotUC7187mar 07, 20132124jun 02, 20132037--
TXiKiBoTUC8167dez 13, 20064400dez 28, 20112559--
EscarbotUC9151jul 09, 20064557fev 07, 20132152--
SieBotUC10138set 17, 20074122jan 10, 20112911--
VolkovBotUC11135set 10, 20083763jan 19, 20132171--
FoxBotUC12105out 11, 20093367fev 04, 20122521--
KamikazeBotUC1388ago 09, 20103065jan 01, 20132189--
HRoestBotUC1485nov 30, 20102952mar 11, 20122485--
JAnDbotUC1574fev 06, 20074345set 06, 20122306--
TjBotUC1674fev 20, 20112870fev 22, 20132137--
AvocatoBotUC1768out 30, 20112618mai 17, 20122418--
RedBotUC1863nov 24, 20112593ago 15, 20122328--
Movses-botUC1957fev 03, 20112887fev 24, 20122501--
Ripchip BotUC2052mar 16, 20112846fev 18, 20122507--
JackieBotUC2151dez 04, 20102948jan 28, 20132162--
MelancholieBotUC2246mai 28, 20083868out 25, 20093353--
Idioma-botUC2344nov 22, 20102960set 28, 20122284--
JhsBotUC2443mai 21, 20103145jun 23, 20122381--
AvicBotUC2541jun 18, 20112752nov 23, 20122228--
VagobotUC2641set 08, 20112670abr 10, 20122455--
MjbmrbotUC2738dez 05, 20102947mar 22, 20112840--
GerakibotUC2837mai 15, 20103151mar 03, 20132128--
AlleborgoBotUC2936nov 12, 20074066dez 02, 20083680--
ArthurBotUC3036jan 19, 20093632abr 12, 20112819--
LaaknorBotUC3133fev 07, 20093613dez 22, 20122199--
LegobotUC3232mar 11, 20132120mar 11, 20132120--
Dinamik-botUC3328jun 22, 20103113dez 14, 20122207--
MastiBotUC3426dez 18, 20093299jan 18, 20132172--
RobbotUC3525mar 04, 20074319ago 05, 20122338--
PipepBotUC3624set 02, 20074137jun 04, 20083861--
CommonsDelinkerUC3724fev 22, 20103233jan 31, 2018333--
HerculeBotUC3823ago 31, 20083773set 21, 20122291--
RubinbotUC3923jun 07, 20093493fev 08, 20132151--
HiW-BotUC4020out 29, 20112619ago 07, 20122336--
LovelessUC4118fev 21, 20083965nov 30, 20102952--
SynthebotUC4218jan 24, 20093627out 16, 20122266--
SilvonenBotUC4317mar 31, 20093561out 28, 20112620--
AlexbotUC4417ago 08, 20093431dez 24, 20102928--
CarsracBotUC4517jan 10, 20103276jan 25, 20132165--
MystBotUC4617set 30, 20103013jan 27, 20122529--
PtbotgourouUC4716out 22, 20083721mai 08, 20122427--
BotMultichillUC4815set 07, 20074132abr 17, 20112814--
Makecat-botUC4915nov 04, 20122247fev 25, 20132134--
CocuBotUC5014jun 09, 20112761set 19, 20112659--

 

Artigos que contêm pelo menos uma ligação interna e .. caracteres de texto legível, não contando códigos wiki e html,
ligações ocultas, etc.; títulos também não contam  (excluindo páginas de redirecionamento)

