Estatísticas da Wikipédia inglês simplificado

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Articles per size range / Records per namespace / Most edited articles / Zeitgeist
 
Jan 31, 2019: This is the final release of Wikistats-1 dump-based reports. Part of these data are available in the first release of Wikistats 2. Read more here

 

Most metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.

Some metrics have been collected from the full archive dump which runs on lower frequency than the usual monthly cycle.
These metrics are columns F,I,J,K,M,N,O,P,Q,R from the first table.


See also metrics definitions


 
Monthly counts & Quarterly rankings: dezembro 2018
 
DataWikipedistasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
dez 20180% +9% +1% +19%    +2%      0%
nov 20180% +14% +1% -19%    +18%      0%
out 20180% -5% +1% -35%    -15%      0%
set 20180% -17% +1% +20%    -7%      +1%
ago 2018+1% +8% +1% 0%    +4%      +1%
jul 2018+1% -15% +1% +64%    -31%      +1%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P____Q____R____S__
dez 201865432514625142 k 3128,9   18 k      56 k
nov 201865182313419141 k 2628,9   18 k      56 k
out 201864953011816140 k 3229   15 k      56 k
set 201864651912413139 k 4929,1   18 k      56 k
ago 201864464615016138 k 4129,2   20 k      55 k
jul 201864004213918136 k 4129,4   19 k      55 k
jun 201863585116420135 k 2529,5   28 k      55 k
mai 201863074616519134 k 3129,5   26 k      54 k
abr 201862614016120133 k 2529,5   25 k      54 k
mar 201862214717021133 k 2529,4   22 k      54 k
fev 201861743715824132 k 2529,4   19 k      53 k
jan 201861374317423131 k 2729,5   23 k      53 k
dez 201760943314019130 k 2529,5   16 k      53 k
nov 201760613714221130 k 2329,5   21 k      53 k
out 201760245515726129 k 2329,5   20 k      52 k
set 201759693413018128 k 2729,5   16 k      52 k
ago 201759352712112127 k 2029,6   25 k      52 k
jul 201759083313316127 k 3129,5   14 k      52 k
jun 201758753711816126 k 2729,6   15 k      52 k
mai 201758383212713125 k 1929,7   14 k      51 k
abr 201758063111413125 k 2029,7   13 k      51 k
mar 201757753813219124 k 1729,8   19 k      51 k
fev 201757372811316123 k 2229,8   18 k      51 k
jan 201757093412717123 k 2529,8   17 k      51 k
dez 20165675158814122 k 1229,8   10 k      50 k
nov 201656602410216122 k 1229,8   13 k      50 k
out 201656363211015121 k 1029,8   15 k      50 k
set 20165604158915121 k 1329,8   11 k      50 k
ago 201655892910314121 k 1129,8   10 k      50 k
jul 201655602710416120 k 2429,8   14 k      50 k
jun 20165533229812119 k 1429,8   11 k      49 k
mai 201655112611120119 k 1829,8   15 k      49 k
abr 201654851810419118 k 1429,9   13 k      49 k
mar 201654673313215118 k 1529,8   14 k      49 k
fev 201654343114318118 k 1829,8   17 k      49 k
jan 201654032812622117 k 2329,8   15 k      48 k
dez 201553752712916116 k 1329,9   13 k      48 k
nov 201553482812515116 k 1629,9   13 k      48 k
out 201553201811818115 k 1529,9   14 k      48 k
set 201553022511417115 k 1529,9   12 k      48 k
ago 201552774211517115 k 1829,9   13 k      47 k
jul 201552352511012114 k 1529,9   11 k      47 k
jun 201552102913015114 k 1829,9   14 k      47 k
mai 201551813215218113 k 1830   15 k      47 k
abr 201551492612514112 k 1630   13 k      46 k
mar 201551233915713112 k 2230   24 k      46 k
fev 201550843213014111 k 2730   16 k      46 k
jan 201550522814017111 k 3630   20 k      45 k
dez 201450243110914109 k 2530,1   14 k      45 k
nov 201449933212219109 k 2630,2   15 k      44 k
out 201449612812020108 k 2330,3   17 k      44 k
set 201449333311222107 k 2430,4   19 k      44 k
ago 20144900249821106 k 3030,4   14 k      44 k
jul 201448762711317105 k 2930,5   13 k      43 k
jun 201448493312517105 k 3130,7   14 k      43 k
mai 201448163012418104 k 2230,8   13 k      43 k
abr 201447863811819103 k 3430,9   16 k      42 k
mar 201447482412222102 k 3031   19 k      42 k
fev 201447243411921101 k90 k3331,1200571%25%21 k252 Mb30,5 M1,8 M5,0 k58 k201 k42 k
jan 201446903013822100 k89 k2831,2200671%25%20 k250 Mb30,2 M1,8 M4,9 k57 k198 k41 k
dez 20134660561702899 k88 k3431,3200471%25%18 k248 Mb30,0 M1,8 M5,6 k58 k195 k41 k
nov 20134604401332698 k87 k3831,4199871%25%32 k245 Mb29,5 M1,8 M5,6 k58 k192 k40 k
out 20134564221062397 k86 k1731,5199670%24%18 k241 Mb29,2 M1,8 M5,7 k57 k189 k40 k
set 2013454221972196 k85 k1831,5199270%24%18 k240 Mb29,0 M1,8 M5,7 k57 k187 k40 k
ago 20134521221102096 k85 k2331,4198770%24%18 k238 Mb28,8 M1,8 M6,2 k57 k186 k39 k
jul 20134499281222995 k84 k6331,5198370%24%26 k236 Mb28,6 M1,8 M15 k56 k184 k39 k
jun 20134471211292893 k83 k3731,9198971%24%28 k233 Mb28,2 M1,7 M25 k54 k180 k38 k
mai 20134450471762892 k82 k3632198571%24%28 k230 Mb27,8 M1,7 M27 k54 k178 k38 k
abr 20134403431382291 k81 k2332197871%24%31 k226 Mb27,4 M1,7 M29 k53 k174 k37 k
mar 20134360391462490 k80 k3331,9197271%24%123 k225 Mb27,1 M1,7 M77 k52 k172 k37 k
fev 20134321421531989 k79 k3030,9196871%24%42 k274 Mb26,7 M1,7 M2,2 M52 k169 k37 k
jan 20134279681952488 k78 k5530,8196470%24%47 k270 Mb26,5 M1,6 M2,2 M51 k167 k36 k
dez 20124211682072487 k77 k3030,8197771%24%44 k266 Mb26,1 M1,6 M2,2 M51 k163 k36 k
nov 20124143371622286 k76 k2530,6195971%24%36 k261 Mb25,6 M1,6 M2,1 M49 k160 k36 k
out 20124106291401885 k75 k2930,5194970%24%40 k257 Mb25,2 M1,6 M2,1 M48 k157 k35 k
set 20124077431312184 k74 k3130,3193970%24%37 k253 Mb24,9 M1,6 M2,1 M47 k154 k35 k
ago 20124034361362183 k73 k3230,2192570%24%40 k249 Mb24,5 M1,5 M2,1 M46 k151 k35 k
jul 20123998441472382 k72 k3730,1191469%24%42 k244 Mb24,1 M1,5 M2,0 M45 k148 k34 k
jun 20123954701832181 k71 k3030190069%23%53 k239 Mb23,6 M1,5 M2,0 M45 k143 k34 k
mai 20123884431651980 k70 k3729,7188269%23%55 k234 Mb23,1 M1,5 M2,0 M43 k139 k33 k
abr 20123841371502279 k69 k4329,4187268%23%63 k229 Mb22,6 M1,5 M1,9 M42 k135 k33 k
mar 20123804451652678 k67 k3829,1185068%23%54 k223 Mb22,1 M1,4 M1,9 M42 k131 k32 k
fev 20123759411602377 k66 k3228,9182367%22%46 k216 Mb21,5 M1,4 M1,8 M41 k126 k31 k
jan 20123718451852076 k65 k2228,6181067%22%40 k212 Mb21,1 M1,4 M1,8 M40 k123 k31 k
dez 20113673421481975 k64 k2628,3179567%22%36 k208 Mb20,7 M1,4 M1,8 M40 k120 k31 k
nov 20113631411532174 k64 k2728,2178166%22%38 k204 Mb20,3 M1,3 M1,8 M39 k116 k30 k
out 20113590261421973 k63 k1828177366%21%36 k201 Mb20,0 M1,3 M1,7 M38 k113 k30 k
set 20113564371271573 k62 k1827,7176566%21%46 k199 Mb19,8 M1,3 M1,7 M38 k111 k30 k
ago 20113527341551972 k62 k1427,2175466%21%40 k196 Mb19,5 M1,3 M1,7 M37 k110 k29 k
jul 20113493431501672 k61 k2026,9174366%21%34 k194 Mb19,3 M1,2 M1,7 M37 k108 k29 k
jun 20113450431722071 k60 k2826,6172465%21%34 k190 Mb18,9 M1,2 M1,7 M36 k106 k29 k
mai 20113407481632070 k60 k2926,4171265%21%34 k187 Mb18,6 M1,2 M1,6 M36 k104 k28 k
abr 20113359431542569 k59 k2726,3169765%21%43 k183 Mb18,2 M1,2 M1,6 M35 k102 k28 k
mar 20113316461682669 k58 k2926168665%20%36 k179 Mb17,9 M1,2 M1,6 M35 k100 k28 k
fev 20113270321572168 k57 k3025,8167565%20%30 k176 Mb17,5 M1,1 M1,6 M34 k97 k27 k
jan 20113238371672367 k56 k2425,6166765%20%35 k173 Mb17,2 M1,1 M1,5 M33 k95 k27 k
dez 20103201621851566 k55 k2325,4166264%20%30 k170 Mb17,0 M1,1 M1,5 M32 k93 k27 k
nov 20103139431511965 k55 k2125,2165464%20%31 k168 Mb16,7 M1,1 M1,5 M32 k92 k26 k
out 20103096481601965 k54 k2125164664%20%28 k165 Mb16,5 M1,1 M1,5 M31 k90 k26 k
set 20103048341251764 k53 k1724,8163164%20%30 k162 Mb16,1 M1,1 M1,5 M31 k89 k25 k
ago 20103014381401964 k53 k3724,6161164%20%41 k159 Mb15,8 M1,1 M1,4 M30 k87 k25 k
jul 20102976421401762 k52 k1524,3158763%19%29 k154 Mb15,3 M1,0 M1,4 M30 k83 k25 k
jun 20102934411482162 k51 k3324,1157863%19%36 k152 Mb15,1 M1,0 M1,4 M29 k82 k24 k
mai 20102893381522161 k50 k3423,9157063%19%40 k149 Mb14,8 M1,0 M1,4 M29 k80 k24 k
abr 20102855551872060 k49 k3423,6155162%19%40 k145 Mb14,3 M986 k1,3 M28 k78 k24 k
mar 20102800501933559 k48 k2123,4153561%19%39 k141 Mb13,9 M965 k1,3 M27 k75 k23 k
fev 20102750481502758 k48 k1622,9152061%19%33 k139 Mb13,6 M951 k1,3 M26 k73 k23 k
jan 20102702561892758 k47 k2922,6150861%18%35 k136 Mb13,4 M941 k1,3 M26 k72 k22 k
dez 20092646391532157 k46 k2222,3148961%18%31 k133 Mb13,0 M917 k1,3 M25 k70 k22 k
nov 20092607521602456 k46 k3022147660%18%30 k131 Mb12,7 M922 k1,2 M25 k69 k22 k
out 20092555491742055 k45 k3121,8146860%18%29 k128 Mb12,4 M906 k1,2 M24 k67 k21 k
set 20092506391562354 k44 k2921,7146160%18%29 k125 Mb12,2 M889 k1,2 M24 k66 k20 k
ago 20092467541591854 k43 k2921,5145059%18%31 k122 Mb11,9 M868 k1,2 M23 k65 k19 k
jul 20092413451661653 k42 k2221,3143858%17%35 k119 Mb11,6 M851 k1,1 M23 k63 k19 k
jun 20092368601951752 k41 k1820,9143058%17%27 k117 Mb11,4 M836 k1,1 M22 k62 k18 k
mai 20092308492022351 k40 k2820,6141658%17%36 k114 Mb11,2 M827 k1,1 M22 k61 k18 k
abr 20092259531972551 k40 k3720,2140657%17%31 k111 Mb10,9 M806 k1,1 M22 k60 k18 k
mar 20092206721982849 k39 k3520140057%17%38 k108 Mb10,6 M784 k1,1 M21 k59 k17 k
fev 20092134712172548 k37 k3419,7139156%17%34 k105 Mb10,3 M765 k1,0 M21 k57 k17 k
jan 20092063672122547 k36 k24719,4137856%17%47 k102 Mb10,0 M745 k1,0 M20 k55 k16 k
dez 20081996692022040 k35 k9321,9155163%19%42 k95 Mb9,5 M687 k916 k19 k53 k16 k
nov 20081927511882637 k34 k4222,5160766%20%35 k91 Mb9,1 M656 k886 k18 k51 k16 k
out 20081876511992536 k33 k4622,3160366%20%32 k88 Mb8,8 M635 k862 k18 k49 k15 k
set 20081825541672534 k31 k4722,3160165%19%30 k84 Mb8,4 M607 k829 k17 k47 k14 k
ago 20081771591742533 k30 k4522,4160466%19%32 k81 Mb8,1 M584 k804 k16 k45 k14 k
jul 20081712631832831 k29 k6922,3161166%19%37 k77 Mb7,8 M563 k777 k16 k43 k13 k
jun 20081649541632629 k27 k4222,7162568%20%34 k73 Mb7,3 M529 k735 k15 k39 k13 k
mai 20081595511522428 k26 k3322,5159967%19%32 k68 Mb6,9 M499 k706 k14 k36 k12 k
abr 20081544471302027 k25 k3122,2160067%19%27 k66 Mb6,6 M480 k679 k13 k35 k11 k
mar 20081497461502326 k24 k2622159467%19%26 k63 Mb6,4 M461 k658 k13 k33 k11 k
fev 20081451541541925 k23 k4021,7156967%19%30 k60 Mb6,1 M443 k640 k12 k31 k10 k
jan 20081397461342024 k22 k3421,5155766%19%32 k57 Mb5,7 M418 k618 k12 k29 k9,8 k
dez 20071351531391823 k21 k6221,1152765%18%33 k54 Mb5,4 M390 k588 k11 k27 k9,3 k
nov 20071298391171721 k19 k2721,5147863%18%26 k48 Mb4,8 M345 k554 k10 k23 k8,8 k
out 20071259371161620 k18 k2021146862%18%25 k46 Mb4,6 M330 k530 k9,7 k21 k8,5 k
set 20071222341131720 k18 k2120,4144061%17%22 k44 Mb4,4 M315 k509 k9,3 k20 k8,2 k
ago 20071188441331819 k17 k3819,9142460%17%22 k42 Mb4,2 M302 k492 k8,9 k18 k7,8 k
jul 20071144381271818 k16 k3120138959%17%17 k38 Mb3,9 M278 k459 k8,2 k15 k7,2 k
jun 20071106601431517 k15 k2020,1139159%17%19 k36 Mb3,7 M265 k440 k7,7 k14 k6,9 k
mai 20071046521401516 k14 k1919,7136658%16%27 k34 Mb3,5 M251 k422 k7,3 k13 k6,5 k
abr 2007994431031616 k14 k2218,6134258%16%20 k33 Mb3,3 M238 k402 k6,9 k11 k6,3 k
mar 2007951391221315 k13 k1918,1131857%16%23 k31 Mb3,1 M224 k383 k6,5 k10 k6,0 k
fev 2007912411331214 k12 k2217,3127455%15%17 k29 Mb2,9 M206 k364 k5,9 k8,8 k5,7 k
jan 2007871591481114 k12 k2516,9123154%14%20 k27 Mb2,7 M191 k346 k5,3 k7,8 k5,4 k
dez 2006812571421313 k11 k2416,3119952%14%21 k24 Mb2,5 M175 k324 k4,8 k6,4 k5,1 k
nov 2006755561271712 k10 k2115,7117851%14%20 k22 Mb2,3 M160 k300 k4,4 k5,3 k4,8 k
out 2006699461181512 k9,5 k2114,8118651%14%15 k21 Mb2,2 M149 k273 k4,0 k4,9 k4,6 k
set 200665337901411 k9,0 k1514,3117750%13%11 k20 Mb2,0 M140 k245 k3,6 k4,5 k4,2 k
ago 2006616481201311 k8,6 k1913,8116350%13%13 k19 Mb1,9 M131 k236 k3,2 k4,1 k3,9 k
jul 20065683492710,0 k8,1 k2113,4115450%13%11 k17 Mb1,8 M123 k209 k2,9 k3,6 k3,5 k
jun 2006534206479,4 k7,5 k1813115749%13%11 k16 Mb1,7 M115 k194 k2,6 k3,4 k3,1 k
mai 2006514549978,8 k7,1 k1712,5115949%13%12 k15 Mb1,6 M109 k183 k2,3 k3,7 k2,8 k
abr 2006460346888,3 k6,6 k1511,9116248%14%10 k14 Mb1,5 M102 k169 k2,3 k3,4 k2,5 k
mar 2006426377077,8 k6,2 k1211,3115648%13%9,8 k13 Mb1,4 M95 k157 k2,0 k3,0 k2,2 k
fev 2006389195167,5 k5,9 k2010,6115347%13%8,5 k12 Mb1,3 M90 k136 k1,8 k2,8 k2,0 k
jan 2006370266586,9 k5,3 k2810,2117647%14%11 k12 Mb1,2 M84 k127 k1,4 k2,5 k1,7 k
dez 2005344346766,0 k4,6 k159,9121746%14%6,8 k10 Mb1,1 M73 k106 k1,2 k2,2 k1,4 k
nov 2005310254755,6 k4,2 k109,5122246%15%5,6 k9,5 Mb1,0 M68 k100 k1,1 k2,0 k1,2 k
out 2005285234545,3 k4,0 k109124046%15%3,9 k9,1 Mb982 k65 k93 k1,0 k2,0 k1,1 k
set 2005262113035,0 k3,7 k48,8121246%14%3,6 k8,5 Mb908 k60 k89 k8911,9 k1,0 k
ago 2005251154264,8 k3,6 k128,3119346%14%4,2 k8,0 Mb873 k59 k76 k8341,9 k1,0 k
jul 2005236284644,4 k3,2 k108118145%14%4,8 k7,2 Mb783 k54 k70 k5801,7 k912
jun 2005208183754,1 k2,9 k147,5114044%13%4,2 k6,2 Mb703 k49 k42 k5061,6 k841
mai 2005190153133,7 k2,6 k167,2104742%11%2,8 k5,1 Mb592 k44 k32 k4451,5 k760
abr 200517592823,2 k2,4 k77,4109844%11%1,8 k4,6 Mb541 k41 k28 k3941,4 k677
mar 2005166133613,0 k2,2 k77,3107344%11%1,5 k4,2 Mb500 k37 k26 k348870654
fev 200515382132,8 k2,1 k87,3108645%11%2,2 k3,9 Mb465 k35 k25 k293817604
jan 2005145122422,6 k1,9 k107,1112746%11%1,4 k3,7 Mb440 k34 k21 k267794554
dez 200413382032,3 k1,8 k57,5116348%12%1,5 k3,4 Mb408 k31 k20 k245740512
nov 2004125132512,1 k1,7 k47,3115548%12%1,3 k3,2 Mb382 k29 k20 k221647466
out 2004112716 2,0 k1,5 k37,1111846%12%1,1 k3,0 Mb346 k27 k18 k203613421
set 200410592131,9 k1,5 k76,9107945%11%1,2 k2,7 Mb318 k25 k17 k180533405
ago 20049671631,7 k1,3 k46,9113148%12%1,4 k2,6 Mb302 k24 k15 k157515361
jul 20048982211,6 k1,3 k36,7117249%12%1,0 k2,5 Mb289 k22 k14 k141474347
jun 200481132521,5 k1,2 k56,4113447%12%2,4 k2,2 Mb263 k21 k13 k115460333
mai 20046872221,3 k1,0 k95,3106447%11%1,5 k1,9 Mb225 k18 k10 k101314310
abr 200461152521,1 k82365,295849%10%1,3 k1,2 Mb162 k14 k7,1 k82257287
mar 2004461416186267754,997551%11%9641020 kb134 k11 k4,9 k37192257
fev 200432817 71458134,6102154%11%610848 kb115 k9,3 k2,9 k22250233
jan 200424312 62350924,3104453%11%463722 kb103 k8,5 k1,2 k11231227
dez 200321513157046833,8102755%11%697641 kb93 k7,8 k6956213200
nov 20031646148439543,1110758%13%403558 kb84 k7,0 k201616684
out 20031256 35729053,1119661%13%518443 kb66 k5,3 k153610367
set 2003715 19215023111658%11%138217 kb31 k2,2 k10556220
ago 2003612 1389913,2107448%11%99149 kb20 k1,4 k8943716
jul 2003512 946313,6101841%11%6697 kb12 k898641188
jun 2003411 6549 4,2120951%14%3284 kb10 k714641185
mai 2003311 6046 4126353%15%5581 kb10 k693641174
abr 20032   5543 3,3122256%13%1672 kb9,0 k644521144
mar 2003211 513913,390955%10%4250 kb6,4 k542391113
fev 20031   2622 4,8128869%15%2235 kb4,5 k26271112
jan 20031   2321 4,5116274%9%828 kb3,8 k2352 112
dez 20021   2119 4,5104971%5%823 kb3,0 k2292 112
nov 20021   1917 4,6105663%5%521 kb2,7 k1832 112
out 20021   1716 4,8110771%6%1021 kb2,7 k1802 92
set 20021   1514 4,8114767%7%1619 kb2,4 k1451192
ago 20021   1313 4,3113769%8%818 kb2,2 k150 192
jul 20021   1212 4107467%8%116 kb2,0 k139 192
jun 20021   1212 3,9107367%8%416 kb2,0 k139  92
mai 20021   1111 3,998564%9%714 kb1,7 k137  62
abr 20021   1010 3,6103960%10%613 kb1,6 k133  62
mar 20021   88 3,887875% 29,2 kb1,1 k80  62
fev 20021 1 88 3,583475% 78,9 kb1,1 k73  62
jan 20021   77 376771%  7,5 kb86164  42
dez 20011   77 376771%  7,5 kb86164  42
nov 20011   77 376771% 37,5 kb86164  42
out 20011 1 77 2,670071% 127,0 kb79259  42
set 20011   33 278167% 12,4 kb38925  1 
ago 20011   22 2,51026100% 12,1 kb33816  1 
jul 20011   22 21026100%  2,1 kb33816  1 
jun 20011   22 21026100% 32,1 kb33816  1 
mai 200111  11 1924100% 1970 14711  1 
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
The following table ranks this project in relation to projects in other languages with 1000+ articles
out 20183336404351 3652   44      278
jul 20183329354452 3450   42      278
abr 20183333364052 4450   34      278
jan 20183335363951 4050   40      278
out 20173228353551 4550   44      278
jul 20173235364651 4148   48      278
abr 20173237395152 5447   47      278
jan 20173236374852 4348   46      278
out 20163233384852 7148   43      278
jul 20163237394251 4950   45      278
abr 20163245413751 5950   44      278
jan 20163240383950 4948   45      278
out 20153242364349 5848   48      278
jul 20153237385149 5553   50      278
abr 20153138404849 5355   48      278
jan 20153140364349 3556   39      278
out 20143134363849 4958   43      278
jul 20143134353849 4157   46      278
abr 20143135393849 4457   42      278
jan 2014313938394949435665926439524444804043278
out 2013313838364650545464966438534444774044278
jul 2013313433334548305665946333514444534042278
abr 2013313434374547515363906342514445364041277
jan 2013312932364445336063896338474242383938277
out 2012313633424444456163906042474241374038277
jul 2012313134384444396063905941474141364139277
abr 2012313534364445306464896127474241364139277
jan 2012313534424445546166926337494241374139277
out 2011313934424446556369876840494041364039277
jul 2011313233434245586670866739474042364038277
abr 2011313133334344516572836538474042364039277
jan 2011293636384143536674816841463941353738277
out 2010292932364042506973786738463840353738277
jul 2010293234414042526775816838443840353936277
abr 2010283130373942436675826540443840343936277
jan 2010283034353942446479837035444041334037277
out 2009273133373842376881857036434040344137277
jul 2009273133413842506477867335424039344137277
abr 2009263230353742406475886839424039343935277
jan 2009272629363843106474906729424039333935276
out 2008272927354444283353585136434140354235274
jul 2008272530344443242749534831434140364236273
abr 2008272835364544381747524435454240384536273
jan 2008263036384544371650514433464240384438269
out 2007253336394745491252574740484441384643267
jul 2007253034374745431051584140484442394843262
abr 2007243037394443521351554038474242414744257
jan 2007222430434544461554574937464343394846254
out 2006232431384545471655564739474444404949251
jul 2006222734484546461857595041464244404950238
abr 2006232534404344472050534136464343394847233
jan 2006232733434243362146503934464243434846215
out 2005212432444143542839463443454142424843213
jul 2005201825413838433335392838433937425140202
abr 2005212931493939462734363841424035465131195
jan 2005192226384040372222252943423332404637191
out 2004192529563835451619182038363129354033189
jul 2004182221443533431412131635333027313831160
abr 2004181317303535311416111531403024303736143
jan 2004191917353231372828282835372823383630127
out 2003201119222726192020202018272422352230101
jul 200324282421303025151515152933312931303788
abr 200326272714262625131313132727272321192471
jan 20033021201121201899992523212127152159
out 200222161491715118888191717151591644
jul 200217910715148888816141414741435
abr 200217810614128777712141212441320
jan 200216912514129333317131213221018
out 2001139102111082222101110921813
jul 20018442874222267552158
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
 WikipedistasArtigosBase de dadosLigações

Nota: os valores para os primeiros meses estão muito baixos. O histórico de revisões nem sempre era preservado nos primeiros tempos.

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikipedistas (usuários registrados)
A = Wikipedistas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikipedistas que editaram pelo menos dez vezes desde que chegaram
C = Wikipedistas que contribuíram cinco vezes ou mais este mês
D = Wikipedistas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Artigos que contêm pelo menos uma ligação interna e 200 caracteres de texto legível, não contando códigos wiki e html,
      ligações ocultas, etc.; títulos também não contam (outras colunas são baseadas no método oficial de contagem)
G = Novos artigos por dia no mês passado
H = Número médio de revisões por artigo
I = Tamanho médio dos artigos em bytes
J = Porcentagem de artigos com pelo menos 0,5 kb de texto legível (veja F)
K = Porcentagem de artigos com pelo menos 2 kb de texto legível (veja F)

Base de dados
L = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
M = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
N = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
O = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
P = Total de ligações para outras wikipédias
Q = Total de imagens apresentadas
R = Total de ligações para outros sítios
S = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  2500  10000  5  10  100  1000  10000  1  3  5  10  25  100  250  1000  2500  5  10  100  1000  10000  1  3  5  10  25  100  250  1000  2500  5  10  100  1000  10000 
dez 201871222414683442592  442  172735234188111331  2409059381862  8621 
nov 2018730221134704019123  731  1727752352072  321  2789556352084  7621 
out 201875520911864321671  542  1745738231263  221  2627853271261  872  
set 2018673199124633213104  842  1646139191253  221  2548758321884  652  
ago 2018627213150914516114  772  1506037231332  331  2648648302284  651  
jul 2018631220139884318104  862  1436239241342  331  27385533114631 961  
jun 201872523816410146201232 7741 2158956362072  331  3171228449191052 751  
mai 20187702771659549191332 651  1928053272073  3311 2741096940237411651  
abr 20187872581618645201031 8721 2017751281573  332  309109614121721 982  
mar 2018836269170945021931 774  2177755392494  431  34910771442364  872  
fev 20187372391589754249   884  19092714326112  431  31110065392043  862  
jan 2018761253174995923631 772  18272523320135  2211 356106643620541 653  
dez 201764420914085471982  963  1466450352361  22   31110169372282  972  
nov 2017719230142875021931 77   1717956362062  33   355113713618541 872  
out 2017765221157101572662  7621 1797048382581  431  358119784725521 873  
set 201767420713075391862  651  1436045331581  64   2758251311732  652  
ago 201757417612169391242  86211147543727165   33   2688260301742  762  
jul 201759420013375341672  441  137614225186   331  27810960322083  772  
jun 201761017211873451651  321  1377347271671  431  2789971441752  872  
mai 201767819912770361351  541  1687144271674  331  2748959361531  862  
abr 201761518711465361342  422  1678052271552  441  288110724417321 882  
mar 2017698208132844319721 661  14460473323113  331  31290603516421 772  
fev 2017636189113704116921 652  1615841302184  331  27692583721531 882  
jan 2017649201127653317102  641  1595545281864  431  28898683518941 872  
out 201875520911864321671  542  1745738231263  221  2627853271261  872  
jul 2018631220139884318104  862  1436239241342  331  27385533114631 961  
abr 20187872581618645201031 8721 2017751281573  332  309109614121721 982  
jan 2018761253174995923631 772  18272523320135  2211 356106643620541 653  
out 2017765221157101572662  7621 1797048382581  431  358119784725521 873  
jul 201759420013375341672  441  137614225186   331  27810960322083  772  
abr 201761518711465361342  422  1678052271552  441  288110724417321 882  
jan 2017649201127653317102  641  1595545281864  431  28898683518941 872  
out 2016551166110713715711 641  1446244321992  331  283106794419311 861  
jul 2016512164104502616112  542  1505740231641  331  24698633517421 651  
abr 20166101831047041197   631  1676549362251  431  31312189552142  761  
jan 2016603196126814622111  551  15871583524102  331  28610470432431  761  
out 20155871841186334187   651  13354393221123  331  2598756362342  541  
jul 20155161541106537126   441  1125337201452  32   214795231142   44   
abr 201555020212565341482  532  1475743281573  44322246925832172   4421 
jan 20156282231406940171041 33   1436552402473  331  27810362401931  431  
out 201453918912067422093  31   12956442619102  22   264876039173   331  
jul 201450216611359341781  33   104463321125   22   2319360311552  441  
abr 2014527176118774919103  32   1205735291952  22   24898673918321 221  
jan 20145692071387840221021 551  15066563925115  33   31911782492885  431  
out 2013503176106704723102  331  10954423424128  44   2558662372383  531  
jul 20134951821227547291652 1091  1356957412372  221  271114794930921 9831 
abr 20135832191388951221421 8852 14860503525103  22   293116884924531 8742 
jan 20137172721951185424144  3935226 16572493521102  22   35314490371962  2322123 
out 2012614203140925018132  4539186 1716252382482  21   34310965471651  292681 
jul 2012594222147915023114  4844216 1546348351873  21   332100563414221 2926122 
abr 201268023615087472217104 4845224 1777859362475  11   3831571064920631 2924112 
jan 20127742751851075420123  4946234 2128363412494  11   45014797511972  292311  
out 2011609205142905519113  4743285 1547963422582  31   398132845029631 3328154 
jul 20116262291509345161021 4739257 140675138254   21   39113287542351  24207  
abr 2011690230154855225122  4342196 1707459452764  21   44414896583373  2621101 
jan 201174226516799552371  5547224 2179572493182  32   51818011870312   2824122 
out 201069424016010054196   4844176 15571554130113  221  416147108714361  3932101 
jul 20106912331408850176   5847225 17386624635146  321  4741721086740144  282372 
abr 20108412791871145720132  4945244 20582624833157  11   501178116633781  232183 
jan 201084529118911072271411 4641244 20195755338135  11   5511821287346142  262261 
out 200976825917492562091  5048275 21388624127133  11   530184119693382  252381 
jul 200970424516690481682  5251335 16280563926105  31   5081731096833115  23197  
abr 200986230319711354258   4843285 205103715027121  11   5522071298542132  282391 
jan 200984130921212561251021 5044348 18580614833124  541  5762161266736195  3228102 
out 200879729319911668259   4841254 20697715233111  111  5811921287638153  191583 
jul 20086922571831116328152  4341256 18383664526103       6402151338349158  231682 
abr 200859720913084512091  3127193 16371533829113  11   504185121663892  141351 
jan 20086282171347549201031 2619125 154815739251371      5201781067129125  13831 
out 200754018411671341681  1919114 98523421154        50316999532582  12115  
jul 20075071811277641188   2220132 1105947301441       499159106571962  11102  
abr 200756117210365351651  2320103 97462618115   21   5201749558257   10632 
jan 200760722914885451161  111062 1164230231021       492179114702052  5411 
out 20065351661186732157   11931 109442919135   111  4601499349203   31   
jul 200641614092523072   10731 89302315721       436141813211    22   
abr 200645012368371582   6331 7025171092        3511246639142        
jan 200633799653418851  543  531813841        302115592992   1    
out 20052387145221042   331  401611821        22464371951        
jul 20052066646261242   885  36161282         196734114311  32   
abr 2005185472813621   21   18932          137401763         
jan 200512233241352         22131194    1    78231472         
out 200492311694    211  12211          4313732         
jul 20049431221361    111  1644      1    471573     11   
abr 200485302516102    211  268542         58171251         
jan 200440181261         104311         1811631         
out 20032611652         74443         53211         
jul 200311221          1             4             
abr 200310                                        
jan 200351                         2             
out 200261                                       
jul 20021                          1             
abr 20025                          1             
jan 2002                                         
out 2001311                         1             
jul 2001                                         

 

Distribuição de edições de artigos por wikipedistas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikipedistasEdições total
157,637100.0%1,898,837100.0%
315,23226.4%1,836,71896.7%
106,54211.4%1,787,75794.2%
322,3744.1%1,718,90590.5%
1001,0021.7%1,644,94986.6%
3164590.8%1,552,55881.8%
10002070.4%1,411,17374.3%
3162890.2%1,195,59463.0%
10000250.0%866,02945.6%
3162380.0%568,76030.0%
10000010.0%140,8297.4%

 

50 wikipedistas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdições 
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
 agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
Auntof6UC1 0140,82954567,886438ago 18, 20083786218---
DjsassoUC2 086,8052,41237,0339,834dez 10, 200451333655--
TDKR Chicago 101UC3 077,4091,0139,15926jul 23, 2012235115,135290--
OsirisUC4 070,096229,054-set 28, 20093380484---
Macdonald-rossUC5 066,02425820,882118set 04, 200934042,7224--
Jim MichaelUC7 038,5391058,90955fev 20, 20103235345---
EptalonUC8 036,0393214,19540dez 20, 200547583,7086--
Ricky81682UC9 030,75931315,018138mai 11, 20054981287---
PeterdownunderUC10 024,5681516,36933mai 25, 20083871668---
Jim.hendersonUC16 015,8572182053fev 06, 2008398023---
ChenzwUC21 014,173416,4484mar 10, 20074313110---
BRPeverUC28+38,0542397,459277jan 23, 201610729416--
GotandaUC32+17,5252241,81334set 19, 2010302440051--
September 1988UC33+17,362703,01317ago 04, 201030704,01716--
EurodyneUC38 06,96133,4853ago 21, 2014159265---
Operator873UC57+34,7002473,429306jun 11, 2018202151--
OnlyUC59 04,6671256,762183dez 27, 2006438664---
ThrasymedesUC61 04,29731,189-set 19, 20103024137---
EnfcerUC62+14,269515,99925set 29, 201319188---
CrasstunUC63-14,26117,3431dez 27, 2013182938---
Gay Yong HernandezUC72+153,807462424out 19, 201680213---
J991UC74-13,768386,67835dez 25, 20112562----
Clarkcj12UC82 03,499102,7031nov 07, 2009334078---
AlicezeppelinUC90+13,12822257-jul 08, 201416364571--
VermontUC99+42,7551674,651227nov 27, 201739821--
MentifistoUC102 02,60141,534-jan 17, 2008400032---
NunabasUC109+52,42812022721fev 04, 20151425----
Some Gadget GeekUC110+12,41691,5853fev 01, 2015142820---
Davey2010UC113-12,402211,92614dez 21, 20131835132---
K6kaUC114+12,330242,84020abr 21, 20141714----
Dale ArnettUC132 02,0522218-out 16, 200355547---
HiànUC133+162,0122452,647170jul 25, 201752329---
Bsadowski1UC139 01,89172,35112jan 10, 200936419---
Jared837UC140+21,891502,82376dez 18, 2017377----
Icem4kUC143-21,857114917mar 09, 201829658---
GrunnyUC145-11,81841,3042mar 08, 201032197---
DeborahjayUC150+251,752365629106jun 14, 200742171---
ShakespeareFan00UC156+371,63548976749ago 11, 20064524----
ONaNcleUC175-21,3961429-mai 12, 200742509---
Rubbish computerUC177+61,35413594037dez 16, 201414759---
Jianhui67UC179-11,28611,539-set 11, 201319361---
StevenJ81UC183-21,27513,05915mar 01, 2013213013---
MiloDennUC185 01,20241,3628dez 22, 2016738119---
BossanovenUC196+121,1121348412fev 01, 2014179324---
LilyKittyUC205+11,0221636-jul 20, 2010308532---
Daniel \"Danny\" LorraineUC211+1996716322220jun 16, 2018197----
Ma'azUC216-19286222-dez 27, 201736850---
OttawahitechUC222+3188815737853dez 06, 20112581302--
DaneGeldUC246+177241,3631fev 03, 201769515---
BigrTexUC251+17612220-jul 10, 2007419119---

 

20 wikipedistas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
  Primeira ediçãoúltima edição
 posiçãototaldatadias
atrás
datadias
atrás
CreolUC653,019out 19, 20064455jul 28, 20151251
Rus793UC1122,532mar 10, 20132121fev 21, 2017677
WwikixUC1220,737jan 06, 2017723jan 30, 2018334
BarlinerUC1320,148jul 23, 20074178jul 01, 20112739
KolbertBotUC1419,903ago 21, 2017496jul 03, 2018180
RazorflameUC1518,359nov 23, 20074055jul 19, 20131990
Oregonian2012UC1715,478fev 12, 20122513out 20, 20131897
KingRaven44UC1815,031out 17, 20093361mar 09, 20161026
Nameless User~simplewikiUC1914,986ago 30, 20083774out 04, 20103009
Mh7kJUC2014,815jul 23, 20112717jul 06, 2017542
GoblinBot4UC2213,873mar 17, 20093575jan 17, 20141808
HorekiUC2313,771dez 13, 20112574out 17, 20122265
BarrasUC2411,792fev 01, 20093619ago 12, 2018140
TbennertUC2510,487jun 05, 20112765dez 08, 2017387
SynergyUC269,981jul 25, 20083810abr 02, 20161002
FylbecatulousUC279,151jan 25, 20132165out 23, 201868
J 1982UC298,051set 20, 20074119out 27, 201864
GriffinofwalesUC308,048mai 07, 20093524jan 21, 2017708
TygrrrUC317,827dez 28, 20064385jul 19, 20112721
BlockinbloxUC347,336out 14, 20054825mar 27, 20122469

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 729.434 edições foram feitas por usuários anônimos, de um total de 4096.367 edições ( 17e %)
  


50 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições 
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
 datadias
atrás
datadias
atrás
EmausBotUC1124,565jun 13, 20103122dez 27, 201831-
Luckas-botUC2115,079jul 10, 20083825jul 03, 2012237111-
AddbotUC399,248fev 16, 20093604jul 28, 201319817-
XqbotUC481,112jan 03, 20093648set 13, 20181081-
SieBotUC569,899jun 18, 20074213jan 25, 20112896--
TXiKiBoTUC668,231fev 20, 20074331jan 09, 201321812-
MerlIwBotUC754,753abr 23, 20112808ago 09, 201319691-
ArthurBotUC852,809dez 14, 20083668nov 15, 201222364-
VolkovBotUC948,504jan 21, 20074361mar 04, 201321273-
Thijs!botUC1046,303mai 10, 20064617out 15, 20122267--
ZéroBotUC1141,927ago 22, 20103052mar 07, 20132124--
EscarbotUC1232,854jun 16, 20064580mar 03, 201321281-
JAnDbotUC1331,289ago 20, 20064515jul 03, 20132006--
WikitanvirBotUC1424,061set 28, 20103015mai 15, 201224202-
YurikBotUC1523,305mai 21, 20054971ago 26, 20064509--
ChenzwBotUC1621,915abr 10, 20083916dez 31, 2018---
AlexbotUC1720,409jan 07, 20084010ago 28, 20122315--
MelancholieBotUC1818,022nov 08, 20054800nov 28, 20093319--
RedBotUC1916,646ago 19, 20093420ago 24, 201223191-
ChuispastonBotUC2016,635set 21, 20103022abr 28, 201224373-
Auntof6BotUC2115,906set 01, 20112677dez 25, 20185--
GrouchoBotUC2214,378jan 11, 20093640mar 06, 201321251-
RibotBOTUC2312,945fev 21, 20093599jan 26, 20132164--
AlleborgoBotUC2411,972mar 30, 20074293ago 08, 20103066--
TobeBotUC2511,842ago 16, 20093423set 14, 201030291-
YFdyh-botUC2611,179jun 17, 20122387fev 27, 20132132--
DexbotUC2710,135mai 03, 20122432nov 12, 2016778--
PtbotgourouUC289,997jul 29, 20083806mar 06, 20132125--
Makecat-botUC299,362jun 21, 20122383mar 06, 20132125--
DragonBotUC309,313out 05, 20074104fev 03, 20132156--
CommonsDelinkerUC319,217set 27, 20064477dez 31, 2018-1-
Idioma-botUC329,162mar 01, 20074322mar 06, 20132125--
BotMultichillUC338,989abr 26, 20074266abr 17, 20112814--
FlaBotUC348,971abr 30, 20054992set 11, 20093397--
FoxBotUC358,730out 01, 20093377fev 05, 20122520--
DarkicebotUC368,539dez 31, 20074017fev 13, 20103242780-
SynthebotUC378,259mar 29, 20074294jan 31, 20132159--
ZorrobotUC388,126jun 12, 20083853set 06, 20122306--
SassoBotUC398,007dez 23, 20083659jun 22, 2018191--
MystBotUC407,638jul 03, 20083832mar 08, 201224882-
YotbotUC417,159dez 29, 20083653mar 13, 200935794,230-
DodekBotUC426,841dez 29, 20064384ago 07, 20083797--
OKBotUC436,797jun 08, 20074223jan 28, 20093623--
CarsracBotUC446,630mai 21, 20083875ago 10, 20131968--
SilvonenBotUC456,621abr 14, 20083912fev 14, 20132145--
KamikazeBotUC466,499jul 03, 20103102jan 27, 20132163--
TjBotUC476,474out 31, 20102982mar 06, 20132125--
Ripchip BotUC486,323mar 05, 20112857fev 18, 201225071-
JackieBotUC496,163ago 12, 20103062fev 05, 20161059--
RubinbotUC506,126abr 02, 20093559mar 05, 20132126--