DataArtigos
 < 32 ch< 64 ch< 128 ch< 256 ch< 512 ch< 1 k ch< 2 k ch< 4 k ch< 8 k ch< 16 k ch< 32 k ch< 64 k ch
out 201139.0%57.3%62.2%84.6%90.3%96.4%97.2%98.8%99.6%99.6%100.0%100.0%
set 201139.2%57.2%62.1%84.5%90.2%96.3%97.1%98.7%99.5%99.5%99.9%99.9%
ago 201139.2%57.2%62.1%84.5%90.2%96.3%97.1%98.7%99.5%99.5%99.9%99.9%
jul 201139.2%57.2%62.1%84.5%90.2%96.3%97.1%98.7%99.5%99.5%99.9%99.9%
jun 201139.8%57.4%62.3%84.8%90.1%96.2%97.0%98.6%99.4%99.4%99.8%99.8%
mai 201139.8%57.4%62.3%84.8%90.1%96.2%97.0%98.6%99.4%99.4%99.8%99.8%
abr 201139.8%57.4%62.3%84.8%90.1%96.2%97.0%98.6%99.4%99.4%99.8%99.8%
mar 201141.0%56.4%61.1%84.6%90.2%96.2%97.1%98.8%99.7%99.7%100.0%100.0%
fev 201139.9%53.8%57.6%84.0%89.8%95.6%96.6%98.5%99.5%99.5%100.0%100.0%
jan 201140.6%53.3%56.9%84.8%90.4%96.0%96.5%98.5%99.5%100.0%100.0%100.0%
dez 201044.6%52.8%61.5%85.4%90.3%96.3%97.4%99.0%99.5%100.0%100.0%100.0%
nov 201042.0%51.1%60.9%91.7%95.2%96.6%98.0%99.4%99.4%100.0%100.0%100.0%
out 201051.1%65.5%81.1%86.7%92.3%94.5%96.7%98.9%98.9%100.0%100.0%100.0%
set 201051.1%65.5%81.1%86.7%92.3%94.5%96.7%98.9%98.9%100.0%100.0%100.0%
ago 201051.1%65.5%81.1%86.7%92.3%94.5%96.7%98.9%98.9%100.0%100.0%100.0%
jul 201051.1%65.5%81.1%86.7%92.3%94.5%96.7%98.9%100.0%100.0%100.0%100.0%
jun 201022.2%31.1%62.2%73.3%84.4%88.8%93.2%97.6%99.8%99.8%99.8%99.8%
mai 201022.7%31.8%61.3%74.9%86.3%90.8%95.3%99.8%99.8%99.8%99.8%99.8%
abr 201033.3%41.6%45.8%58.3%79.1%83.3%91.6%99.9%99.9%99.9%99.9%99.9%
mar 201039.1%47.8%47.8%60.8%82.5%82.5%91.2%99.9%99.9%99.9%99.9%99.9%
fev 201039.1%47.8%47.8%60.8%82.5%82.5%91.2%99.9%99.9%99.9%99.9%99.9%
jan 201036.4%45.5%45.5%59.1%81.8%81.8%90.9%100.0%100.0%100.0%100.0%100.0%
dez 200936.4%45.5%45.5%59.1%81.8%81.8%90.9%100.0%100.0%100.0%100.0%100.0%
nov 200936.4%45.5%45.5%59.1%81.8%81.8%90.9%100.0%100.0%100.0%100.0%100.0%
out 200936.4%45.5%45.5%59.1%81.8%81.8%90.9%100.0%100.0%100.0%100.0%100.0%
set 200938.1%42.9%42.9%57.2%81.0%81.0%90.5%100.0%100.0%100.0%100.0%100.0%
ago 200938.1%42.9%42.9%57.2%81.0%81.0%90.5%100.0%100.0%100.0%100.0%100.0%
jul 200938.1%42.9%42.9%57.2%81.0%81.0%90.5%100.0%100.0%100.0%100.0%100.0%
jun 200938.1%42.9%42.9%57.2%81.0%81.0%90.5%100.0%100.0%100.0%100.0%100.0%
mai 200938.1%42.9%42.9%57.2%81.0%81.0%90.5%100.0%100.0%100.0%100.0%100.0%
abr 200938.1%42.9%42.9%57.2%81.0%81.0%90.5%100.0%100.0%100.0%100.0%100.0%
mar 200938.1%42.9%42.9%57.2%81.0%81.0%90.5%100.0%100.0%100.0%100.0%100.0%
fev 200938.1%42.9%42.9%57.2%81.0%81.0%90.5%100.0%100.0%100.0%100.0%100.0%
jan 200938.1%42.9%42.9%57.2%81.0%81.0%90.5%100.0%100.0%100.0%100.0%100.0%
dez 200825.0%31.2%31.2%50.0%75.0%75.0%87.5%100.0%100.0%100.0%100.0%100.0%
nov 200825.0%31.2%37.4%56.2%75.0%75.0%87.5%100.0%100.0%100.0%100.0%100.0%
out 200820.0%33.3%33.3%53.3%80.0%80.0%93.3%100.0%100.0%100.0%100.0%100.0%
set 200826.7%33.4%33.4%53.4%80.1%80.1%93.4%100.0%100.0%100.0%100.0%100.0%
ago 200826.7%33.4%33.4%53.4%80.1%80.1%93.4%100.0%100.0%100.0%100.0%100.0%
jul 200821.4%28.5%28.5%49.9%78.5%78.5%92.8%99.9%99.9%99.9%99.9%99.9%
jun 200823.1%30.8%30.8%46.2%77.0%77.0%92.4%100.0%100.0%100.0%100.0%100.0%
mai 200825.0%33.3%33.3%50.0%83.3%83.3%91.6%99.9%99.9%99.9%99.9%99.9%
abr 200825.0%33.3%33.3%50.0%83.3%83.3%91.6%99.9%99.9%99.9%99.9%99.9%
mar 200825.0%33.3%33.3%50.0%83.3%83.3%91.6%99.9%99.9%99.9%99.9%99.9%
fev 200825.0%33.3%33.3%50.0%83.3%83.3%91.6%99.9%99.9%99.9%99.9%99.9%
jan 200825.0%33.3%33.3%50.0%83.3%83.3%91.6%99.9%99.9%99.9%99.9%99.9%
dez 200725.0%33.3%33.3%50.0%83.3%83.3%91.6%99.9%99.9%99.9%99.9%99.9%
nov 200725.0%33.3%33.3%50.0%83.3%83.3%91.6%99.9%99.9%99.9%99.9%99.9%
out 200718.2%27.3%27.3%45.5%81.9%81.9%91.0%100.0%100.0%100.0%100.0%100.0%
set 200718.2%27.3%27.3%45.5%72.8%81.9%91.0%100.0%100.0%100.0%100.0%100.0%
ago 200720.0%30.0%30.0%50.0%80.0%80.0%90.0%100.0%100.0%100.0%100.0%100.0%
jul 200720.0%30.0%30.0%50.0%80.0%80.0%90.0%100.0%100.0%100.0%100.0%100.0%
jun 200720.0%30.0%30.0%50.0%80.0%80.0%90.0%100.0%100.0%100.0%100.0%100.0%
mai 200720.0%30.0%30.0%50.0%80.0%80.0%90.0%100.0%100.0%100.0%100.0%100.0%
abr 200720.0%30.0%30.0%50.0%80.0%80.0%90.0%100.0%100.0%100.0%100.0%100.0%
mar 200720.0%30.0%30.0%50.0%80.0%80.0%90.0%100.0%100.0%100.0%100.0%100.0%
fev 200720.0%30.0%30.0%50.0%80.0%80.0%90.0%100.0%100.0%100.0%100.0%100.0%
jan 200720.0%30.0%30.0%50.0%80.0%90.0%90.0%100.0%100.0%100.0%100.0%100.0%
dez 200620.0%30.0%30.0%50.0%80.0%90.0%90.0%100.0%100.0%100.0%100.0%100.0%
nov 200620.0%30.0%30.0%50.0%80.0%90.0%90.0%100.0%100.0%100.0%100.0%100.0%
out 200620.0%30.0%30.0%50.0%80.0%90.0%90.0%100.0%100.0%100.0%100.0%100.0%
set 200620.0%30.0%40.0%50.0%80.0%90.0%90.0%100.0%100.0%100.0%100.0%100.0%
ago 200620.0%30.0%40.0%50.0%80.0%90.0%100.0%100.0%100.0%100.0%100.0%100.0%
jul 200620.0%30.0%40.0%50.0%80.0%90.0%100.0%100.0%100.0%100.0%100.0%100.0%
jun 200620.0%30.0%40.0%50.0%80.0%90.0%100.0%100.0%100.0%100.0%100.0%100.0%
mai 200633.3%33.3%33.3%33.3%66.6%83.3%100.0%100.0%100.0%100.0%100.0%100.0%
abr 200625.0%25.0%25.0%25.0%50.0%75.0%100.0%100.0%100.0%100.0%100.0%100.0%
mar 20060.0%0.0%0.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%
fev 20060.0%0.0%0.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%
jan 20060.0%0.0%0.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%
dez 20050.0%0.0%0.0%50.0%50.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
nov 20050.0%0.0%0.0%50.0%50.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110Svg
dez 201882365212122581231       1
nov 20188186521112601180       1
out 20188186521112601180       1
set 20188186511112601177       1
ago 20188176511112601177       1
jul 20188176511112601177       1
jun 20188176511112601177       1
mai 201881765011 2601177        
abr 201881765011 2601177        
mar 201881564911 2601174        
fev 201881464911 2601174        
jan 201881364611 2601172        
dez 201781364611 2601172        
nov 201766564411 2601172        
out 201766564411 2601172        
set 201764364411 2601172        
ago 201764364411 2601172        
jul 201764364311 2601172        
jun 201764364311 2601169        
mai 201764364311 260195        
abr 201764264311 260194        
mar 201764264311 260194        
fev 201764064311 259194        
jan 201764064111 259194        
dez 201663864111 259194        
nov 201663564111 259194        
out 201663464011 259193        
set 201663464011 259192        
ago 201663463911 259192        
jul 201663163711 259187        
jun 201663163511 259187        
mai 201663163511 259187        
abr 201663163411 259187        
mar 201662963211 259187        
fev 201662763211 259187        
jan 201662763211 259187        
dez 201562563211 259187        
nov 201562362811 259187        
out 20155256269 257187        
set 20155256269 250187        
ago 20155246259 250186        
jul 20155246229 249186        
jun 20155066219 249185        
mai 20155036219 249184        
abr 20155036209 249182        
mar 20154906198 249182        
fev 20154796198 249181        
jan 20154796128 249181        
dez 20144796108 249181        
nov 20144786098 249181        
out 20144776078 249181        
set 20144776068 249181        
ago 20144746028 238181        
jul 20144695948 238181        