 

Artigos que contêm pelo menos uma ligação interna e .. caracteres de texto legível, não contando códigos wiki e html,
ligações ocultas, etc.; títulos também não contam  (excluindo páginas de redirecionamento)

DataArtigos
 < 32 ch< 64 ch< 128 ch< 256 ch< 512 ch< 1 k ch< 2 k ch< 4 k ch< 8 k ch< 16 k ch< 32 k ch< 64 k ch
mai 20100.0%0.2%7.6%22.5%38.4%59.9%81.4%92.9%97.6%99.3%99.9%100.0%
abr 20100.0%0.2%7.8%22.9%39.0%60.6%81.6%93.0%97.7%99.4%99.9%100.0%
mar 20100.0%0.2%7.9%23.2%39.5%61.1%81.7%93.0%97.6%99.3%99.8%99.9%
fev 20100.0%0.2%8.0%23.5%39.8%61.5%82.0%93.1%97.7%99.4%99.9%100.0%
jan 20100.0%0.2%8.1%23.7%40.1%61.8%82.2%93.2%97.8%99.5%100.0%100.0%
dez 20090.0%0.2%8.2%23.9%40.4%62.0%82.3%93.2%97.7%99.3%99.8%99.9%
nov 20090.0%0.2%8.2%24.1%40.7%62.4%82.6%93.4%97.9%99.5%100.0%100.0%
out 20090.0%0.2%8.3%24.3%40.8%62.6%82.6%93.3%97.7%99.3%99.8%99.9%
set 20090.0%0.2%8.4%24.6%41.1%62.9%82.7%93.4%97.8%99.4%99.9%100.0%
ago 20090.0%0.2%8.5%24.9%41.4%63.3%82.8%93.4%97.8%99.4%99.9%100.0%
jul 20090.0%0.2%8.6%26.1%42.6%63.7%82.9%93.4%97.8%99.4%99.9%100.0%
jun 20090.0%0.2%8.5%26.5%43.0%64.2%83.3%93.6%97.9%99.4%99.9%100.0%
mai 20090.0%0.2%8.5%26.6%43.2%64.4%83.4%93.5%97.7%99.2%99.7%99.8%
abr 20090.0%0.4%9.0%27.1%43.8%65.0%83.7%93.7%97.9%99.4%99.9%100.0%
mar 20090.0%0.4%9.1%27.4%44.2%65.3%83.7%93.6%97.8%99.3%99.8%99.9%
fev 20090.0%0.4%9.3%28.0%44.7%65.7%83.9%93.8%98.0%99.5%100.0%100.0%
jan 20090.0%0.4%9.5%28.5%45.2%66.0%84.0%93.8%98.0%99.5%100.0%100.0%
dez 20080.0%0.5%4.1%18.5%37.9%61.8%81.8%92.8%97.6%99.3%99.8%99.9%
nov 20080.0%0.2%2.9%14.9%35.6%60.6%81.0%92.5%97.6%99.4%100.0%100.0%
out 20080.0%0.2%3.0%14.8%35.4%60.7%80.9%92.3%97.4%99.2%99.8%99.9%
set 20080.0%0.3%3.2%14.8%35.7%61.3%81.3%92.5%97.6%99.4%100.0%100.0%
ago 20080.0%0.2%3.1%14.0%35.3%61.1%81.3%92.5%97.6%99.4%99.9%100.0%
jul 20080.0%0.2%3.0%13.8%34.9%60.9%81.1%92.3%97.4%99.2%99.8%99.9%
jun 20080.0%0.2%3.0%13.9%33.4%60.1%81.0%92.4%97.6%99.4%99.9%100.0%
mai 20080.0%0.3%3.1%14.2%33.8%60.6%81.3%92.6%97.7%99.5%100.0%100.0%
abr 20080.0%0.3%3.2%14.3%33.9%60.5%81.2%92.5%97.7%99.5%100.0%100.0%
mar 20080.0%0.3%3.3%14.2%33.5%60.4%81.2%92.5%97.6%99.4%99.9%100.0%
fev 20080.0%0.3%3.4%14.2%33.8%60.8%81.5%92.7%97.7%99.4%99.8%99.9%
jan 20080.0%0.3%3.5%14.7%34.5%61.2%81.6%92.7%97.7%99.4%99.8%99.9%
dez 20070.0%0.3%3.8%15.6%35.9%61.9%81.9%92.8%97.7%99.4%99.8%99.9%
nov 20070.0%0.4%3.8%16.1%37.9%62.7%82.3%93.0%97.9%99.5%99.8%99.9%
out 20070.0%0.4%4.0%16.6%38.4%63.2%82.6%93.0%98.0%99.6%99.9%100.0%
set 20070.0%0.4%4.2%17.1%39.2%63.9%83.0%93.2%98.0%99.5%99.8%99.9%
ago 20070.1%0.5%4.5%17.9%40.2%64.7%83.4%93.4%98.1%99.6%99.9%100.0%
jul 20070.1%0.6%4.8%18.7%41.7%66.0%83.8%93.6%98.3%99.8%100.0%100.0%
jun 20070.1%0.6%4.9%18.7%41.6%65.9%83.6%93.5%98.2%99.7%100.0%100.0%
mai 20070.1%0.7%5.3%19.3%42.3%66.7%84.1%93.6%98.2%99.6%99.9%100.0%
abr 20070.1%0.7%5.5%19.8%43.0%67.3%84.5%93.8%98.2%99.6%99.9%100.0%
mar 20070.1%0.8%5.9%20.5%43.9%68.1%84.9%94.0%98.3%99.7%100.0%100.0%
fev 20070.2%0.9%6.3%21.8%45.5%69.6%85.7%94.3%98.4%99.8%100.0%100.0%
jan 20070.2%1.0%6.9%22.8%46.8%70.5%86.1%94.4%98.3%99.7%99.9%99.9%
dez 20060.2%1.2%7.6%24.2%48.6%72.0%86.9%94.7%98.5%99.9%100.0%100.0%
nov 20060.2%1.3%8.3%25.1%49.7%72.0%86.9%94.6%98.4%99.7%99.9%99.9%
out 20060.3%1.6%9.0%25.9%50.0%71.9%86.9%94.6%98.4%99.8%100.0%100.0%
set 20060.3%1.7%9.6%26.7%50.8%72.3%87.1%94.7%98.5%99.9%100.0%100.0%
ago 20060.3%1.7%9.8%27.0%51.5%72.9%87.2%94.6%98.3%99.6%99.8%99.8%
jul 20060.4%2.0%10.0%27.2%51.7%73.0%87.3%94.7%98.4%99.7%99.9%99.9%
jun 20060.4%2.1%10.5%27.6%52.1%73.1%87.1%94.4%98.3%99.6%99.8%99.8%
mai 20060.4%2.3%10.9%27.9%52.5%73.2%87.1%94.5%98.4%99.7%99.9%99.9%
abr 20060.5%2.6%11.5%28.2%53.0%73.3%87.0%94.4%98.4%99.7%99.9%99.9%
mar 20060.5%2.6%11.7%28.6%53.7%73.6%87.0%94.2%98.4%99.7%99.9%99.9%
fev 20060.5%2.9%12.2%29.4%54.1%74.0%87.1%94.3%98.5%99.8%100.0%100.0%
jan 20060.5%2.8%12.4%29.7%54.0%73.5%86.6%93.9%98.4%99.8%100.0%100.0%
dez 20050.6%3.2%13.0%30.5%54.4%73.0%86.1%93.4%98.1%99.7%99.9%100.0%
nov 20050.8%3.6%13.4%31.4%54.9%72.9%85.7%93.3%98.1%99.7%99.9%99.9%
out 20050.9%3.5%13.5%31.6%54.4%72.8%85.6%93.1%98.1%99.7%100.0%100.0%
set 20051.0%3.6%14.1%32.0%55.1%73.5%86.0%93.4%98.2%99.7%100.0%100.0%
ago 20051.2%4.1%14.4%32.5%55.4%74.0%86.1%93.5%98.3%99.8%100.0%100.0%
jul 20051.8%5.3%15.7%33.9%55.9%74.4%86.3%93.4%98.2%99.6%99.9%99.9%
jun 20052.2%6.7%17.9%36.0%56.8%74.9%86.9%93.9%98.3%99.7%100.0%100.0%
mai 20055.8%10.2%20.1%37.5%58.3%76.7%88.9%95.6%98.5%99.6%99.9%100.0%
abr 20051.8%5.6%14.9%33.1%55.8%75.9%89.0%95.5%98.4%99.5%99.9%100.0%
mar 20051.5%5.1%14.3%32.6%55.8%76.0%89.2%95.5%98.3%99.4%99.8%99.9%
fev 20050.7%3.9%13.2%31.1%54.4%75.6%89.4%95.5%98.3%99.4%99.8%99.9%
jan 20050.5%3.0%12.4%29.9%53.1%74.7%89.1%95.5%98.4%99.6%100.0%100.0%
dez 20040.3%2.3%11.8%28.9%52.2%73.7%88.3%95.2%98.4%99.7%100.0%100.0%
nov 20040.2%2.5%12.2%29.4%53.0%73.7%88.3%95.0%98.1%99.4%99.8%99.9%
out 20040.3%2.9%13.4%30.8%54.8%75.0%88.6%95.3%98.4%99.5%99.9%100.0%
set 20040.4%3.1%14.0%31.8%56.4%76.4%89.6%95.6%98.5%99.6%100.0%100.0%
ago 20040.2%2.8%12.9%29.9%53.8%75.0%89.0%95.2%98.2%99.4%99.9%100.0%
jul 20040.4%2.6%12.0%28.2%52.7%73.8%88.6%95.1%98.2%99.3%99.9%100.0%
jun 20040.1%2.5%12.6%29.9%54.3%75.1%88.8%95.3%98.3%99.3%99.9%100.0%
mai 20040.2%2.8%12.9%31.1%54.7%75.6%89.7%95.5%98.4%99.3%99.9%99.9%
abr 20040.3%2.8%12.8%29.3%51.9%75.6%90.9%96.5%99.2%99.9%100.0%100.0%
mar 20040.4%2.5%12.2%27.9%49.6%73.8%90.6%96.9%99.6%100.0%100.0%100.0%
fev 20040.4%2.6%10.7%24.2%46.3%72.2%90.6%96.6%99.3%99.9%99.9%99.9%
jan 20040.5%3.0%11.1%24.3%46.6%71.8%90.0%96.6%99.3%100.0%100.0%100.0%
dez 20030.6%3.4%11.0%23.3%45.0%71.3%89.7%96.9%99.5%100.0%100.0%100.0%
nov 20031.3%4.4%10.8%22.7%40.8%68.6%88.5%96.2%99.3%100.0%100.0%100.0%
out 20031.2%2.7%9.8%20.9%36.6%63.7%88.0%96.3%99.4%100.0%100.0%100.0%
set 20031.9%4.4%13.8%21.9%38.8%68.8%91.3%98.8%100.0%100.0%100.0%100.0%
ago 20031.9%4.7%17.8%29.0%49.6%76.7%92.6%99.1%100.0%100.0%100.0%100.0%
jul 20032.9%8.8%23.5%35.3%57.4%82.4%92.7%100.0%100.0%100.0%100.0%100.0%
jun 20030.0%2.2%17.8%28.9%48.9%80.0%91.1%100.0%100.0%100.0%100.0%100.0%
mai 20030.0%2.4%17.0%24.3%46.3%78.0%90.2%100.0%100.0%100.0%100.0%100.0%
abr 20030.0%2.6%15.8%23.7%42.1%76.3%89.5%100.0%100.0%100.0%100.0%100.0%
mar 20030.0%2.9%17.2%25.8%42.9%80.0%91.4%100.0%100.0%100.0%100.0%100.0%
fev 20030.0%0.0%8.3%8.3%16.6%49.9%83.2%99.9%99.9%99.9%99.9%99.9%
jan 20030.0%0.0%0.0%0.0%9.1%54.6%91.0%100.0%100.0%100.0%100.0%100.0%
dez 20020.0%0.0%0.0%0.0%10.0%60.0%100.0%100.0%100.0%100.0%100.0%100.0%
nov 20020.0%0.0%0.0%0.0%12.5%62.5%100.0%100.0%100.0%100.0%100.0%100.0%
out 20020.0%0.0%0.0%0.0%12.5%62.5%100.0%100.0%100.0%100.0%100.0%100.0%
set 20020.0%0.0%0.0%0.0%28.6%71.5%100.0%100.0%100.0%100.0%100.0%100.0%
ago 20020.0%0.0%0.0%0.0%28.6%71.5%100.0%100.0%100.0%100.0%100.0%100.0%
jul 20020.0%0.0%0.0%0.0%33.3%83.3%100.0%100.0%100.0%100.0%100.0%100.0%
jun 20020.0%0.0%0.0%0.0%33.3%83.3%100.0%100.0%100.0%100.0%100.0%100.0%
mai 20020.0%0.0%0.0%0.0%33.3%83.3%100.0%100.0%100.0%100.0%100.0%100.0%
abr 20020.0%0.0%0.0%0.0%33.3%83.3%100.0%100.0%100.0%100.0%100.0%100.0%
mar 20020.0%0.0%0.0%0.0%33.3%83.3%100.0%100.0%100.0%100.0%100.0%100.0%
fev 20020.0%0.0%0.0%0.0%33.3%83.3%100.0%100.0%100.0%100.0%100.0%100.0%
jan 20020.0%0.0%0.0%0.0%40.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
dez 20010.0%0.0%0.0%0.0%40.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
nov 20010.0%0.0%0.0%0.0%40.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
out 20010.0%0.0%0.0%0.0%40.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
set 20010.0%0.0%0.0%0.0%50.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
ago 20010.0%0.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
jul 20010.0%0.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
jun 20010.0%0.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%
mai 20010.0%0.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%100.0%

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.