jun 20144115938 238174        
mai 20143945938 238174        
abr 20143945858 238174        
mar 20143935838 238174        
fev 20143935798 238174      1 
jan 20143935778 238174      197 
dez 20132715738 238172      2 
nov 20132715738 238172      9 
out 20132715677 138171        
set 20132715617 138171        
ago 20132715477 138171        
jul 20132715437 138171      5 
jun 20132715417 138171      1 
mai 20132695397 138171      1 
abr 20132685347 138171      2 
mar 20132675247 138171      4 
fev 20132634877 138171      2 
jan 20132634777 138171      11 
dez 20122544747 138171      3 
nov 20122544657 138171        
out 20122544657 138171      20 
set 20122514597 138170      5 
ago 20122514537 138170      16 
jul 20122514487 138170      3 
jun 20122504417 138170      3 
mai 20122504297 138170      3 
abr 20122494247 138170      3 
mar 20122494177 138170      8 
fev 20122484066 138170      4 
jan 20122443986 138170      1 
dez 20112443926 138170        
nov 20112443886 138170      1 
out 20112443746 138170      2 
set 20112433666 138170        
ago 20112433606 138170      5 
jul 20112433526 138170      3 
jun 20112423426 138170      1 
mai 20112423366 138170        
abr 20112423316 138170      46 
mar 20112343226 137170      58 
fev 20112083216 137169      96 
jan 20111963136 137165      75 
dez 20101833086 132151      98 
nov 20101433026 132148      72 
out 2010902956  32146        
set 2010902906  32146      1 
ago 2010902856  32146      1 
jul 2010902686  31146      108 
jun 2010452676  1118      1 
mai 2010442556  1118      69 
abr 2010242486  618      27 
mar 2010232416  618      5 
fev 2010232336  618      3 
jan 2010222306  618      5 
dez 2009222166  618      1 
nov 2009222136  618      2 
out 2009222076  618        
set 2009212046  618        
ago 2009211956  618        
jul 2009211946  618        
jun 2009211866  618        
mai 2009211856  518      1 
abr 2009211826  518      3 
mar 2009211726  518        
fev 2009211614  418        
jan 2009211564  418      19 
dez 2008171494  214      2 
nov 2008171434  214      26 
out 2008171324  214      10 
set 2008171154  213      1 
ago 2008171054  213      7 
jul 200815994  213      2 
jun 200814904  213        
mai 200813814  213        
abr 200813784  213        
mar 200813743  2 3        
fev 200813713  2 3        
jan 200812703  2 3        
dez 200712643  2 3      1 
nov 200712613  2 3      6 
out 200711603  2 3      12 
set 200711553  2 3      1 
ago 200711511  2 3      2 
jul 200711461  2 2      7 
jun 200711441  2 2      1 
mai 200711421  2 2        
abr 200711411  2 2      5 
mar 200711331  2 2      2 
fev 20071128   1 2        
jan 20071124   1 2        
dez 20061124   1 2        
nov 20061021   1 2        
out 20061020   1 2        
set 20061020   1 2        
ago 20061019   1 2        
jul 20061018   1 2      1 
jun 20061017   1 2      19 
mai 2006717   1 2        
abr 2006417   1 2      7 
mar 2006216              
fev 2006213              
jan 2006213              
dez 2005211              
nov 2005210              
out 200517              
set 200516              
ago 200515              
jul 200514              
jun 200514              
mai 200513              
abr 200513              
mar 20051               
fev 20051               
jan 20051               
dez 20041               
nov 20041               
out 20041               
set 20041               
ago 20041               
jul 20041               
jun 20041               
mai 20041               
abr 20041               
mar 20041               

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

mar 2004: 1 1 Main Page

nov 2005: 1 1 Uburundi

dez 2005: 1 1 Main Page

jan 2006: 1 2 Main Page

abr 2006: 1 1 Rwagasore Louis

jun 2006: 1 2 Interahamwe , 2 1 Ikirundi

jul 2006: 1 1 Interahamwe

mar 2007: 1 1 Main Page

abr 2007: 1 3 Ikirundi

jun 2007: 1 1 Leta z’Unze Ubumwe za Amerika

jul 2007: 1 1 Ikirundi

ago 2007: 1 1 Bibiliya

set 2007: 1 1 Leta z’Unze Ubumwe za Amerika

out 2007: 1 3 Ikirundi , 2 2 Leta z’Unze Ubumwe za Amerika , 3 1 Bibiliya

nov 2007: 1 1 Republika y'u Burundi

dez 2007: 1 1 Bibiliya

jul 2008: 1 1 Gitega

ago 2008: 1 1 Tanzaniya

set 2008: 1 1 Ubudage

out 2008: 1 3 Google

nov 2008: 1 3 Ubudage , 2 3 Gitega , 3 3 Kiseperanto , 4 3 Interahamwe , 5 3 Uburundi , 6 1 Bibiliya

dez 2008: 1 2 Google

jan 2009: 1 2 Google , 2 2 Ubuhindi , 3 2 Urwanda , 4 1 Yezu Kirisitu

abr 2009: 1 1 Leta z’Unze Ubumwe za Amerika

mai 2009: 1 1 Ubuhindi

nov 2009: 1 2 Pigazzano

dez 2009: 1 1 Pigazzano

jan 2010: 1 1 Bibiliya

fev 2010: 1 1 Lituania

mar 2010: 1 2 Google

abr 2010: 1 3 Rudoviko Rwagasore , 2 2 Ikirundi , 3 2 Ikinyarwanda , 4 1 Bibiliya

mai 2010: 1 4 Ishengero ry'ukuri rya Yesu , 2 1 IProvense ya Bujumbura

jun 2010: 1 1 IProvense ya Bujumbura Mairie

jul 2010: 1 2 Ikigahugahu , 2 2 Imamba , 3 1 Musophaga rossae

ago 2010: 1 1 Imbogo

set 2010: 1 1 Main Page

nov 2010: 1 2 Main Page , 2 1 Tragelaphus scriptus

dez 2010: 1 1 Ibiyayura umutwe

jan 2011: 1 2 Ubudage , 2 1 Bolivia

fev 2011: 1 4 Uburundi , 2 2 Agasumo ka Mwaro , 3 2 Amashule kaminuza , 4 2 Amashule y'isumbuye , 5 2 Kigamba , 6 2 Icongereza ka rurimi rwa kabiri , 7 2 Ikirundi