See also Category Overview Complete (2.3 Mb!), Concise (74 kb)
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110OggPng
dez 2018198 k23 k6,0 k3654521 k13640 k       351
nov 2018197 k23 k5,9 k3654521 k13640 k       351
out 2018196 k23 k5,9 k3654521 k13639 k       351
set 2018195 k23 k5,9 k3654521 k13539 k       351
ago 2018193 k23 k5,8 k3654421 k13439 k       351
jul 2018191 k23 k5,8 k3654421 k13438 k       351
jun 2018190 k23 k5,8 k3654421 k13438 k       351
mai 2018189 k22 k5,7 k3654220 k13236 k       351
abr 2018187 k22 k5,7 k3654220 k13234 k       351
mar 2018186 k22 k5,6 k3654220 k13233 k       351
fev 2018185 k22 k5,6 k3654220 k12933 k       351
jan 2018184 k22 k5,5 k3654220 k12633 k       351
dez 2017183 k22 k5,5 k3654219 k12432 k       351
nov 2017182 k21 k5,4 k3654219 k12432 k       351
out 2017181 k21 k5,4 k3654219 k12232 k       351
set 2017180 k21 k5,4 k3654219 k12131 k       351
ago 2017179 k21 k5,4 k3654219 k12131 k       351
jul 2017179 k21 k5,3 k3654218 k11931 k       351
jun 2017177 k21 k5,3 k3654218 k11931 k       351
mai 2017177 k21 k5,3 k3654218 k11931 k       351
abr 2017176 k21 k5,3 k3654218 k11931 k       351
mar 2017175 k20 k5,2 k3654218 k11930 k       351
fev 2017174 k20 k5,2 k3654218 k11930 k       351
jan 2017173 k20 k5,2 k3654118 k11930 k       351
dez 2016172 k20 k5,1 k3654118 k11929 k       351
nov 2016172 k20 k5,1 k3654118 k11929 k       351
out 2016171 k20 k5,1 k3654118 k11929 k       351
set 2016171 k20 k5,1 k3654118 k11929 k       351
ago 2016170 k20 k5,1 k3654017 k11929 k       351
jul 2016170 k19 k5,1 k3653917 k11829 k       351
jun 2016169 k19 k5,0 k3653817 k11829 k       351
mai 2016168 k19 k5,0 k3653817 k11829 k       351
abr 2016168 k19 k5,0 k3653717 k11829 k       351
mar 2016167 k19 k4,9 k3653717 k11828 k       351
fev 2016166 k19 k4,9 k3653717 k11828 k       351
jan 2016166 k19 k4,9 k3453717 k11828 k       331
dez 2015164 k18 k4,8 k3453717 k11828 k       331
nov 2015164 k18 k4,8 k3453717 k11828 k       331
out 2015163 k18 k4,7 k3453617 k11827 k       331
set 2015163 k18 k4,7 k3453617 k11327 k       331
ago 2015162 k18 k4,7 k3453617 k11327 k       331
jul 2015161 k18 k4,7 k3453617 k11227 k       331
jun 2015160 k18 k4,6 k3453617 k11127 k       331
mai 2015160 k18 k4,6 k3453617 k10927 k       331
abr 2015159 k17 k4,6 k3453417 k10926 k       331
mar 2015158 k17 k4,5 k3453417 k10926 k       331
fev 2015157 k17 k4,5 k3453417 k10926 k       331
jan 2015156 k17 k4,5 k3453416 k10926 k       331
dez 2014154 k17 k4,4 k3451416 k10926 k       331
nov 2014153 k17 k4,4 k3451216 k10926 k       331
out 2014152 k17 k4,4 k3451216 k10825 k       331
set 2014151 k17 k4,3 k3451216 k10825 k       331
ago 2014150 k17 k4,3 k3451216 k10825 k       331
jul 2014149 k17 k4,3 k3450816 k10825 k       331
jun 2014147 k16 k4,2 k3450416 k10825 k       331
mai 2014146 k16 k4,2 k3450216 k10825 k       331
abr 2014145 k16 k4,1 k3449616 k10824 k       331
mar 2014144 k16 k4,1 k3449416 k10824 k       331
fev 2014143 k16 k4,1 k3449416 k10824 k      14907331
jan 2014141 k16 k4,0 k3449216 k10823 k      13407331
dez 2013140 k16 k4,0 k3449216 k10823 k      14325331
nov 2013139 k16 k3,9 k3449116 k10623 k      25169331
out 2013137 k15 k3,9 k3449116 k10523 k      11895331
set 2013136 k15 k3,8 k3449115 k10523 k      12717331
ago 2013135 k15 k3,8 k3448915 k10522 k      15000331
jul 2013134 k15 k3,7 k3448915 k10522 k      20781331
jun 2013132 k15 k3,7 k3448915 k10522 k      21733331
mai 2013130 k15 k3,6 k3447815 k10521 k      20558331
abr 2013128 k14 k3,6 k3447215 k10420 k      16688331
mar 2013127 k14 k3,5 k3447215 k10420 k      18730331
fev 2013126 k14 k3,5 k3447015 k10319 k      14747331
jan 2013125 k14 k3,5 k3447014 k10319 k      15500331
dez 2012123 k14 k3,4 k3447014 k10318 k      16512331
nov 2012121 k14 k3,4 k3446714 k10218 k      12174331
out 2012120 k13 k3,4 k3446614 k10218 k      13317331
set 2012119 k13 k3,3 k3446413 k10118 k      12621331
ago 2012118 k13 k3,3 k3445513 k10117 k      14807331
jul 2012116 k13 k3,3 k3444913 k10117 k      14328331
jun 2012115 k13 k3,3 k3444813 k10116 k      26820331
mai 2012113 k13 k3,2 k3444813 k10116 k      28735331
abr 2012112 k13 k3,2 k3444713 k10116 k      40437331
mar 2012110 k12 k3,1 k3444513 k10116 k      28329331
fev 2012108 k12 k3,1 k3444512 k10115 k      21956331
jan 2012107 k12 k3,0 k3444412 k10014 k      15848331
dez 2011106 k12 k3,0 k3444012 k10014 k      12250331
nov 2011104 k12 k2,9 k3444012 k9914 k      14043331
out 2011103 k12 k2,9 k3444012 k9914 k      14430331
set 2011103 k12 k2,9 k3444011 k9913 k      16548331
ago 2011102 k11 k2,9 k3444011 k9913 k      17465331
jul 2011101 k11 k2,8 k3343911 k9913 k      11370321
jun 2011100 k11 k2,8 k3343811 k9913 k      8184321
mai 201199 k11 k2,8 k3343611 k9613 k      9204321
abr 201198 k11 k2,7 k3343311 k9612 k      13137321
mar 201196 k11 k2,7 k3342910 k9612 k      12402321
fev 201195 k11 k2,6 k3342610 k9612 k      9435321
jan 201194 k10 k2,6 k3341310 k9512 k      10167321
dez 201093 k10 k2,6 k3341110 k9512 k      8426321
nov 201092 k10 k2,5 k3240810,0 k9512 k      8237311
out 201091 k9,9 k2,5 k324069,7 k9511 k      8575311
set 201090 k9,8 k2,4 k323999,4 k9511 k      8194311
ago 201089 k9,7 k2,4 k323989,3 k9511 k      16277311
jul 201087 k9,5 k2,3 k323979,1 k9211 k      8072311
jun 201086 k9,3 k2,3 k323858,5 k9011 k      9564311
mai 201085 k9,1 k2,2 k323778,1 k8711 k      11480311
abr 201083 k8,9 k2,2 k323778,0 k8611 k      13159311
mar 201082 k8,7 k2,1 k323767,8 k8611 k      16136311
fev 201081 k8,5 k2,0 k323757,7 k8511 k      10228311
jan 201080 k8,2 k1,9 k323757,6 k8411 k      14986311
dez 200979 k8,0 k1,9 k323757,4 k8411 k      11275311
nov 200978 k7,9 k1,8 k323757,3 k8111 k      10741311
out 200977 k7,6 k1,8 k323747,2 k8111 k      10274311
set 200974 k7,4 k1,7 k323747,1 k8110 k      9761311
ago 200973 k7,2 k1,7 k313687,0 k8110 k      10469301
jul 200971 k7,1 k1,6 k313666,9 k8110 k      11288301
jun 200970 k6,9 k1,5 k313036,8 k8110 k      8292301
mai 200969 k6,8 k1,4 k312936,7 k8110 k      13291301
abr 200968 k6,6 k1,4 k312856,6 k8110 k      10541301
mar 200967 k6,4 k1,3 k302836,4 k819,8 k      13070291
fev 200965 k6,1 k1,2 k132825,9 k819,8 k      12456121
jan 200964 k5,8 k1,1 k132795,7 k349,5 k      15353121
dez 200856 k5,6 k1,0 k132775,5 k349,4 k      17548121
nov 200852 k5,4 k945132755,4 k339,2 k      12696121
out 200851 k5,2 k859132735,2 k339,0 k      12137121
set 200849 k5,0 k790132635,0 k328,8 k      12098121
ago 200847 k4,8 k731132544,9 k328,7 k      12217121
jul 200845 k4,5 k670132514,6 k288,4 k      15448121
jun 200842 k4,3 k606132464,3 k278,2 k      14453121
mai 200840 k4,0 k560132454,0 k267,8 k      11078121
abr 200838 k3,7 k514132363,8 k257,5 k      9077121
mar 200837 k3,6 k490132213,7 k247,4 k      10417121
fev 200835 k3,4 k472131803,5 k247,2 k      13856121
jan 200834 k3,2 k460131673,4 k246,8 k      13937121
dez 200732 k3,0 k435131403,2 k236,5 k      18085121
nov 200730 k2,9 k414131283,0 k236,0 k      9811121
out 200729 k2,8 k410131272,8 k235,8 k      7875121
set 200728 k2,7 k396131262,4 k225,5 k      8503121
ago 200727 k2,5 k378131222,1 k205,3 k      10715121
jul 200725 k2,4 k349121181,9 k195,0 k      7506111
jun 200724 k2,3 k329121101,8 k174,8 k      7322111
mai 200723 k2,2 k307121101,7 k174,7 k      7397111
abr 200722 k2,1 k296121101,6 k174,6 k      7327111
mar 200721 k2,0 k278121071,5 k154,4 k      8316111
fev 200720 k1,9 k27612931,5 k154,0 k      6773111
jan 200719 k1,8 k25712931,4 k153,7 k      7683111
dez 200618 k1,6 k24712931,2 k153,6 k      9367111
nov 200617 k1,5 k23512881,0 k153,4 k      9060111
out 200616 k1,4 k22512881,0 k153,1 k      6510111
set 200615 k1,3 k197688981152,9 k      607151
ago 200614 k1,2 k192688920142,8 k      509151
jul 200613 k1,1 k186687888132,8 k      408151
jun 200612 k968173187833132,7 k      3534 1
mai 200612 k917159186767132,6 k      5155 1
abr 200611 k846152186601132,3 k      3850 1
mar 200610,0 k791146184525132,1 k      3620 1
fev 20069,4 k719146184499122,0 k      4367 1
jan 20068,5 k676131182469121,9 k      5481 1
dez 20057,3 k624128182425111,8 k      2865 1
nov 20056,8 k566125177402111,7 k      2745 1
out 20056,4 k531124177386111,6 k      2037 1
set 20056,0 k495122177364111,5 k      1240 1
ago 20055,8 k468122177355111,4 k      2372 1
jul 20055,3 k444116177319111,0 k      2212 1
jun 20055,0 k40011417230011707      3010 1
mai 20054,5 k37311117221511367      1867 1
abr 20053,9 k33810917216011232      1131 1
mar 20053,7 k31010817215111191      1037 1
fev 20053,4 k2861071726811180      1120 1
jan 20053,1 k2631061726311144      816 1
dez 20042,8 k2341061725810139      1063 1
nov 20042,6 k2209517150993      787 1
out 20042,4 k2049017047986      410 1
set 20042,3 k1898717046880      857 1
ago 20042,1 k1748316935740      1113 1
jul 20041,9 k152811692471      546 1
jun 20041,8 k13280 68177          
mai 20041,6 k10579 67156          
abr 20041,3 k9267 33146          
mar 20041,1 k6762 33115          
fev 20049335558 3385          
jan 20048384653 3275          
dez 20037573347 3175          
nov 20035552226   4          
out 20034131723   3          
set 20032021312   3          
ago 2003144109   2          
jul 20039265   1          
jun 20036144   1          
mai 20035524              
abr 20035023              
mar 20034523              
fev 20032122              
jan 20031812              
dez 20021612              
nov 20021511              
out 20021411              
set 20021311              
ago 20021211              
jul 20021111              
jun 200211 1              
mai 200210 1              
abr 20029 1              
mar 20027 1              
fev 20027 1              
jan 20024                
dez 20014                
nov 20014                
out 20014                
set 2001   
ago 2001   
jul 2001   
jun 2001   
mai 2001   

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

mai 2001: 1 1 Swedish Academy

jun 2001: 1 2 Ludwig Mies van der Rohe

ago 2001: 1 1 Swedish Academy

set 2001: 1 1 Mark

out 2001: 1 1 Paul Bunyan

fev 2002: 1 2 Ludwig Mies van der Rohe , 2 2 Mark

mar 2002: 1 2 Europa

abr 2002: 1 3 Europa , 2 1 Pulitzer Prize for Drama

mai 2002: 1 3 Europa , 2 1 360

jun 2002: 1 1 Ludwig Mies van der Rohe

jul 2002: 1 1 Mark

ago 2002: 1 2 Paul Bunyan , 2 2 Candidiasis , 3 1 360

set 2002: 1 3 Europa , 2 1 360

out 2002: 1 1 Edmonton (disambiguation)

nov 2002: 1 1 Stewiacke

dez 2002: 1 1 Science Museum (London)

jan 2003: 1 1 Stewiacke

fev 2003: 1 3 Cancer (constellation) , 2 2 Swedish Academy , 3 1 List of communities in Nova Scotia

mar 2003: 1 2 Zacarias Moussaoui , 2 2 Cancer (constellation) , 3 1 Ludwig Mies van der Rohe

abr 2003: 1 3 Sibley-Monroe checklist 1 , 2 1 Ptolemaic Dynasty

mai 2003: 1 3 Ludwig Mies van der Rohe , 2 3 1961 in sports , 3 1 Subprefectures in France

jun 2003: 1 3 1961 in sports , 2 2 List of communities in Nova Scotia , 3 2 Paul Bunyan

jul 2003: 1 4 Astrodome , 2 2 Cancer (constellation) , 3 1 Edmonton (disambiguation)

ago 2003: 1 3 Zacarias Moussaoui , 2 3 Cancer (constellation) , 3 2 Feral , 4 2 Astrodome

set 2003: 1 3 Name , 2 2 Basic English , 3 2 Very High Bitrate Digital Subscriber Line , 4 2 Oahu , 5 2 Non-profit , 6 1 Neville Bonner

out 2003: 1 2 Neville Bonner , 2 2 Speaker of the Australian House of Representatives , 3 2 Alfred Sisley , 4 2 Saku Koivu , 5 2 Allan Cup , 6 2 Northern League (baseball) , 7 2 List of NHL players , 8 2 Microsoft Windows , 9 2 Verb , 10 2 Unit of measurement , 11 2 Terrestrial ecoregion , 12 2 Sheep , 13 2 Psychoneuroimmunology , 14 2 Microsoft , 15 2 History

nov 2003: 1 3 Dimension , 2 2 Feral , 3 2 Zacarias Moussaoui , 4 2 Tunisair , 5 2 International Ice Hockey Federation , 6 2 Pluto , 7 2 Window , 8 2 Volume , 9 2 Table , 10 2 Systeme internationale , 11 2 State , 12 2 Server log , 13 2 Sport , 14 2 Pi , 15 2 Periodic table , 16 2 Plant , 17 2 Like , 18 2 Killing , 19 2 Helium , 20 2 Geometry , 21 2 Egypt , 22 2 Elements , 23 2 Depth , 24 2 Dimensions , 25 1 Edmonton (disambiguation)

dez 2003: 1 5 Main Page , 2 3 Basic English , 3 3 Zinc , 4 3 Dimension , 5 3 Browser , 6 2 Feral , 7 2 Speaker of the Australian House of Representatives , 8 2 Ludwig Mies van der Rohe , 9 2 Zacarias Moussaoui , 10 2 English as a second language , 11 2 Volcanism , 12 2 Fold (geology) , 13 2 Endogenetic process , 14 2 Old calendar , 15 2 Atlantic Ocean , 16 2 Mexico , 17 2 Gaol , 18 2 Republic of China , 19 2 Zoo , 20 2 Chinese language , 21 2 Web browser , 22 2 Unix , 23 2 University , 24 2 Right angle , 25 2 Plastic

jan 2004: 1 5 Main Page , 2 3 Australian War Memorial , 3 3 United States dollar , 4 3 Colour , 5 2 San Cristóbal , 6 2 Zacarias Moussaoui , 7 2 World War I , 8 2 Wade Redden , 9 2 Names of numbers in English , 10 2 English as a second language , 11 2 Euro , 12 2 Albert Einstein , 13 2 Semiotics , 14 2 Asia , 15 2 Slavery , 16 2 River , 17 2 Japan , 18 1 Colac, Victoria

fev 2004: 1 11 Main Page , 2 7 Swag , 3 4 Computer network , 4 4 Mark , 5 4 Kami , 6 3 Russia , 7 3 Berlin , 8 3 Luxembourg , 9 3 Communication , 10 3 Cat , 11 3 Google , 12 2 Feral , 13 2 William Shakespeare , 14 2 Sibley-Monroe checklist 1 , 15 2 Zacarias Moussaoui , 16 2 Paul Bunyan , 17 2 Canada , 18 2 Wikipedia , 19 2 1990s , 20 2 Munich , 21 2 Peru , 22 2 Homonym , 23 2 Vienna , 24 2 Baden-Württemberg , 25 2 Treaty

mar 2004: 1 5 Television , 2 4 Main Page , 3 3 Lord Mayor , 4 3 Mark , 5 3 Discovery , 6 3 Christmas cake , 7 3 Gas syringe , 8 3 Scotland , 9 3 United States dollar , 10 3 Unit of measurement , 11 3 Universe , 12 3 Solar System , 13 3 OK , 14 3 Mars , 15 3 Asteroid , 16 2 Havre Boucher , 17 2 San Cristóbal , 18 2 Deutsche Eishockey Liga , 19 2 Pluto , 20 2 Mansfield, Victoria , 21 2 Sun , 22 2 Minnesota River , 23 2 German language , 24 2 Renegades , 25 2 Properties

abr 2004: 1 10 Main Page , 2 4 List of ice hockey leagues , 3 4 Mark , 4 4 French language , 5 4 Fertilizer , 6 4 Culture , 7 3 Los Santos Province , 8 3 Christianity , 9 3 United States , 10 3 North , 11 3 Gross domestic product , 12 3 Photon , 13 3 Desktop environment , 14 3 Linux , 15 3 Buddha , 16 3 Sphere , 17 3 Isotope , 18 3 Minute , 19 3 Female , 20 3 Slope , 21 3 Euro , 22 3 Periodic table , 23 3 Kilometre , 24 3 Graph theory , 25 3 Everything2

mai 2004: 1 6 Main Page , 2 4 Air space , 3 4 Vitamin C , 4 4 Generation , 5 4 Preposition , 6 4 North , 7 4 Internet Explorer , 8 4 Raw food , 9 3 Lord Mayor , 10 3 United States , 11 3 Mark , 12 3 Oxidation , 13 3 Lao Tzu , 14 3 Snow , 15 3 East , 16 3 Lake , 17 3 Adelaide , 18 3 Nuclear war , 19 3 Market , 20 3 Rain , 21 3 Light , 22 3 Jungle , 23 3 19th century , 24 3 Decade , 25 3 Arrow

jun 2004: 1 5 Marco Polo , 2 5 Gmail , 3 5 Population , 4 4 Science Museum (London) , 5 4 World War II , 6 4 GNU General Public License , 7 4 Tokyo , 8 4 Chat , 9 4 British English , 10 3 Saku Koivu , 11 3 Main Page , 12 3 Cancer (constellation) , 13 3 Herbivore , 14 3 Omnivore , 15 3 Aristotle , 16 3 Astronomer , 17 3 Adolf Hitler , 18 3 Neuron , 19 3 North Korea , 20 3 Resurrection , 21 3 Snow , 22 3 Adjustable spanner , 23 3 Video game console , 24 3 Plato , 25 3 Blindness

jul 2004: 1 4 Main Page , 2 4 Wikipedia , 3 4 EBay , 4 4 Tokyo , 5 4 English , 6 3 Doreen Mantle , 7 3 Christianity , 8 3 Translation , 9 3 Star , 10 3 Australia , 11 2 Bryn Celli Ddu , 12 2 Pulitzer Prize for Drama , 13 2 360 , 14 2 National Trust of Australia , 15 2 San Cristóbal , 16 2 Zacarias Moussaoui , 17 2 Czech Extraliga , 18 2 Bread roll , 19 2 World War II , 20 2 Spain , 21 2 Swedish Academy , 22 2 IRCd , 23 2 Mark , 24 2 Astrodome , 25 2 Saskatchewan

ago 2004: 1 4 United States , 2 4 Stockholm , 3 4 Norway , 4 4 Cologne , 5 4 Turkey , 6 4 Sweden , 7 3 Abbotsford , 8 3 Spain , 9 3 Highland Football League , 10 3 Oral candidiasis , 11 3 Naples , 12 3 Socrates , 13 3 Afganistan , 14 3 Pakistan , 15 3 Atlanta , 16 3 Côte d'Ivoire , 17 3 Aristotle , 18 3 Kyoto , 19 3 Johann Sebastian Bach , 20 3 Tokyo , 21 3 Xenon , 22 3 Lisbon , 23 3 Estonia , 24 3 Chile , 25 3 Das Lied der Deutschen

set 2004: 1 8 Mark , 2 5 Dickie Moore (ice hockey) , 3 5 Main Page , 4 4 DNA , 5 3 Feral , 6 3 Australian War Memorial , 7 3 List of current Canadian first ministers , 8 3 List of Canadian painters , 9 3 Caspar Wessel , 10 3 Canada , 11 3 United States , 12 3 George Washington , 13 3 Mandarin Chinese , 14 3 George W. Bush , 15 3 Wiki , 16 3 Japan , 17 2 Speaker of the Australian House of Representatives , 18 2 2050 , 19 2 2026 , 20 2 Divisions of the Australian House of Representatives , 21 2 Ludwig Mies van der Rohe , 22 2 Science Museum (London) , 23 2 Alfred Sisley , 24 2 Basic English , 25 2 Germany

out 2004: 1 5 Main Page , 2 4 Breakfast , 3 3 Division of Cowper , 4 3 Division of Canberra , 5 3 Australian War Memorial , 6 3 Division of North Sydney , 7 3 Ludwig Mies van der Rohe , 8 3 Norwegian Nobel Committee , 9 3 Candidiasis , 10 3 Mark , 11 3 Julius Caesar , 12 2 Division of Bendigo , 13 2 Division of Ballarat , 14 2 Speaker of the Australian House of Representatives , 15 2 List of bridges in Ottawa , 16 2 List of Canadian painters , 17 2 Zacarias Moussaoui , 18 2 Prostatitis , 19 2 Lord Mayor , 20 2 Ararat, Victoria , 21 2 Bukit Timah , 22 2 Northern League (baseball) , 23 2 Daemon (computer software) , 24 2 Cancer (constellation) , 25 2 Discovery

nov 2004: 1 5 Zacarias Moussaoui , 2 4 Neville Bonner , 3 4 Francisco Hernández de Córdoba (Yucatán conquistador) , 4 4 Main Page , 5 4 Mark , 6 3 Judaism , 7 3 Comparative , 8 3 George Orwell , 9 3 Chopsticks , 10 3 Synonym , 11 3 Psychology , 12 3 Archduke Franz Ferdinand of Austria , 13 3 George W. Bush , 14 3 English as a second language , 15 3 History , 16 2 Stewiacke , 17 2 Division of Kingston , 18 2 Swag , 19 2 Dickie Moore (ice hockey) , 20 2 Pulitzer Prize for Drama , 21 2 360 , 22 2 National Trust of Australia , 23 2 Oxford, Nova Scotia , 24 2 Division of Ballarat , 25 2 Speaker of the Australian House of Representatives

dez 2004: 1 5 Mark , 2 4 Francisco Hernández de Córdoba (Yucatán conquistador) , 3 4 Main Page , 4 4 Death penalty , 5 3 International Ice Hockey Federation , 6 3 World War I , 7 3 Collaboration , 8 3 Astrodome , 9 3 Dictator , 10 3 Viktor Yushchenko , 11 3 Province , 12 3 Salamander , 13 3 February 12 , 14 3 February 22 , 15 3 1882 , 16 3 George W. Bush , 17 3 Das Lied der Deutschen , 18 3 Netherlands , 19 3 English as a second language , 20 3 France , 21 3 Editor , 22 3 English , 23 3 Dictionary , 24 3 Bottle , 25 2 Dit Clapper

jan 2005: 1 5 Alberta Junior Hockey League , 2 5 Cancer (constellation) , 3 5 Light pollution , 4 4 Canadian Junior Hockey League , 5 3 Fresh Horses , 6 3 Arup , 7 3 Fort William, Ontario , 8 3 Daemon (computer software) , 9 3 January 30 , 10 3 February 21 , 11 3 May 1 , 12 3 Jurassic Park: Operation Genesis , 13 3 Pig Latin , 14 3 Jurassic Park , 15 3 Friends , 16 3 Mrs. Doubtfire , 17 3 J. R. R. Tolkien , 18 2 Serekh , 19 2 Bartlett's Familiar Quotations , 20 2 Prostatitis , 21 2 Paul Bunyan , 22 2 Northern League (baseball) , 23 2 Very High Bitrate Digital Subscriber Line , 24 2 Europa , 25 2 Leipzig

fev 2005: 1 4 Dodgeball , 2 4 Ray Charles , 3 3 Bartlett's Familiar Quotations , 4 3 Neville Bonner , 5 3 2045 , 6 3 Cancer (constellation) , 7 3 Wikipedia , 8 3 Steel , 9 3 Orphanage , 10 3 Uno (card game) , 11 3 Trailer (movie) , 12 3 Richard Attenborough , 13 3 Flower , 14 3 Cage , 15 3 February 7 , 16 3 American Samoa , 17 3 Diaper , 18 3 Rainbow , 19 3 Jehovah's Witnesses , 20 3 Mario Party (series) , 21 3 Light pollution , 22 3 Korean War , 23 3 Jerry Lee Lewis , 24 3 Frank Zappa , 25 3 Seinfeld

mar 2005: 1 5 Francisco Hernández de Córdoba (Yucatán conquistador) , 2 5 Fibonacci , 3 4 Divisions of the Australian House of Representatives , 4 4 Alfred Sisley , 5 4 Vandalism , 6 4 Algebra , 7 3 Australian War Memorial , 8 3 Bernie Morris , 9 3 Ad Council , 10 3 Guy Carbonneau , 11 3 Europa , 12 3 Cheers , 13 3 September 26 , 14 3 Free will , 15 3 1973 , 16 3 Tunnel , 17 3 Somerset , 18 3 City of London , 19 3 Green , 20 2 Human , 21 2 Dickie Moore (ice hockey) , 22 2 Division of Flinders , 23 2 List of communities in Nova Scotia , 24 2 Greenwood, Nova Scotia , 25 2 Oxford, Nova Scotia

abr 2005: 1 12 Zacarias Moussaoui , 2 6 Daemon (computer software) , 3 5 Division of Higgins , 4 5 Main Page , 5 4 Australian War Memorial , 6 4 Ludwig Mies van der Rohe , 7 4 Periwinkle (color) , 8 4 Gábor Csupó , 9 4 The Who , 10 4 Pope John Paul II , 11 4 Cartoonist , 12 3 Colac, Victoria , 13 3 Bartlett's Familiar Quotations , 14 3 Francisco Hernández de Córdoba (Yucatán conquistador) , 15 3 International Ice Hockey Federation , 16 3 Alfred Sisley , 17 3 State Library of Victoria , 18 3 Second Fleet (Australia) , 19 3 Ararat, Victoria , 20 3 IRCd , 21 3 BBC Radio Scotland , 22 3 Hip hop , 23 3 1923 , 24 3 1904 , 25 3 Scandinavia

mai 2005: 1 6 Alfred Sisley , 2 6 Main Page , 3 5 List of ice hockey leagues , 4 5 Cancer (constellation) , 5 5 Pope John Paul II , 6 5 Homosexuality , 7 4 International Ice Hockey Federation , 8 4 Brandon Wheat Kings , 9 4 Jew , 10 4 Will Smith , 11 4 Pencil , 12 4 Earth , 13 3 Ludwig Mies van der Rohe , 14 3 Canadian Junior Hockey League , 15 3 United States , 16 3 A.C. Milan , 17 3 W. C. Fields , 18 3 Store , 19 3 Clint Eastwood , 20 3 Organic chemistry , 21 3 May 8 , 22 3 Buffy the Vampire Slayer , 23 3 January 17 , 24 3 Pope Benedict XVI , 25 3 January 15

jun 2005: 1 6 United States , 2 5 List of ice hockey leagues , 3 5 Cairo , 4 4 Queen Anne of Romania , 5 4 Jesus , 6 4 Scott Young (writer) , 7 4 Candidiasis , 8 4 Bent , 9 4 Kim Il-sung , 10 4 Calvin and Hobbes , 11 4 Audrey Hepburn , 12 4 Portugal , 13 4 China , 14 3 Division of Wannon , 15 3 Speaker of the Australian House of Representatives , 16 3 Ludwig Mies van der Rohe , 17 3 Honey War , 18 3 Zacarias Moussaoui , 19 3 Jersey (clothing) , 20 3 A minor , 21 3 Germany , 22 3 Northern League (baseball) , 23 3 Daemon (computer software) , 24 3 Astrodome , 25 3 Nirvana (band)

jul 2005: 1 7 London , 2 6 Discovery , 3 5 Ludwig Mies van der Rohe , 4 5 Neil Young , 5 5 Vladimir Nabokov , 6 5 Oscar Wilde , 7 5 Philosophy , 8 5 Music , 9 4 List of ice hockey leagues , 10 4 Northern League (baseball) , 11 4 Candidiasis , 12 4 Nirvana (band) , 13 4 Maceió (Brazil) , 14 4 Roberta Flack , 15 4 KC & the Sunshine Band , 16 4 The Specials , 17 4 Aaron Copland , 18 4 George Gershwin , 19 4 Costa Rica , 20 4 Steppenwolf , 21 4 Blue Öyster Cult , 22 4 The Cure , 23 4 John Williams , 24 4 Larry Mullen Jr. , 25 4 The Edge

ago 2005: 1 8 List of ice hockey leagues , 2 8 Pokémon (video game series) , 3 7 WWE Cruiserweight Championship (1991–2007) , 4 6 Astrodome , 5 5 Very High Bitrate Digital Subscriber Line , 6 5 George W. Bush , 7 4 Canadian Junior Hockey League , 8 4 Saku Koivu , 9 4 Candidiasis , 10 4 Testicle , 11 4 Bill Clinton , 12 4 Alan Turing , 13 3 Australian War Memorial , 14 3 Speaker of the Australian House of Representatives , 15 3 Ludwig Mies van der Rohe , 16 3 List of bridges to the Island of Montreal , 17 3 List of Montreal Canadiens players , 18 3 1942–43 NHL season , 19 3 Francisco Hernández de Córdoba (Yucatán conquistador) , 20 3 Jefferson Station (SEPTA) , 21 3 Alfred Sisley , 22 3 Greg Johnson , 23 3 Arup , 24 3 Monaro (New South Wales) , 25 3 Pikachu

set 2005: 1 20 Astrodome , 2 6 Candidiasis , 3 6 George W. Bush , 4 5 Division of Darling Downs , 5 5 Ludwig Mies van der Rohe , 6 4 Science Museum (London) , 7 4 Pip Skid , 8 4 Cancer (constellation) , 9 4 Mark , 10 4 Vice president , 11 3 Neville Bonner , 12 3 Saku Koivu , 13 3 List of Calgary Flames players , 14 3 Ocarina , 15 2 Stewiacke , 16 2 Dickie Moore (ice hockey) , 17 2 Division of Higgins , 18 2 List of NHL players (J) , 19 2 List of NHL players (B) , 20 2 List of Detroit Red Wings players , 21 2 List of Montreal Canadiens players , 22 2 Czech Extraliga , 23 2 List of subcamps of Stutthof , 24 2 List of subcamps of Kraków-Płaszów , 25 2 Cockatoo Island (New South Wales)

out 2005: 1 17 Hurricane Vince , 2 7 A (musical note) , 3 6 Edgar Allan Poe , 4 5 Ludwig Mies van der Rohe , 5 5 Cancer (constellation) , 6 5 Candidiasis , 7 5 Monica Lewinsky , 8 4 List of Montreal Canadiens players , 9 4 Science Museum (London) , 10 4 Swedish Academy , 11 4 Gene Hackman , 12 4 Hippopotamus , 13 4 Elton John , 14 4 Toledo, Ohio , 15 4 George W. Bush , 16 3 Subprefectures in France , 17 3 1968 Atlantic hurricane season , 18 3 William Shakespeare , 19 3 List of Canadian painters , 20 3 List of Detroit Red Wings players , 21 3 Airblue , 22 3 Southern Professional Hockey League , 23 3 Alfred Sisley , 24 3 Jimmy Creighton , 25 3 WWE Cruiserweight Championship (1991–2007)

nov 2005: 1 7 WWE Cruiserweight Championship (1991–2007) , 2 6 The Holocaust , 3 5 Science Museum (London) , 4 5 Freddie Mercury , 5 5 Thanksgiving , 6 5 George W. Bush , 7 4 2050 , 8 4 Zacarias Moussaoui , 9 4 List of ice hockey leagues , 10 4 Hurricane Vince , 11 4 Eric Staal , 12 4 Doug Bentley , 13 4 Wade Redden , 14 4 Daemon (computer software) , 15 4 Candidiasis , 16 4 Astrodome , 17 4 Satan , 18 4 1468 , 19 4 Cambridgeshire , 20 4 Full Metal Jacket , 21 4 1915 , 22 4 Xbox 360 , 23 4 Love , 24 4 1986 , 25 4 1985

dez 2005: 1 8 Penis , 2 8 Sex , 3 7 List of ice hockey leagues , 4 7 Mark , 5 7 The Holocaust , 6 7 George W. Bush , 7 7 Dog , 8 6 Jew , 9 6 Jimmy Wales , 10 6 Rape , 11 5 No Fences , 12 5 Ryan Miller , 13 5 Saku Koivu , 14 5 Santa Claus , 15 5 Leet , 16 5 Joseph Stalin , 17 5 Zoology , 18 4 Queen Anne of Romania , 19 4 Naturalism (arts) , 20 4 Star Wars Episode IV: A New Hope , 21 4 Something Awful , 22 4 Shit , 23 4 Bob Barker , 24 4 Quantum mechanics , 25 4 Money

jan 2006: 1 11 Mark , 2 8 Chile , 3 7 Paul Bunyan , 4 7 United States , 5 7 Astrodome , 6 7 Adolf Hitler , 7 7 George W. Bush , 8 6 16-cell , 9 6 Cancer (constellation) , 10 6 Candidiasis , 11 6 List of Calgary Flames players , 12 6 The Holocaust , 13 6 Penis , 14 6 Wolfgang Amadeus Mozart , 15 5 Australian War Memorial , 16 5 Ken Wregget , 17 5 Taylor Chorney , 18 5 Hurricane Vince , 19 5 Oral candidiasis , 20 5 Holocaust , 21 5 Vagina , 22 5 Cuba , 23 4 Colac, Victoria , 24 4 List of Montreal Canadiens players , 25 4 Saku Koivu

fev 2006: 1 12 Mark , 2 9 Saku Koivu , 3 8 WWE Cruiserweight Championship (1991–2007) , 4 8 Astrodome , 5 7 Zacarias Moussaoui , 6 7 Hurricane Vince , 7 6 Larry Aurie , 8 6 Alex Auld , 9 6 The Holocaust , 10 5 List of ice hockey leagues , 11 5 State Library of Victoria , 12 5 A minor , 13 5 Canada , 14 5 Bukit Timah , 15 5 Very High Bitrate Digital Subscriber Line , 16 5 Holocaust , 17 5 Movie , 18 5 Cat , 19 4 2045 , 20 4 1968 Atlantic hurricane season , 21 4 International Ice Hockey Federation , 22 4 Ryan Miller , 23 4 Jake Forbes , 24 4 Katie Weatherston , 25 4 Paul Bunyan

mar 2006: 1 35 Zacarias Moussaoui , 2 9 Mark , 3 7 Australian War Memorial , 4 7 Saku Koivu , 5 7 Paul Bunyan , 6 7 Hurricane Vince , 7 7 Jimmy Wales , 8 6 Ludwig Mies van der Rohe , 9 6 Germany , 10 6 Christianity , 11 6 United States , 12 6 Holocaust , 13 6 Cannabis , 14 6 Adolf Hitler , 15 6 Defense (military) , 16 6 Copyright , 17 6 Farming , 18 5 Queen Anne of Romania , 19 5 Feral , 20 5 Science Museum (London) , 21 5 List of ice hockey leagues , 22 5 Pluto , 23 5 Spain , 24 5 Canada , 25 5 Eric Staal

abr 2006: 1 43 Zacarias Moussaoui , 2 9 WWE Cruiserweight Championship (1991–2007) , 3 8 Holocaust , 4 7 List of ice hockey leagues , 5 7 Saku Koivu , 6 7 Xbox (console) , 7 6 Queen Anne of Romania , 8 6 Wade Redden , 9 6 Astrodome , 10 5 Daniel Jacobs , 11 5 Australian War Memorial , 12 5 Ludwig Mies van der Rohe , 13 5 Airblue , 14 5 Central Canada Hockey League , 15 5 Alex Auld , 16 5 Paul Bunyan , 17 5 Hurricane Vince , 18 5 Christianity , 19 5 Cancer (constellation) , 20 5 Candidiasis , 21 5 Iraq , 22 5 Abortion , 23 5 Anus , 24 5 Hinduism , 25 4 Aylesford, Nova Scotia

mai 2006: 1 124 Zacarias Moussaoui , 2 13 WWE Cruiserweight Championship (1991–2007) , 3 13 Mark , 4 11 Ryan Miller , 5 10 Cancer (constellation) , 6 9 Earthworm , 7 8 Prostatitis , 8 8 Paul Bunyan , 9 8 Hurricane Vince , 10 7 PBS Kids Go! , 11 7 Brown tree snake , 12 7 The Simpsons , 13 6 Queen Anne of Romania , 14 6 Canada , 15 6 Daemon (computer software) , 16 6 Wikipedia , 17 6 Holocaust , 18 6 Baseball , 19 5 United States , 20 5 Wade Redden , 21 5 Candidiasis , 22 5 Europa , 23 5 Wikispecies , 24 5 Deer , 25 5 Sherpa

jun 2006: 1 11 Jordan Staal , 2 10 Eric Staal , 3 9 2026 , 4 8 Alex Auld , 5 7 Airblue , 6 7 Sexual intercourse , 7 6 2050 , 8 6 List of NHL players (A) , 9 6 Zacarias Moussaoui , 10 6 WWE Cruiserweight Championship (1991–2007) , 11 6 Wade Redden , 12 5 List of NHL players (J) , 13 5 List of NHL players (C) , 14 5 Hurricane Vince , 15 5 Spain , 16 5 Daemon (computer software) , 17 5 Candidiasis , 18 5 Mark , 19 5 Astrodome , 20 5 Smallpox , 21 5 Gay , 22 5 Pythagoras , 23 4 Colac, Victoria , 24 4 Ludwig Mies van der Rohe , 25 4 List of NHL players (B)

jul 2006: 1 17 WWE Cruiserweight Championship (1991–2007) , 2 10 Candidiasis , 3 10 Sex , 4 8 Mark , 5 7 Airblue , 6 7 Taylor Pyatt , 7 7 United States , 8 6 Daniel Jacobs , 9 6 2026 , 10 6 List of Montreal Canadiens players , 11 6 Astrodome , 12 6 Jimmy Wales , 13 5 Saku Koivu , 14 5 Marc Staal , 15 5 Scott Young (ice hockey b. 1967) , 16 5 Domestic violence , 17 5 Wikipedia , 18 5 Feces , 19 5 Philippines , 20 4 PBS Kids Go! , 21 4 2050 , 22 4 List of NHL players (A) , 23 4 Zacarias Moussaoui , 24 4 Ryan Miller , 25 4 Prostatitis

ago 2006: 1 13 Zacarias Moussaoui , 2 13 Astrodome , 3 13 African-American people , 4 12 Wikipedia , 5 12 Jimmy Wales , 6 10 Paul Bunyan , 7 9 Pornography , 8 9 Nigger , 9 8 Candidiasis , 10 8 Martin Luther King, Jr. , 11 7 Lesbian , 12 7 Taiwan , 13 6 Broughton, Nova Scotia , 14 6 List of ice hockey leagues , 15 6 Pescara , 16 6 Dwarf planet , 17 6 Nucleophilic substitution , 18 6 Dick Cheney , 19 6 Homosexuality , 20 6 Planet , 21 5 Australian War Memorial , 22 5 Ludwig Mies van der Rohe , 23 5 List of Canadian painters , 24 5 List of Montreal Canadiens players , 25 5 Pluto

set 2006: 1 14 Lesbian , 2 10 Ludwig Mies van der Rohe , 3 10 Astrodome , 4 9 Zacarias Moussaoui , 5 9 Candidiasis , 6 9 Steve Irwin , 7 8 WWE Cruiserweight Championship (1991–2007) , 8 8 Atheism , 9 7 Saku Koivu , 10 7 Paul Bunyan , 11 7 Spain , 12 7 Mark , 13 7 Hong Kong , 14 7 Terrorism , 15 6 Oleg Tverdovsky , 16 6 Pythagoras , 17 6 Philippines , 18 6 England , 19 5 Canada , 20 5 Cancer (constellation) , 21 5 Legacy , 22 5 Ubuntu , 23 5 Anthony Kiedis , 24 5 Unit circle , 25 5 Air gun

out 2006: 1 13 Candidiasis , 2 10 Wikipedia , 3 9 Ludwig Mies van der Rohe , 4 9 WWE Cruiserweight Championship (1991–2007) , 5 8 Feral , 6 8 Gay , 7 8 Singapore , 8 8 Adolf Hitler , 9 7 Prostatitis , 10 6 William Shakespeare , 11 6 Greg Johnson , 12 6 Judaism , 13 6 Jesus , 14 6 Mark , 15 6 RuneScape , 16 6 The Beatles , 17 6 Cat , 18 5 List of Tom and Jerry video games , 19 5 Swag , 20 5 List of Montreal Canadiens players , 21 5 Jordan Staal , 22 5 Paul Bunyan , 23 5 Islam , 24 5 Eric Staal , 25 5 Guy Carbonneau

nov 2006: 1 14 Paul Bunyan , 2 13 Mark , 3 10 WWE Cruiserweight Championship (1991–2007) , 4 10 Mormonism , 5 9 Bill Gates , 6 9 Adolf Hitler , 7 8 Ludwig Mies van der Rohe , 8 8 Holocaust , 9 8 France , 10 7 United States , 11 7 Jesus , 12 7 Wikipedia , 13 7 Uruguay , 14 7 Fire , 15 6 Ryan Miller , 16 6 Death mask , 17 6 Saku Koivu , 18 6 Gábor Csupó , 19 6 Christianity , 20 6 Darth Vader , 21 6 Cult , 22 6 California Gold Rush , 23 6 Monkey , 24 6 Botswana , 25 6 Singapore

dez 2006: 1 13 Judaism , 2 12 WWE Cruiserweight Championship (1991–2007) , 3 10 Colac, Victoria , 4 10 Mark , 5 9 Jesus , 6 9 Gerard Way , 7 9 Wiki , 8 8 Ludwig Mies van der Rohe , 9 8 Saku Koivu , 10 8 Alcohol , 11 7 Paul Bunyan , 12 7 Christianity , 13 7 Michael Jackson , 14 7 Charles Dickens , 15 7 Apple , 16 6 Allan Cup , 17 6 Cancer (constellation) , 18 6 Candidiasis , 19 6 Brown tree snake , 20 6 List of acronyms and initialisms , 21 6 George Michael , 22 6 Wikipedia , 23 6 Wii , 24 6 Holocaust , 25 6 Concentration camp

jan 2007: 1 13 Cancer (constellation) , 2 12 WWE Cruiserweight Championship (1991–2007) , 3 11 Carey Price , 4 11 Candidiasis , 5 11 Mark , 6 10 Ryan Miller , 7 10 Paul Bunyan , 8 9 Ludwig Mies van der Rohe , 9 9 Astrodome , 10 7 United States , 11 7 Apple Inc. , 12 6 Queen Anne of Romania , 13 6 Zacarias Moussaoui , 14 6 Alfred Sisley , 15 6 Saku Koivu , 16 6 Sexual intercourse , 17 6 Judaism , 18 6 Europa , 19 6 50 Cent , 20 6 Anal sex , 21 6 Movie , 22 6 England , 23 6 Association football , 24 5 2050 , 25 5 Southern Professional Hockey League

fev 2007: 1 24 WWE Cruiserweight Championship (1991–2007) , 2 15 Paul Bunyan , 3 12 United States , 4 12 September 11 attacks , 5 10 Candidiasis , 6 9 Jordan Staal , 7 9 Mark , 8 8 Spain , 9 8 Astrodome , 10 8 Cannabis , 11 8 Global warming , 12 7 World War II , 13 7 Cancer (constellation) , 14 7 Hillary Clinton , 15 7 France , 16 6 List of Canadian painters , 17 6 List of Detroit Red Wings players , 18 6 Ryan Miller , 19 6 Eric Staal , 20 6 Daemon (computer software) , 21 6 Michael Jackson , 22 6 Napoléon Bonaparte , 23 6 George Washington , 24 6 Vietnam War , 25 6 Terrorism

mar 2007: 1 15 Jordan Staal , 2 12 Paul Bunyan , 3 12 Cancer (constellation) , 4 12 Mark , 5 10 Saku Koivu , 6 9 Emergency medical services in the United Kingdom , 7 8 Spain , 8 8 Global warming , 9 8 American Civil War , 10 8 Google , 11 7 2050 , 12 7 WWE Cruiserweight Championship (1991–2007) , 13 7 United States , 14 7 Car , 15 7 Candidiasis , 16 6 Daniel Jacobs , 17 6 List of NHL players (B) , 18 6 Eric Staal , 19 6 Astrodome , 20 6 Cannabis , 21 6 Death penalty , 22 6 Middle Ages , 23 6 Abraham Lincoln , 24 6 The Holocaust , 25 6 Alcohol