mar 2011: 1 2 Main Page , 2 1 Inyama

abr 2011: 1 1 Paris

jun 2011: 1 1 IProvense ya Ruyigi

jul 2011: 1 1 Interahamwe

ago 2011: 1 1 Uruguay

out 2011: 1 1 Paltoga

nov 2011: 1 1 Ubugiriki

jan 2012: 1 1 Argentine

fev 2012: 1 2 Anastacia

mar 2012: 1 1 Moshchena

abr 2012: 1 1 Ibitunguru

mai 2012: 1 1 Trpinja

jun 2012: 1 1 Ikaroti

jul 2012: 1 1 Ibibazo N'inyishu

ago 2012: 1 1 Ikirundi

set 2012: 1 1 Ikirundi

out 2012: 1 2 Ibibiriya , 2 1 Amamuko

dez 2012: 1 1 Umubiri

jan 2013: 1 2 Ikigabane ca 1 , 2 1 Ikigabane ca 9

fev 2013: 1 1 Umukoto

mar 2013: 1 1 Noreg

abr 2013: 1 1 Wickiana

mai 2013: 1 1 Uburusiya

jun 2013: 1 1 Uburundi

jul 2013: 1 1 Icongereza ka rurimi rwa kabiri

nov 2013: 1 1 Bufirika

dez 2013: 1 1 Anastacia

jan 2014: 1 1 Rusizi

fev 2014: 1 1 Portugal

mar 2014: 1 2 Ikirundi

abr 2014: 1 2 Norway , 2 1 Noruega

mai 2014: 1 1 Buganda

jun 2014: 1 2 Ronald Reagan , 2 2 Leta z’Unze Ubumwe za Amerika , 3 1 Mabaya

jul 2014: 1 3 Imburu , 2 1 Acampe joiceyana

ago 2014: 1 2 Ubutariyano , 2 1 Acanthopteroctetes bimaculata

set 2014: 1 3 Ingwara iterwa n’umugera wa Ebola , 2 1 Ebola

out 2014: 1 1 Esipanye

dez 2014: 1 1 Deutschland

mar 2015: 1 2 Varsovie , 2 2 Pologne , 3 1 Phyllanthus burundiensis

abr 2015: 1 1 Saint-Marin

mai 2015: 1 1 Ikaroti

jun 2015: 1 1 Sericanthe burundensis

jul 2015: 1 1 Abakuru w'igihugu ca Uburundi

set 2015: 1 1 Brasília

out 2015: 1 1 Kanada

nov 2015: 1 2 Los Angeles , 2 2 Las Vegas , 3 2 Pierre Nkurunziza , 4 2 Varsovie , 5 2 Songa , 6 2 Cibitoke , 7 2 Bubanza , 8 2 Bujumbura , 9 2 Ubutariyano , 10 2 Cankuzo , 11 2 Uburundi , 12 1 Ubudagi

dez 2015: 1 1 Musa acuminata

jan 2016: 1 1 Kizito Mihigo

fev 2016: 1 1 Kizito Mihigo

mar 2016: 1 1 Rio de Janeiro

abr 2016: 1 1 Myanmar

jun 2016: 1 1 Michel Micombero

jul 2016: 1 2 Google

ago 2016: 1 2 Ubugiriki , 2 1 Finilande

set 2016: 1 1 Finilande

out 2016: 1 1 Roseville, Michigan

nov 2016: 1 1 Łobez

dez 2016: 1 3 Michael Jackson

jan 2017: 1 2 Hulk , 2 2 South Tucson

fev 2017: 1 1 Abahutu

mai 2017: 1 2 Ubufaransa , 2 1 Roubaix

jun 2017: 1 1 Łobez

jul 2017: 1 1 Michael Jackson

ago 2017: 1 1 Honduras

set 2017: 1 1 Boliviya

out 2017: 1 1 Garry Marshall

nov 2017: 1 1 John de Lancie

dez 2017: 1 1 Aliço Pehlivan

jan 2018: 1 1 Nevşehir

fev 2018: 1 1 IProvense ya Rumonge

mar 2018: 1 1 Nevşehir

abr 2018: 1 1 Irani

jun 2018: 1 1 Kigandu

ago 2018: 1 1 Los Angeles

set 2018: 1 1 ব্যবহারকারী:Riadul Islam Limon

dez 2018: 1 1 Ikirundi

Wikipedias are initially ordered by number of speakers of the language

Speakers: Number of speakers of a language is the estimated total of primary and secondary speakers, is in many cases a very rough estimation (based on the page on the English Wikipedia about that language)
Regions are parts of the world where the language is spoken in substantial amounts (compared to total number of speakers). Regions where a language gained presence only by a recent diaspora are generally not included.
Region codes: AF:Africa, AS:Asia, EU:Europe, NA:North America, OC:Oceania, SA:South America, W:World Wide, CL:Constructed Language

Estatísticas geradas em Sexta-feira, 1 de fevereiro 2019 08:47 (final run)

Dump file rnwiki-20190101-stub-meta-history.xml.gz (edits only), size 975 kb as gz -> 6.5 Mb
Dump processed till Dec 31, 2018, on server stat1007, ready at Sat-05/01/2019-16:12 after 6 sec.

Autor:Erik Zachte (2002-Jan 2019) (Sítio web)
Endereço:erikzachte@### (no spam: ### = infodisiac.com)
Documentation / Scripts / CSV files: About WikiStats

You can download the English version of these reports here (also download common_files.zip)
You can download aggregated data here

All data and images on this page are in the public domain.