abr 2007: 1 12 Ryan Miller , 2 11 Mark , 3 9 Paul Bunyan , 4 7 Saku Koivu , 5 7 HC Dynamo Moscow , 6 7 WWE Cruiserweight Championship (1991–2007) , 7 7 World War II , 8 7 Canada , 9 7 Astrodome , 10 7 Amazon rainforest , 11 7 Engineering , 12 7 God , 13 6 2050 , 14 6 Ludwig Mies van der Rohe , 15 6 Jordan Staal , 16 6 Islam , 17 6 United States , 18 6 Cancer (constellation) , 19 6 Little Red Riding Hood , 20 6 Abraham Lincoln , 21 6 Alcohol , 22 6 Egypt , 23 5 List of NHL players (B) , 24 5 List of ice hockey leagues , 25 5 Christianity

mai 2007: 1 14 List of Wikipedias , 2 14 Ryan Miller , 3 12 Mark , 4 11 Saku Koivu , 5 10 Islam , 6 9 Ludwig Mies van der Rohe , 7 9 Paul Bunyan , 8 9 Eric Staal , 9 8 William Shakespeare , 10 8 Taylor Pyatt , 11 8 Jordan Staal , 12 8 Wade Redden , 13 8 Candidiasis , 14 7 List of ice hockey leagues , 15 7 Sexual intercourse , 16 7 Brown tree snake , 17 7 Manchester United F.C. , 18 6 WWE Cruiserweight Championship (1991–2007) , 19 6 World War II , 20 6 Car , 21 6 Dingo , 22 6 Rocky Marciano , 23 6 Monkey , 24 6 Rape , 25 6 Grey wolf

jun 2007: 1 15 Mark , 2 11 Frieza , 3 11 Zarbon , 4 10 Dodoria , 5 10 My Chemical Romance , 6 9 Bear , 7 9 Penis , 8 8 List of Wikipedias , 9 8 WWE Cruiserweight Championship (1991–2007) , 10 8 Vince McMahon , 11 7 Ludwig Mies van der Rohe , 12 7 RuneScape , 13 7 Justin Timberlake , 14 6 List of NHL players (J) , 15 6 Alex Plante , 16 6 Saku Koivu , 17 6 Sexual intercourse , 18 6 Paul Bunyan , 19 6 Christianity , 20 6 Judaism , 21 6 Carey Price , 22 6 Candidiasis , 23 6 Giant panda , 24 6 Anal sex , 25 6 Cannabis

jul 2007: 1 27 WWE Cruiserweight Championship (1991–2007) , 2 9 Main Page , 3 9 Harry Potter , 4 8 List of Wikipedias , 5 8 Zacarias Moussaoui , 6 8 Eric Staal , 7 8 M×0 , 8 8 D.Gray-man , 9 7 Daemon (computer software) , 10 7 Candidiasis , 11 6 List of NHL players (B) , 12 6 I'm with You , 13 6 Harry Potter and the Deathly Hallows , 14 6 Evolution , 15 6 Dog , 16 5 Paul Bunyan , 17 5 Quebec Bulldogs , 18 5 Avril Lavigne , 19 5 Nicky Hilton , 20 5 Miss World , 21 5 Donald Trump , 22 5 Yamaha Corporation , 23 5 Takao , 24 5 Bleach (manga) , 25 5 Lily Allen

ago 2007: 1 12 WWE Cruiserweight Championship (1991–2007) , 2 9 Sexual intercourse , 3 8 Periwinkle (color) , 4 8 Main Page/Test 1 , 5 8 50 Cent , 6 8 Chopsticks , 7 7 List of Wikipedias , 8 7 Main Page , 9 7 A minor , 10 7 Mark , 11 7 BBC Radio 1Xtra , 12 7 Hanami , 13 7 Jimi Hendrix , 14 7 India , 15 6 Airblue , 16 6 Zacarias Moussaoui , 17 6 First Time , 18 6 Candidiasis , 19 6 BBC Radio 5 Live Sports Extra , 20 6 American Staffordshire Terrier , 21 6 Intelligent design , 22 6 Names for large numbers , 23 6 Little Red Riding Hood , 24 6 Ho Chi Minh , 25 6 The Simpsons

set 2007: 1 20 WWE Cruiserweight Championship (1991–2007) , 2 13 Mark , 3 12 Paul Bunyan , 4 8 Brown tree snake , 5 8 Evolution , 6 7 List of Wikipedias , 7 7 United States , 8 7 Edgar the Atheling , 9 7 Catholicism , 10 7 Encyclopedia , 11 6 Feral , 12 6 Candidiasis , 13 6 Software piracy , 14 6 Kitzmiller, et al. v. Dover Area School District, et al. , 15 6 Crusade , 16 5 Cassi Davis , 17 5 William Shakespeare , 18 5 Main Page , 19 5 Christianity , 20 5 Car , 21 5 Paneuropean Picnic , 22 5 Cuban Missile Crisis , 23 5 Lysergic acid diethylamide , 24 5 United States Constitution , 25 5 John Howard

out 2007: 1 11 Candidiasis , 2 9 WWE Cruiserweight Championship (1991–2007) , 3 9 United States , 4 9 Mark , 5 8 Paul Bunyan , 6 8 Carey Price , 7 8 Justin Timberlake , 8 8 Global warming , 9 7 Saku Koivu , 10 7 Very High Bitrate Digital Subscriber Line , 11 7 Wikipedia , 12 6 World War II , 13 6 Germany , 14 6 Judaism , 15 6 Northern League (baseball) , 16 6 School , 17 6 Arab people , 18 6 Great Depression , 19 6 Warcraft , 20 6 PlayStation 3 , 21 6 Edgar Allan Poe , 22 6 Caffeine , 23 6 George Washington , 24 6 Dog , 25 6 Cat

nov 2007: 1 11 Paul Bunyan , 2 11 Sandy Robson , 3 9 Carey Price , 4 9 Australia , 5 8 Saku Koivu , 6 8 Candidiasis , 7 8 Brown tree snake , 8 8 Thanksgiving , 9 8 Apple , 10 7 United States , 11 7 Mark , 12 7 Kevin Rudd , 13 7 Chiara Zanni , 14 7 Cristiano Ronaldo , 15 7 Nuclear power , 16 7 Penis , 17 6 Division of Wakefield , 18 6 Jordan Staal , 19 6 Islam , 20 6 School , 21 6 Chuck Norris , 22 6 Alan Carr , 23 6 Elizabeth I of England , 24 6 Cloud , 25 6 Galileo Galilei

dez 2007: 1 18 List of Tom and Jerry video games , 2 10 Ludwig Mies van der Rohe , 3 8 Paul Bunyan , 4 8 World War II , 5 8 United States , 6 8 Sari , 7 8 Xbox 360 , 8 7 Ryan Miller , 9 7 Chuck Norris facts , 10 7 Warhammer 40,000 , 11 7 Jimi Hendrix , 12 7 Pokémon (video game series) , 13 7 Muhammad , 14 7 Nazism , 15 7 Global warming , 16 6 Division of Ballarat , 17 6 Eric Staal , 18 6 The Queen Vic , 19 6 Radwimps , 20 6 Brett Lee , 21 6 Diplodocus , 22 6 Tourette syndrome , 23 6 United States Declaration of Independence , 24 6 Christmas , 25 6 Foot

jan 2008: 1 16 Paul Bunyan , 2 11 William Shakespeare , 3 9 List of Tom and Jerry video games , 4 9 United States , 5 8 Jesus , 6 8 Britney Spears , 7 8 Alcohol , 8 7 Ludwig Mies van der Rohe , 9 7 Ryan Miller , 10 7 Calvin Harris , 11 7 RuneScape , 12 7 Newbie , 13 7 Bono , 14 7 Evolution , 15 7 Italy , 16 6 Saku Koivu , 17 6 Car , 18 6 Eric Staal , 19 6 Mark , 20 6 Romeo + Juliet , 21 6 Moulin Rouge! , 22 6 Group 0 , 23 6 Mean Girls , 24 6 Static RAM , 25 6 Cuban Missile Crisis

fev 2008: 1 16 United States , 2 14 Jesus , 3 13 Mark , 4 12 Carey Price , 5 11 Islam , 6 9 Paul Bunyan , 7 9 Moulin Rouge! , 8 9 RuneScape , 9 9 Prostitution , 10 8 List of ice hockey leagues , 11 8 Ryan Miller , 12 8 Jordan Staal , 13 8 World War I , 14 8 Simple English Wikipedia , 15 8 Coffee , 16 7 Glen Hanlon , 17 7 Eric Staal , 18 7 Carbon footprint , 19 7 Plain White T's , 20 7 Kosovo , 21 7 Pipe organ , 22 7 Volcano , 23 7 Adolf Hitler , 24 7 Buddhism , 25 7 Government

mar 2008: 1 12 Carey Price , 2 12 Mark , 3 10 Paul Bunyan , 4 9 Ludwig Mies van der Rohe , 5 9 World War I , 6 9 IPod , 7 8 List of Wikipedias , 8 8 Zacarias Moussaoui , 9 8 List of ice hockey leagues , 10 8 Ryan Miller , 11 8 United States , 12 8 Classical Athens , 13 8 Gorilla , 14 7 Germany , 15 7 Islam , 16 7 Canada , 17 7 Proxy server , 18 7 Newbie , 19 7 United Kingdom , 20 7 Tree , 21 6 William Shakespeare , 22 6 Saku Koivu , 23 6 Wade Redden , 24 6 Hannah Montana , 25 6 Chris Benoit

abr 2008: 1 16 Kontinental Hockey League , 2 13 Mark , 3 12 Carey Price , 4 10 Newbie , 5 9 William Shakespeare , 6 8 Jesus , 7 8 IRCd , 8 7 Saku Koivu , 9 7 United States , 10 7 Cancer (constellation) , 11 7 Gandhi (band) , 12 7 Baseball , 13 7 Poland , 14 7 Earthquake , 15 7 Association football , 16 7 God , 17 6 List of Wikipedias , 18 6 List of ice hockey leagues , 19 6 Jordan Staal , 20 6 Paul Bunyan , 21 6 Billy Graham , 22 6 Halo 3 , 23 6 Indiana Jones and the Kingdom of the Crystal Skull , 24 6 Seedling , 25 6 Transcendental Meditation

mai 2008: 1 15 Carey Price , 2 13 Dog , 3 10 Ludwig Mies van der Rohe , 4 10 Jordan Staal , 5 10 Paul Bunyan , 6 10 World War I , 7 10 United States , 8 10 Animal Farm , 9 9 Kontinental Hockey League , 10 8 Old Major (Animal Farm) , 11 8 Giant panda , 12 8 Michael Jackson , 13 7 Neville Bonner , 14 7 Americas , 15 7 Billy Graham , 16 7 Guy Carbonneau , 17 7 Cancer (constellation) , 18 7 OGame , 19 7 Boxer (Animal Farm) , 20 7 Cuban Missile Crisis , 21 7 History of the world , 22 7 Pornography , 23 7 George Washington , 24 7 Buddhism , 25 6 PBS Kids Go!

jun 2008: 1 12 Paul Bunyan , 2 10 William Shakespeare , 3 9 Baseball uniform , 4 8 Islam , 5 8 High School Musical 3: Senior Year , 6 8 Charles Spurgeon , 7 8 Cheese , 8 7 Kontinental Hockey League , 9 7 United States , 10 7 Carey Price , 11 7 Ana Ivanović , 12 7 Parental advisory , 13 7 Rubik's Cube , 14 7 England , 15 7 LOL , 16 6 Germany , 17 6 Daemon (computer software) , 18 6 Mark , 19 6 Naas , 20 6 Get Smart , 21 6 She , 22 6 Mysticeti , 23 6 Kudu , 24 6 Polar bear , 25 6 PlayStation 3

jul 2008: 1 19 Kontinental Hockey League , 2 14 Jessica Alba , 3 12 Lab Rats , 4 11 Powderfinger , 5 10 Wade Redden , 6 9 Baseball uniform , 7 8 List of Canadian painters , 8 8 Daniela Hantuchová , 9 8 American Airlines Flight 11 , 10 8 Scottish Premier League , 11 8 Chess , 12 7 Alex Auld , 13 7 Langston University , 14 7 Paul Bunyan , 15 7 Main Page/Introduction , 16 7 Charles Spurgeon , 17 7 Mass Rapid Transit (Singapore) , 18 7 NASA , 19 7 Gun , 20 6 Ryan Johnson , 21 6 Arup , 22 6 Mark , 23 6 Wicca rock , 24 6 Andre Agassi , 25 6 WWE The Great American Bash

ago 2008: 1 12 Cassi Davis , 2 12 LaVan Davis , 3 11 Hurricane Vince , 4 11 Powderfinger , 5 11 2008 Summer Olympics , 6 10 Lab Rats , 7 10 Evolution , 8 10 Charles Darwin , 9 9 Kontinental Hockey League , 10 9 Sarah Palin , 11 8 Human , 12 8 List of Canadian painters , 13 8 Jesus , 14 8 Homeopathy , 15 8 Simple English Wikipedia , 16 8 Neopets , 17 7 Main Page , 18 7 Gumby , 19 7 Charlotte's Web (1973 movie) , 20 7 2008 South Ossetia war , 21 7 Main Page/Introduction , 22 7 Mass Rapid Transit (Singapore) , 23 7 RAID , 24 7 Gene , 25 7 Jupiter

set 2008: 1 17 Kontinental Hockey League , 2 15 LaVan Davis , 3 11 Sarah Palin , 4 9 Saku Koivu , 5 9 Rick Riordan , 6 9 Main Page , 7 9 Dipsy , 8 8 Cassi Davis , 9 8 Oklahoma , 10 8 Green Day , 11 7 Australian War Memorial , 12 7 2050 , 13 7 Science Museum (London) , 14 7 Whitey Wistert , 15 7 Laa-Laa , 16 7 Po (Teletubby) , 17 7 Paul Newman , 18 7 RAID , 19 7 Big Bang , 20 7 Dog , 21 6 Jesus , 22 6 Halo 3 , 23 6 Cell , 24 6 Brother Bear 2 , 25 6 Iranian coup d'etat (1953)

out 2008: 1 18 Paul Bunyan , 2 10 List of Canadian painters , 3 10 Kontinental Hockey League , 4 10 Saku Koivu , 5 10 Sligo Rovers F.C. , 6 9 International , 7 9 Main Page , 8 9 Halo 3 , 9 9 Sniper , 10 8 LaVan Davis , 11 8 Rick Riordan , 12 8 Jonas Brothers , 13 8 Jimi Hendrix , 14 8 Pornography , 15 7 Mark , 16 7 Bambi , 17 7 Seismic retrofit , 18 7 Paris , 19 6 Ludwig Mies van der Rohe , 20 6 United States , 21 6 Wade Redden , 22 6 Cancer (constellation) , 23 6 Derrick Pierce , 24 6 Mathew Turner , 25 6 Victory

nov 2008: 1 20 Barack Obama , 2 13 Mark , 3 12 Bop It , 4 11 LaVan Davis , 5 10 Hot chocolate , 6 9 Airblue , 7 8 List of Canadian painters , 8 8 Paul Bunyan , 9 8 Manchester , 10 8 Penis , 11 7 United States , 12 7 2008 Mumbai attacks , 13 7 Phetchabun , 14 7 Giant panda , 15 7 Nudity , 16 7 France , 17 6 Australian War Memorial , 18 6 Kontinental Hockey League , 19 6 Saku Koivu , 20 6 Rick Riordan , 21 6 Main Page , 22 6 Miley Cyrus , 23 6 Cancer (constellation) , 24 6 Trang , 25 6 Crich Tramway Village

dez 2008: 1 11 Paul Bunyan , 2 10 Kontinental Hockey League , 3 10 Penis , 4 9 Ludwig Mies van der Rohe , 5 9 Santa Claus , 6 8 Barack Obama , 7 8 Headset , 8 8 George W. Bush , 9 7 Thermocouple , 10 7 Supercomputer , 11 7 MRI , 12 7 Blackpool tramway , 13 7 Joseph Stalin , 14 6 Rick Riordan , 15 6 Main Page , 16 6 United States , 17 6 Mark , 18 6 Static electricity , 19 6 Standard-definition television , 20 6 Hydrogen car , 21 6 South Thailand insurgency , 22 6 Airbag , 23 6 Adolf Hitler , 24 5 Human , 25 5 Septicemic plague

jan 2009: 1 13 Barack Obama , 2 12 Kontinental Hockey League , 3 12 Paul Bunyan , 4 9 United States , 5 9 Daniela Hantuchová , 6 8 Stanley Armour Dunham , 7 8 World War II , 8 8 Nudity , 9 8 Joseph Stalin , 10 8 Adolf Hitler , 11 8 George W. Bush , 12 8 Romania , 13 7 Marian Shields Robinson , 14 7 Ludwig Mies van der Rohe , 15 7 Sexual intercourse , 16 7 Encyclopedia Dramatica , 17 7 Feces , 18 7 Japan , 19 6 Periwinkle (color) , 20 6 Jordan Staal , 21 6 Harry Potter , 22 6 Jesus , 23 6 Mydoom , 24 6 Phosgene , 25 6 Avril Lavigne

fev 2009: 1 20 Barack Obama , 2 17 WrestleMania XXVI , 3 15 Wikipedia , 4 14 Sexual intercourse , 5 14 List of colors , 6 13 Paul Bunyan , 7 12 Car , 8 12 Sniper , 9 10 Grand Olympic Auditorium , 10 10 Large Hadron Collider , 11 9 Swahili Wikipedia , 12 9 Penis , 13 9 George W. Bush , 14 9 Dog , 15 9 Mathematics , 16 9 Internet , 17 8 Jesus , 18 8 Baseball uniform , 19 8 Anna Kournikova , 20 8 New York City , 21 7 Marian Shields Robinson , 22 7 William Shakespeare , 23 7 Christianity , 24 7 Bop It , 25 7 Simple English Wikipedia

mar 2009: 1 18 Barack Obama , 2 17 WrestleMania XXVI , 3 17 Jimmy Wales , 4 15 Guy Carbonneau , 5 12 Wikipedia , 6 11 Hermann Göring , 7 11 Cheese , 8 9 United States , 9 9 Bop It , 10 9 Large Hadron Collider , 11 9 Message (computer science) , 12 9 Computer , 13 8 Color of the day (police) , 14 8 Snow White and the Seven Dwarfs (1937 movie) , 15 8 Crich Tramway Village , 16 8 Ben Hall , 17 8 Pope John Paul II , 18 8 Cat , 19 8 Internet , 20 7 Ryan Miller , 21 7 Sexual intercourse , 22 7 Jesus , 23 7 Car , 24 7 Walt Poddubny , 25 7 Autofellatio

abr 2009: 1 14 Color blindness , 2 13 George W. Bush , 3 12 WrestleMania XXVI , 4 12 Mosque , 5 11 Barack Obama , 6 9 World War I , 7 9 Swine influenza , 8 9 Ernst Röhm , 9 9 Wikipedia , 10 9 Cat , 11 8 Paul Bunyan , 12 8 United States , 13 8 Battle of Gettysburg , 14 8 Asshole , 15 8 Cuban Missile Crisis , 16 8 Refrigerator , 17 8 Pope John Paul II , 18 7 Taylor Pyatt , 19 7 Jordan Staal , 20 7 Rick Riordan , 21 7 World War II , 22 7 Hannah Montana , 23 7 Dave Thomas , 24 7 AIDS , 25 7 Epilepsy

mai 2009: 1 13 Paul Bunyan , 2 12 Eric Staal , 3 12 Cheese , 4 11 Darius Danesh , 5 11 Teletubbies , 6 10 Adolf Hitler , 7 9 Hurricane Ismael , 8 9 Jonas Brothers , 9 9 Mormonism , 10 9 Leonardo da Vinci , 11 9 Star , 12 9 Internet , 13 8 Australian War Memorial , 14 8 World War I , 15 8 Swine influenza , 16 8 Simple English Wikipedia , 17 8 Down syndrome , 18 8 Cat , 19 7 International Ice Hockey Federation , 20 7 Rick Riordan , 21 7 Jesus , 22 7 Huang Xianfan , 23 7 Wikipedia , 24 7 George W. Bush , 25 7 Black hole

jun 2009: 1 27 Michael Jackson , 2 11 Earth , 3 10 Australian War Memorial , 4 9 Stanley Armour Dunham , 5 8 Daniel Tosh , 6 7 2009–10 NHL season , 7 7 Sexual intercourse , 8 7 London Underground 1967 Stock , 9 7 Simple English Wikipedia , 10 7 Wikipedia , 11 7 Jessica Alba , 12 7 Dog , 13 7 Cheese , 14 6 List of ice hockey leagues , 15 6 Jordan Staal , 16 6 World War II , 17 6 United States , 18 6 The Wave 96.4 FM , 19 6 Foot binding , 20 6 Bubble tea , 21 6 WrestleMania XXVI , 22 6 Ghana , 23 6 Ludwig van Beethoven , 24 5 Colac, Victoria , 25 5 William Shakespeare

jul 2009: 1 13 Italy , 2 12 2009–10 NHL season , 3 12 Michael Jackson , 4 10 Saku Koivu , 5 10 Jupiter , 6 8 Daniel Tosh , 7 8 Wernher von Braun , 8 8 Earth , 9 7 United States , 10 7 Victoria line , 11 7 WrestleMania XXVI , 12 7 Jimmy Wales , 13 7 Woodrow Wilson , 14 7 Chat , 15 6 List of Wikipedias , 16 6 Sexual intercourse , 17 6 Wikipedia , 18 6 Sex , 19 5 Ludwig Mies van der Rohe , 20 5 List of ice hockey leagues , 21 5 Basic English , 22 5 Adobe Reader , 23 5 Buffalo , 24 5 Hinglaj Mata , 25 5 University of Balochistan

ago 2009: 1 20 List of 20th Century Fox movies , 2 15 India , 3 12 Earth , 4 10 Abraham Lincoln , 5 9 Ludwig Mies van der Rohe , 6 9 WrestleMania XXVI , 7 9 Wikipedia , 8 8 MissingNo. , 9 8 2009 Atlantic hurricane season , 10 8 Philippines , 11 8 God , 12 7 Daniel Tosh , 13 7 Essjay controversy , 14 7 Joe Biden , 15 7 20th Century Fox , 16 6 Australian War Memorial , 17 6 2009–10 NHL season , 18 6 Jesse Helms , 19 6 Victoria line , 20 6 Hemis National Park , 21 6 1492 Pictures , 22 6 Cannabis , 23 6 Michael Jackson , 24 6 Water cycle , 25 5 List of Canadian painters

set 2009: 1 14 Michael Jackson , 2 13 Paul Bunyan , 3 12 Bella Thorne , 4 11 Barack Obama , 5 10 Jupiter , 6 9 List of Wikipedias , 7 9 Rick Riordan , 8 9 WrestleMania XXVI , 9 9 Evolution , 10 8 2009–10 NHL season , 11 8 Leonese language , 12 8 Joe Biden , 13 8 Adolf Hitler , 14 7 Australian War Memorial , 15 7 List of bridges to the Island of Montreal , 16 7 Siege of Fort Zeelandia , 17 7 Linkin Park , 18 7 Atheism , 19 7 France , 20 6 Dave Pasch , 21 6 Anton Babchuk , 22 6 World War I , 23 6 Vikings , 24 6 Race (sociology) , 25 6 Napoleon II of France

out 2009: 1 17 2009–10 NHL season , 2 12 Paul Bunyan , 3 11 Wikipedia , 4 10 Daniel Tosh , 5 9 Barack Obama , 6 8 Bella Thorne , 7 8 World War I , 8 8 Norwegian Nobel Committee , 9 8 Justin Bieber , 10 8 Moon landing conspiracy theory , 11 8 Martin Luther King, Jr. , 12 7 Sexual intercourse , 13 7 United States , 14 7 Bukit Timah , 15 7 WrestleMania XXVI , 16 7 Manchester , 17 7 Illegal drugs , 18 7 Hyderabad, India , 19 7 Michael Jackson , 20 7 Kurt Cobain , 21 6 List of Wikipedias , 22 6 Harry Potter , 23 6 United States Declaration of Independence , 24 6 Horse , 25 6 Alexander Graham Bell

nov 2009: 1 33 Jimmy Wales , 2 12 Jesus , 3 12 Michael Jackson , 4 11 Daniel Tosh , 5 11 Lady Gaga , 6 10 Barack Obama , 7 10 WrestleMania XXVI , 8 10 Illegal drugs , 9 10 Pie , 10 9 Ludwig Mies van der Rohe , 11 9 Dog , 12 8 Simple English Wikipedia , 13 8 Robert Enke , 14 8 Christopher Columbus , 15 8 Cat , 16 8 Australia , 17 7 Stanley Armour Dunham , 18 7 Miley Cyrus , 19 7 Twilight (series) , 20 7 Baby , 21 7 2012 , 22 7 Global warming , 23 7 Manchester United F.C. , 24 6 List of Wikipedias , 25 6 Zacarias Moussaoui

dez 2009: 1 17 Rick Riordan , 2 16 WrestleMania XXVI , 3 12 Paul Bunyan , 4 9 Justin Bieber , 5 8 Christmas , 6 7 William Shakespeare , 7 7 Akmal Shaikh , 8 7 Tiger Woods , 9 7 List of Universal Pictures movies , 10 7 List of Disney animated movies , 11 7 Brittany Murphy , 12 7 Edgar Allan Poe , 13 7 Seismic retrofit , 14 6 Kijiji , 15 6 Judaism , 16 6 Catherine Morland , 17 6 Northanger Abbey , 18 6 Sujebi , 19 6 Gwar , 20 6 Eddie Fatu , 21 6 The Fox and the Hound , 22 6 Twilight (series) , 23 6 Newbie , 24 6 Evolution , 25 6 Cat

jan 2010: 1 15 Rick Riordan , 2 12 Federal Hockey League , 3 11 Daniel Tosh , 4 11 WrestleMania XXVI , 5 10 Justin Bieber , 6 10 Jonas Brothers , 7 10 Dominican Republic , 8 10 Adolf Hitler , 9 10 Dog , 10 10 Elizabeth II , 11 9 Barack Obama , 12 9 The Brothers Karamazov , 13 9 World War I , 14 9 Ana Ivanović , 15 9 Death of Tina Watson , 16 9 Sun , 17 8 Paul Bunyan , 18 8 7 Seconds , 19 8 2010 Haiti earthquake , 20 8 Bird nest , 21 8 Miley Cyrus , 22 8 Nigger , 23 7 List of Wikipedias , 24 7 Lady Gaga , 25 7 Medical Renaissance

fev 2010: 1 33 Ryan Miller , 2 18 Rick Riordan , 3 15 Daniel Tosh , 4 13 Ghost , 5 12 Justin Bieber , 6 10 Oxford, Nova Scotia , 7 10 2009–10 NHL season , 8 10 Wank , 9 9 World War I , 10 9 Lawn , 11 9 Toilet , 12 9 Abraham Lincoln , 13 9 Chess , 14 8 North Kosovo , 15 8 Miley Cyrus , 16 8 Demon , 17 8 Desert , 18 8 Michael Jackson , 19 8 Dog , 20 8 Elizabeth II , 21 7 Bella Thorne , 22 7 Lady Gaga , 23 7 List of surviving veterans of World War I , 24 6 Kontinental Hockey League , 25 6 Sexual intercourse

mar 2010: 1 18 Ryan Miller , 2 17 2009–10 NHL season , 3 13 Chess , 4 12 Saku Koivu , 5 12 Daniel Tosh , 6 12 Justin Bieber , 7 10 Jew , 8 10 Fascism , 9 10 Global warming , 10 10 George Washington , 11 9 Swag , 12 9 Paul Bunyan , 13 9 Davy Crockett , 14 9 Barack Obama , 15 9 Illegal drugs , 16 9 Computer , 17 8 William Shakespeare , 18 8 Faggot , 19 8 Lady Gaga , 20 8 World War II , 21 8 United States , 22 8 Jesus , 23 8 United States Constitution , 24 8 Wikipedia , 25 8 Renaissance

abr 2010: 1 36 2009–10 NHL season , 2 22 2010 Stanley Cup playoffs , 3 14 Ryan Miller , 4 11 Justin Bieber , 5 11 Riaz Ahmed Gohar Shahi , 6 10 Daniel Tosh , 7 10 Moon landing conspiracy theory , 8 9 Josip Broz Tito , 9 9 Napoleon , 10 9 Chess , 11 8 Car , 12 8 Martin Luther King, Jr. , 13 7 List of Wikipedias , 14 7 William Shakespeare , 15 7 Arctic fox , 16 7 Eugène Terre'Blanche , 17 7 Pokémon , 18 7 Solar energy , 19 7 Lech Kaczyński , 20 7 John Adams , 21 7 George W. Bush , 22 7 God , 23 7 Australia , 24 6 Kijiji , 25 6 Jordan Staal

mai 2010: 1 15 Justin Bieber , 2 12 Wikipedia , 3 11 Simple English Wikipedia , 4 10 Daniel Tosh , 5 9 The Lion King II: Simba's Pride , 6 9 Josip Broz Tito , 7 8 Michael Howe (bushranger) , 8 8 Jimmy Wales , 9 7 Bella Thorne , 10 7 World War I , 11 7 Car , 12 7 Vietnam War , 13 7 Penis , 14 7 Chess , 15 7 Blood , 16 7 Japan , 17 7 God , 18 6 Central Canada Hockey League , 19 6 Federal Hockey League , 20 6 World War II , 21 6 City of Manchester Stadium , 22 6 Pokémon , 23 6 Albatross , 24 6 Newton's laws of motion , 25 6 Muhammad

jun 2010: 1 12 Bella Thorne , 2 12 Justin Bieber , 3 12 2010 FIFA World Cup , 4 11 Simple English Wikipedia , 5 9 Ryan Miller , 6 9 Gaza flotilla raid , 7 9 Al Jackson, Jr. , 8 8 Chatroulette , 9 8 IPad , 10 8 Car , 11 7 Pithole, Pennsylvania , 12 7 World War II , 13 7 Wikipedia , 14 7 Apple Inc. , 15 7 Computer , 16 6 Airblue , 17 6 Sexual intercourse , 18 6 LeBron James , 19 6 IPhone , 20 6 E-book , 21 6 YouTube , 22 6 AIDS , 23 6 Love , 24 6 Vampire , 25 6 Trojan War

jul 2010: 1 25 Airblue , 2 15 Justin Bieber , 3 11 Twilight (series) , 4 10 2010–11 New York Knicks season , 5 10 Daniel Tosh , 6 10 2010 FIFA World Cup , 7 9 Bella Thorne , 8 9 Suraj Narredu , 9 7 Epic Movie , 10 7 Miley Cyrus , 11 7 Jew , 12 7 Elizabeth II , 13 6 Ludwig Mies van der Rohe , 14 6 Kontinental Hockey League , 15 6 Ice algae , 16 6 Perpetual motion , 17 6 Gettysburg Address , 18 6 Mario , 19 6 Bible , 20 5 Steve Brookstein , 21 5 Geyser , 22 5 Alex Auld , 23 5 Islam , 24 5 John 3:16 , 25 5 Nike, Inc.

ago 2010: 1 16 Bella Thorne , 2 11 France , 3 10 Aang , 4 9 Swag , 5 8 Future of the Earth , 6 8 The Lightning Thief , 7 8 History of the United States , 8 7 The Fox and the Hound , 9 7 Pinniped , 10 7 The Pilgrim's Progress , 11 7 Triangle , 12 6 Reggie Jackson , 13 6 Daniel Tosh , 14 6 Tosh.0 , 15 6 Justin Bieber , 16 6 Hot dog , 17 6 Bill Clinton , 18 6 September 11 attacks , 19 5 Stanley Armour Dunham , 20 5 Angela Fong , 21 5 Kontinental Hockey League , 22 5 Kijiji , 23 5 Fiat 500 , 24 5 Darren Young , 25 5 Junior Seau

set 2010: 1 10 Bella Thorne , 2 10 Simple English Wikipedia , 3 9 Dog , 4 8 Isaac Newton , 5 7 Feral , 6 7 Tosh.0 , 7 7 The Church of Jesus Christ of Latter-day Saints , 8 7 Augusto Pinochet , 9 7 Penis , 10 6 List of Wikipedias , 11 6 Angela Fong , 12 6 Hannibal Alkhas , 13 6 Yogi Bear , 14 6 Christianity , 15 6 Asperger syndrome , 16 6 History of the United States , 17 6 Adenoidectomy , 18 6 Gay , 19 6 Abraham Lincoln , 20 5 William Shakespeare , 21 5 Alfred Sisley , 22 5 Meg Whitman , 23 5 William Langland , 24 5 2010 Canterbury earthquake , 25 5 Faggot

out 2010: 1 11 Bella Thorne , 2 10 Swag , 3 10 History of the United States , 4 9 Daniel Tosh , 5 8 Tosh.0 , 6 8 Néstor Kirchner , 7 7 2026 , 8 7 Conservatives in the United States , 9 7 Billy Graham , 10 7 Bald eagle , 11 6 2010 Copiapó mining accident , 12 6 Judaism , 13 6 Islam , 14 6 Food web , 15 6 Simple English Wikipedia , 16 6 Cubism , 17 6 Renaissance , 18 6 Berlin Wall , 19 6 United States Declaration of Independence , 20 6 Martin Luther King, Jr. , 21 5 Connie Madigan , 22 5 Woolsthorpe-by-Colsterworth , 23 5 Weak acid , 24 5 Liu Xiaobo , 25 5 James Naismith

nov 2010: 1 10 Bella Thorne , 2 10 History of the United States , 3 10 Adolf Hitler , 4 8 List of Wikipedias , 5 8 Anton Babchuk , 6 8 Tosh.0 , 7 8 World War I , 8 8 Grand Duchess Anastasia Nikolaevna of Russia , 9 7 Conservatives in the United States , 10 7 United States , 11 6 Pithole, Pennsylvania , 12 6 Wandering albatross , 13 6 World War II , 14 6 Human rights , 15 6 Michael Jackson , 16 6 Love , 17 6 Dog , 18 6 Cat , 19 5 Villain , 20 5 Daniel Tosh , 21 5 Christianity , 22 5 Canada , 23 5 Medieval music , 24 5 Charlie Chaplin , 25 5 Vaccination

dez 2010: 1 11 Shrek , 2 10 WikiLeaks , 3 10 Grand Duchess Anastasia Nikolaevna of Russia , 4 10 Adolf Hitler , 5 8 Tosh.0 , 6 8 Singapore , 7 8 George W. Bush , 8 8 Mahatma Gandhi , 9 7 Bella Thorne , 10 7 Conservatives in the United States , 11 7 Deaths in 2010 , 12 6 Islam , 13 6 Miley Cyrus , 14 6 Aristotle , 15 5 Swag , 16 5 Denis Napthine , 17 5 2026 , 18 5 List of current Canadian first ministers , 19 5 Periwinkle (color) , 20 5 2011 in sports , 21 5 Radio drama , 22 5 Shuzo Matsuoka , 23 5 Julian Assange , 24 5 Kanda University of International Studies , 25 5 Lifeboat

jan 2011: 1 14 Lightning Bar , 2 10 William Shakespeare , 3 10 2011 in sports , 4 9 Tosh.0 , 5 9 Wikipedia , 6 8 Swag , 7 8 2026 , 8 8 Deaths in 2011 , 9 8 Miley Cyrus , 10 8 Simple English Wikipedia , 11 8 George Washington , 12 7 Judaism , 13 7 United States , 14 7 Racism , 15 7 Obesity , 16 7 Computer virus , 17 7 Adolf Hitler , 18 7 Russia , 19 6 United States Constitution , 20 6 2011 , 21 6 List of Greek gods and goddesses , 22 6 Human rights , 23 6 50 Cent , 24 6 Anus , 25 6 The Walt Disney Company

fev 2011: 1 13 WrestleMania XXVIII , 2 11 2011 in sports , 3 10 Justin Bieber , 4 10 List of Greek gods and goddesses , 5 10 Thomas Edison , 6 10 Snow , 7 10 Albert Einstein , 8 8 Bella Thorne , 9 8 Car , 10 8 Henry VIII of England , 11 8 Martin Luther King, Jr. , 12 7 2011 Egyptian revolution , 13 7 Lady Gaga , 14 7 Human rights , 15 7 Abraham Lincoln , 16 7 Adolf Hitler , 17 6 2026 , 18 6 Barack Obama , 19 6 Komodo dragon , 20 6 LeBron James , 21 6 Imaginary number , 22 6 Illegal drugs , 23 6 Malcolm X , 24 6 Valentine's Day , 25 6 Hamlet

mar 2011: 1 82 2011 Tōhoku earthquake and tsunami , 2 12 William Shakespeare , 3 11 Swag , 4 11 Ryan Miller , 5 10 Barack Obama , 6 10 Human rights , 7 9 Simple English Wikipedia , 8 9 Bleach , 9 8 United States , 10 8 Asexual reproduction , 11 8 List of Greek gods and goddesses , 12 7 Fukushima Daiichi Nuclear Power Plant , 13 7 Miley Cyrus , 14 7 Carolus Linnaeus , 15 7 Elizabeth Taylor , 16 7 Socrates , 17 7 Isaac Newton , 18 6 List of current Canadian first ministers , 19 6 2011 in sports , 20 6 Cabot High School , 21 6 World War I , 22 6 Jesus , 23 6 Car , 24 6 Classical Athens , 25 6 Thought

abr 2011: 1 16 WrestleMania XXVIII , 2 14 Pithole, Pennsylvania , 3 11 Tosh.0 , 4 11 World War II , 5 10 Feces , 6 9 Swag , 7 8 Kontinental Hockey League , 8 8 Nikolayevsk Incident , 9 8 Dan Kelly , 10 8 Saturn , 11 7 2011 Green Bay Packers season , 12 7 Ryan Miller , 13 7 Bobby Fischer , 14 7 History of the United States , 15 7 Carolus Linnaeus , 16 6 Ludwig Mies van der Rohe , 17 6 William Shakespeare , 18 6 2011 in sports , 19 6 Daniel Tosh , 20 6 Jean-Baptiste de Lamarck , 21 6 Prince William, Duke of Cambridge , 22 6 Avril Lavigne , 23 6 Facebook , 24 6 Russell Brand , 25 6 Ninja

mai 2011: 1 22 Bella Thorne , 2 22 Osama bin Laden , 3 14 Barack Obama , 4 11 Darfur conflict , 5 10 Wiki , 6 9 Portal 2 , 7 9 Illegal drugs , 8 8 World War II , 9 8 World War I , 10 8 Simple English Wikipedia , 11 8 Johannes Gutenberg , 12 7 Swag , 13 7 Islam , 14 7 Quantum mechanics , 15 7 Saturn , 16 6 2011 in sports , 17 6 Wikipedia , 18 6 List of Greek gods and goddesses , 19 6 Oklahoma , 20 6 Feces , 21 6 God , 22 5 List of Wikipedias , 23 5 William Shakespeare , 24 5 List of ice hockey leagues , 25 5 Behak Maken

jun 2011: 1 39 Bella Thorne , 2 15 Swag , 3 9 Science Museum (London) , 4 9 2011 in sports , 5 8 World War II , 6 8 Internet , 7 7 Airblue , 8 7 Barack Obama , 9 7 Nathan Kress , 10 6 Daniel Tosh , 11 6 Miley Cyrus , 12 6 Mad cow disease , 13 5 Speaker of the Australian House of Representatives , 14 5 Kontinental Hockey League , 15 5 Interstate 485 , 16 5 Bengali Wikipedia , 17 5 Bragg Diffraction , 18 5 The Fox and the Hound , 19 5 Tropical Depression Ten (2005) , 20 5 Sikhism , 21 5 Krypton , 22 5 Bell , 23 5 Martin Luther King, Jr. , 24 5 Penis , 25 5 Video game

jul 2011: 1 32 Bella Thorne , 2 11 Saturn , 3 10 The King's Speech , 4 9 Swag , 5 8 2011 in sports , 6 7 Guilford Native American Association , 7 7 Airblue , 8 7 The Brunts School , 9 7 Amy Winehouse , 10 6 Arecibo message , 11 6 Simple English Wikipedia , 12 6 Thought , 13 6 Scottish Premier League , 14 5 List of Wikipedias , 15 5 William Shakespeare , 16 5 Kontinental Hockey League , 17 5 Gay Nigger Association of America , 18 5 27 Club , 19 5 Jagadguru Rambhadracharya , 20 5 Rebecca Black , 21 5 Sikhism , 22 5 Jupiter , 23 4 List of ice hockey leagues , 24 4 Art Institute of Chicago , 25 4 Falling in Reverse

ago 2011: 1 13 2011 in sports , 2 13 Dragon Ball , 3 12 Swag , 4 12 Valve Corporation , 5 11 Minecraft , 6 10 4chan , 7 10 Space Invaders , 8 10 Wikipedia , 9 9 Bella Thorne , 10 8 Muammar al-Gaddafi , 11 8 Call of Duty: Modern Warfare 3 , 12 7 Gay Nigger Association of America , 13 7 Internet , 14 6 List of Wikipedias , 15 6 2011 Green Bay Packers season , 16 6 2011 Virginia earthquake , 17 6 Halo: Reach , 18 6 Amy Winehouse , 19 6 The Legend of Zelda: The Wind Waker , 20 6 Dog , 21 5 Tarkovsky , 22 5 List of ice hockey leagues , 23 5 Blackburn B-103 , 24 5 Explode (song) , 25 5 Theoretical chemistry

set 2011: 1 16 2011 Green Bay Packers season , 2 10 Swag , 3 9 Adolf Hitler , 4 8 2011 in sports , 5 8 Yabasic , 6 8 Cristiano Ronaldo , 7 8 Toronto Maple Leafs , 8 7 John McDouall Stuart , 9 7 Call of Duty: Modern Warfare 2 , 10 7 Illegal drugs , 11 7 London , 12 6 Lady Gaga , 13 6 Laptop , 14 6 Ostrich , 15 6 France , 16 5 World War I , 17 5 Car , 18 5 Avril Lavigne , 19 5 Rihanna , 20 5 Battle of Dunkirk , 21 5 Carolus Linnaeus , 22 5 Dragon Ball , 23 5 Asexual reproduction , 24 5 Wikipedia , 25 5 List of Greek gods and goddesses

out 2011: 1 25 Swag , 2 22 Steve Jobs , 3 15 2011 Green Bay Packers season , 4 11 Libya , 5 11 Adolf Hitler , 6 10 Team Fortress 2 , 7 9 Call of Duty: Modern Warfare 3 , 8 9 Henry VIII of England , 9 8 Intellectual disability , 10 8 Call of Duty series , 11 7 Gluten-free diet , 12 7 Hardwood , 13 7 Selena , 14 7 Paula Radcliffe , 15 7 Dragon Ball , 16 7 Osama bin Laden , 17 7 Europe , 18 7 China , 19 7 Brazil , 20 6 Sam P. Chelladurai , 21 6 Geek , 22 6 Barack Obama , 23 6 World War I , 24 6 Network card , 25 6 Moon

nov 2011: 1 16 2011 Green Bay Packers season , 2 12 Nair , 3 10 Homosexuality , 4 9 Swag , 5 9 Illegal drugs , 6 8 Speaker of the Australian House of Representatives , 7 8 Adolf Hitler , 8 7 PBS Kids Go! , 9 7 William Shakespeare , 10 7 World War II , 11 6 Age of sexual consent in the United States , 12 6 Voynich manuscript , 13 6 Call of Duty: Modern Warfare 3 , 14 6 Deaths in 2011 , 15 6 Action figure , 16 6 Barack Obama , 17 6 United States , 18 6 Steve Jobs , 19 6 Thomas Edison , 20 6 Rainforest , 21 6 George Washington , 22 5 Gaslighting , 23 5 Frank Drake , 24 5 Fermi paradox , 25 5 Khedive

dez 2011: 1 13 2011 Green Bay Packers season , 2 11 Swag , 3 11 United States , 4 8 Lady Gaga , 5 8 Thought , 6 7 Sodium , 7 6 Repeating , 8 6 Minecraft , 9 6 South Korea , 10 6 England , 11 5 American Contract Bridge League , 12 5 Foam , 13 5 One Direction , 14 5 Age of sexual consent in the United States , 15 5 Václav Havel , 16 5 Selena , 17 5 Selena Gomez , 18 5 Ned Kelly , 19 5 Simple English Wikipedia , 20 5 N-Dubz , 21 5 Confucianism , 22 5 Cellular respiration , 23 5 Diabetes mellitus , 24 5 Michael Jackson , 25 5 Global warming

jan 2012: 1 22 2011 Green Bay Packers season , 2 20 Stop Online Piracy Act , 3 14 Barack Obama , 4 12 Adolf Hitler , 5 9 Simple English Wikipedia , 6 9 Schizophrenia , 7 9 Cheese , 8 7 PROTECT IP Act , 9 7 Nicolaus Steno , 10 7 Megaupload , 11 7 United States , 12 7 Illegal drugs , 13 7 List of Greek gods and goddesses , 14 7 Acid rain , 15 7 Cat , 16 6 Science Museum (London) , 17 6 Tommy \"Hurricane\" Jackson , 18 6 Broken Sword: The Shadow of the Templars , 19 6 Axolotl , 20 6 World War II , 21 6 World War I , 22 6 Martin Luther King, Jr. , 23 6 United Kingdom , 24 5 List of Wikipedias , 25 5 Ludwig Mies van der Rohe

fev 2012: 1 10 United States , 2 9 Barack Obama , 3 8 Streptococcal pharyngitis , 4 8 Skrillex , 5 7 S-block , 6 7 Whitney Houston , 7 7 Illegal drugs , 8 6 2011 Green Bay Packers season , 9 6 Urinary tract infection , 10 6 Morgan Oey , 11 6 Binary fission , 12 6 Electronic Arts , 13 6 Discrimination , 14 5 Oxford, Nova Scotia , 15 5 William Shakespeare , 16 5 Girl Gone Wild , 17 5 Periwinkle (color) , 18 5 Learner's permit , 19 5 Nankana Sahib , 20 5 Lardarius Webb , 21 5 Siguroardottir , 22 5 Open Season (movie series) , 23 5 Conservation of mass , 24 5 World War I , 25 5 Dengue fever

mar 2012: 1 37 Ludwig Mies van der Rohe , 2 16 Swag , 3 9 Crater Lake , 4 8 Justin Bieber , 5 8 Kim Kardashian , 6 8 Football , 7 7 Mayra Verónica , 8 7 Carolus Linnaeus , 9 6 Cincinnati Zoo and Botanical Garden , 10 6 Bidsar , 11 6 Jason Witten , 12 6 Fermionic condensate , 13 6 Sperm whale , 14 6 Illegal drugs , 15 6 Sun , 16 6 List of Greek gods and goddesses , 17 6 Human rights , 18 6 Samurai , 19 6 Leonardo da Vinci , 20 6 Bird , 21 6 Albert Einstein , 22 5 Orc , 23 5 West Gate Bridge , 24 5 Kuch Toh Log Kahenge , 25 5 Hines Ward

abr 2012: 1 13 Snail , 2 12 Brine shrimp , 3 11 Flatworm , 4 9 2012 Green Bay Packers season , 5 9 List of Greek gods and goddesses , 6 9 Goldfish , 7 8 Dit Clapper , 8 8 Rick Santorum , 9 8 Drosophila melanogaster , 10 8 Wikipedia , 11 7 Swag , 12 7 Waheed Murad , 13 7 Christianity , 14 7 The Nutcracker , 15 7 Evolution , 16 7 China , 17 6 Ludwig Mies van der Rohe , 18 6 Daphnia , 19 6 Cincinnati Zoo and Botanical Garden , 20 6 Bidsar , 21 6 Selena (movie) , 22 6 Ronnie Radke , 23 6 World War II , 24 6 Ryōta Tsuzuki , 25 6 Ryūji Bando

mai 2012: 1 11 Neville Bonner , 2 10 Plausible Prejudices: Essays on American Writing , 3 9 Osama bin Laden , 4 8 François Hollande , 5 8 World War II , 6 8 Illegal drugs , 7 8 Hacker , 8 7 Jesus , 9 7 France , 10 6 French Civil Aviation University , 11 6 Electrical circuit , 12 6 Tiger , 13 6 Cat , 14 6 Albert Einstein , 15 5 Wales Coast Path , 16 5 Diana Dors , 17 5 Samantha Mumba , 18 5 Stranger with My Face , 19 5 Mario Vargas Llosa , 20 5 The Assault on Truth: Freud's Suppression of the Seduction Theory , 21 5 Maggie Grace , 22 5 Yu Gamdong , 23 5 Le Spectre de la rose , 24 5 Ronnie Radke , 25 5 Junior Seau

jun 2012: 1 18 Tokyo Medical and Dental University , 2 13 UEFA Euro 2012 , 3 10 Detective Conan (manga) , 4 9 Shōten , 5 9 Fukuoka SoftBank Hawks , 6 8 Kikuō Hayashiya , 7 8 Hiroshima Toyo Carp , 8 8 Sleep apnea , 9 8 Snoopy , 10 7 Croatian Liberation Movement , 11 7 Hepatitis C , 12 7 Pancake , 13 7 Flute , 14 6 Heckler & Koch G36 , 15 6 Pope Alexander VI , 16 6 Mount Tate , 17 6 Botan nabe , 18 6 The Last Emperor , 19 6 Japanese calligraphy , 20 6 Lego big morl , 21 6 Tororo , 22 6 Moyashimon , 23 6 Kathryn Joosten , 24 6 Oort cloud , 25 6 Erebos

jul 2012: 1 9 Higgs boson , 2 8 Deaths in 2012 , 3 7 Ben 10: Omniverse (video game) , 4 7 Hiro Arikawa , 5 6 Tomihiko Morimi , 6 6 Call of Duty: Modern Warfare 3 , 7 6 List of countries by continents , 8 5 List of SpongeBob SquarePants episodes , 9 5 Atsushi Sato , 10 5 First Hull Trains , 11 5 William Shakespeare , 12 5 Rin Nakai , 13 5 Pandora Hearts , 14 5 E-learning , 15 5 Polandball , 16 5 Higgs field , 17 5 Katy Perry , 18 5 Cristiano Ronaldo , 19 5 Roman Polanski , 20 5 Mourning dove , 21 5 Communism , 22 4 Chuck Grassley , 23 4 Northern Rail (Serco-Abellio) , 24 4 Southeastern (train company) , 25 4 TransPennine Express

ago 2012: 1 11 List of Wikipedias , 2 8 Corrosive substance , 3 7 Australian War Memorial , 4 6 The Pursuit of Happyness , 5 6 2012 Summer Olympics medal table , 6 6 Deaths in 2012 , 7 6 Barack Obama , 8 6 George Clooney , 9 6 Mitt Romney , 10 6 RMS Titanic , 11 5 Ben 10: Omniverse (video game) , 12 5 Re'em Ha'Cohen , 13 5 Robert Earl Jones , 14 5 Alexander Haig , 15 5 List of SpongeBob SquarePants episodes , 16 5 Hola (ethnic group) , 17 5 Tergum , 18 5 Mikoyan-Gurevich MiG-23 , 19 5 Mikoyan-Gurevich MiG-9 , 20 5 Documents on the Persian Gulf's name , 21 5 Billy Ocean , 22 5 Gore Vidal , 23 5 World War I , 24 5 Jesus , 25 5 Selena Gomez

set 2012: 1 14 2012 Green Bay Packers season , 2 7 Swag (album) , 3 7 One Direction , 4 7 Galba , 5 7 World War I , 6 6 Warrior (wrestler) , 7 6 Nikki Reed , 8 6 Andy Murray , 9 6 Jupiter , 10 5 List of Wikipedias , 11 5 2012 U.S. diplomatic missions attacks , 12 5 Aimee Mann , 13 5 Barry White , 14 5 Barack Obama , 15 5 Structure of the Earth , 16 5 Uyghur people , 17 5 Mitt Romney , 18 5 Victor Hugo , 19 5 Henry VIII of England , 20 5 Pollution , 21 5 Saddam Hussein , 22 5 Rickets , 23 5 United Kingdom , 24 4 Ben 10: Omniverse (video game) , 25 4 Gao (surname)

out 2012: 1 8 Speaker of the Australian House of Representatives , 2 8 Ludwig Mies van der Rohe , 3 8 Jared Padalecki , 4 8 Human rights , 5 8 Abraham Lincoln , 6 7 One Direction , 7 7 Particle theory of matter , 8 7 Barack Obama , 9 7 The Cranberries , 10 7 Evolution , 11 7 People's Republic of China , 12 6 OSI model , 13 6 Michael Howe (bushranger) , 14 6 Jimi Hendrix , 15 6 Doctor Who , 16 6 List of fruits , 17 5 Savant syndrome , 18 5 Tel Aviv Cinematheque , 19 5 William Shakespeare , 20 5 Minecraft , 21 5 Brad Paisley , 22 5 Selena , 23 5 World War I , 24 5 Selena Gomez , 25 5 Vikings

nov 2012: 1 9 One Direction , 2 8 Congo rainforest , 3 8 Jesus , 4 8 Wikipedia , 5 8 Dog , 6 7 Ludwig Mies van der Rohe , 7 7 Hurricane Sandy (2012) , 8 7 America's Next Top Model, Cycle 19 , 9 7 Air pollution , 10 7 Barack Obama , 11 6 Zinc finger , 12 6 Menstrual migraine , 13 6 Benign paroxysmal vertigo of childhood , 14 6 Gangnam Style , 15 6 Baobab , 16 6 Illegal drugs , 17 6 Human rights , 18 6 Global warming , 19 6 Leonardo da Vinci , 20 6 List of diseases , 21 5 Angela Fong , 22 5 Kang Gyeong-ae , 23 5 Aura (symptom) , 24 5 Acromegaly , 25 5 William Shakespeare

dez 2012: 1 10 One Direction , 2 9 Marie Avgeropoulos , 3 9 Sandy Hook Elementary School shooting , 4 8 One Piece , 5 7 Hide with Spread Beaver , 6 7 Chocolate , 7 7 George Washington , 8 7 Christmas , 9 6 Swag (album) , 10 6 Norman Rockwell Museum , 11 6 Niigata, Niigata , 12 6 Super Junior , 13 6 Migraine , 14 6 Studio Ghibli , 15 6 Naruto (manga) , 16 6 Manga , 17 6 Iran , 18 5 Pasquale J. D'Amuro , 19 5 JYJ , 20 5 The Power Within , 21 5 Tubuai , 22 5 Óscar Romero , 23 5 Tonka Tomičić , 24 5 Kokeshi , 25 5 Ed Sheeran

jan 2013: 1 12 Wikipedia , 2 11 One Direction , 3 9 Particle theory of matter , 4 8 Germany , 5 8 Boxing , 6 7 Violin , 7 7 Abraham Lincoln , 8 6 Maroda , 9 6 James M. Buchanan , 10 6 Mikey Way , 11 6 Martin Luther King, Jr. , 12 6 Mexico , 13 5 Kasabian , 14 5 Suzanne Cleary , 15 5 Estivareilles, Allier , 16 5 Richard Blanco , 17 5 Genco Gulan , 18 5 Gun control , 19 5 Daniel Tosh , 20 5 2037 , 21 5 Canada , 22 5 United States , 23 5 Girls' Generation , 24 5 Electrical circuit , 25 5 List of Miss America winners

fev 2013: 1 13 Barack Obama , 2 10 Swag (album) , 3 9 Pope Benedict XVI , 4 8 Minecraft , 5 7 Australian War Memorial , 6 7 Mikey Way , 7 7 George Washington , 8 7 Isaac Newton , 9 7 Greenhouse effect , 10 6 Rooney Mara , 11 6 LionsXII , 12 6 United States , 13 6 List of Renaissance artists , 14 6 Pocahontas , 15 6 YouTube , 16 6 Illegal drugs , 17 6 Valentine's Day , 18 6 Republican Party (United States) , 19 6 King Arthur , 20 6 Global warming , 21 6 List of planets , 22 6 Dog , 23 6 Albert Einstein , 24 5 Speaker of the Lok Sabha , 25 5 Meira Kumar

mar 2013: 1 21 Pope Francis , 2 13 Albert Einstein , 3 12 Nea Salamis Famagusta FC , 4 12 Justin Bieber , 5 9 Pope Benedict XVI , 6 9 Moose , 7 8 Denis Napthine , 8 8 William Shakespeare , 9 8 United States , 10 7 Minecraft , 11 7 Barack Obama , 12 7 World War II , 13 7 Hugo Chávez , 14 7 French Revolution , 15 7 List of countries by continents , 16 6 Swag (album) , 17 6 Kraft, Louisiana , 18 6 Chiton , 19 6 Event-driven programming , 20 6 Simple English Wikipedia , 21 6 Sun , 22 6 The Holocaust , 23 6 List of planets , 24 6 Schizophrenia , 25 6 English language

abr 2013: 1 20 Swag , 2 11 William Shakespeare , 3 9 One Direction , 4 8 Particle theory of matter , 5 7 Military radio station of Pierre-sur-Haute , 6 7 Barack Obama , 7 7 Margaret Thatcher , 8 7 Slavery , 9 6 2013 Boston Marathon bombings , 10 6 The Cartful , 11 6 Deaths in 2013 , 12 6 Yun Chi-ho , 13 6 United States , 14 6 Justin Bieber , 15 6 Wikipedia , 16 6 Augustus , 17 6 John F. Kennedy , 18 6 Korean War , 19 6 Feces , 20 6 George Washington , 21 6 Leonardo da Vinci , 22 6 Christopher Columbus , 23 6 Cat , 24 5 National Cheng Kung University , 25 5 National Sun Yat-sen University

mai 2013: 1 10 Paul Tibbets , 2 9 Illegal drugs , 3 9 The Holocaust , 4 8 Swag , 5 8 Swag (album) , 6 8 Liseberg , 7 8 Congo rainforest , 8 8 World War I , 9 8 Justin Bieber , 10 7 Jesus , 11 7 Tobey Maguire , 12 7 Trail of Tears , 13 7 List of Roman gods and goddesses , 14 7 Human rights , 15 7 Volcano , 16 7 History of Australia , 17 6 Xbox One , 18 6 Ariel Castro kidnappings , 19 6 One Direction , 20 6 Minecraft , 21 6 Barack Obama , 22 6 United States , 23 6 Asylum seeker , 24 6 Backup , 25 6 Thermoplastic

jun 2013: 1 11 William Shakespeare , 2 9 Toni Basil , 3 8 Edward Snowden , 4 8 One Direction , 5 8 Pollution , 6 7 James Gandolfini , 7 7 Moondyne Joe , 8 7 Cat , 9 7 Australia , 10 6 Muslim Patrol , 11 6 John Howland , 12 6 Type 2 diabetes , 13 6 Assassination of Abraham Lincoln , 14 6 Coeliac disease , 15 6 Hydrogen car , 16 6 Sun , 17 6 Penicillin , 18 6 Big Ben , 19 6 Dodo , 20 6 Robert E. Lee , 21 6 Abraham Lincoln , 22 6 Solar System , 23 5 Ponnambalam Arunachalam , 24 5 Fatimah , 25 5 Yoshitaka Amano

jul 2013: 1 10 Dwight D. Eisenhower , 2 7 Nea Salamis Famagusta FC , 3 7 Prince George of Cambridge , 4 7 Dick Figures , 5 6 Marie Avgeropoulos , 6 6 Ryo Nishikido , 7 6 Commodore Nutt , 8 6 Edward Snowden , 9 6 Cory Monteith , 10 6 StarHub TV , 11 6 Wikipedia , 12 6 List of Greek gods and goddesses , 13 6 Evolution , 14 6 Pollution , 15 6 Apple Inc. , 16 5 Begin Road , 17 5 Ayalon Highway , 18 5 List of television stations in the Philippines , 19 5 Dill pickle , 20 5 Lindy Boggs , 21 5 Information systems , 22 5 Austin Butler , 23 5 William Shakespeare , 24 5 Ooooooohhh... On the TLC Tip , 25 5 Windows 8

ago 2013: 1 8 Nelson Mandela , 2 7 Sung Jae-ki , 3 7 List of television stations in the Philippines , 4 7 Bitcoin , 5 7 List of Greek gods and goddesses , 6 6 PBS Kids Go! , 7 6 Tower of Saviors , 8 6 Commodore Nutt , 9 6 Feather , 10 6 Mahatma Gandhi , 11 5 Marie Avgeropoulos , 12 5 Chelsea Manning , 13 5 Mary Kom , 14 5 Johor Bahru , 15 5 Seremban , 16 4 Hoia-Baciu Forest , 17 4 Manila hostage crisis , 18 4 Head teacher , 19 4 Lisa Robin Kelly , 20 4 University of Leicester , 21 4 University of Paris , 22 4 Brookhaven, Georgia , 23 4 Wells Fargo Center (Philadelphia) , 24 4 Montacute, South Australia , 25 4 Todd Graff

set 2013: 1 17 George A. Miller , 2 12 Wikipedia , 3 10 World War II , 4 9 Dinosaur , 5 8 2012 Delhi gang rape , 6 8 Nelson Mandela , 7 7 One Direction , 8 7 Chocolate , 9 6 Jean de Venette , 10 6 Attachment theory , 11 6 Parking lot , 12 6 Commodore Nutt , 13 6 Para-alpine skiing , 14 6 World War I , 15 6 Hiroshi Yamauchi , 16 6 September 11 attacks , 17 6 Mahatma Gandhi , 18 5 Tyche (hypothetical planet) , 19 5 Psychodynamic theory , 20 5 Technical writing , 21 5 Edward Brooke , 22 5 James Gandolfini , 23 5 Lady Gaga , 24 5 Animal Farm , 25 5 Osama bin Laden

out 2013: 1 12 United States , 2 10 One Direction , 3 9 Peg + Cat , 4 9 World War I , 5 8 PBS Kids Go! , 6 8 Nea Salamis Famagusta FC , 7 8 DWTL-TV , 8 8 Fisting , 9 8 Ancient Egypt , 10 8 Penguin , 11 8 Cat , 12 7 Wales Coast Path , 13 7 List of television stations in the Philippines , 14 7 Wikipedia , 15 7 Michael Jackson , 16 7 Buddhism , 17 6 Branle , 18 6 Anthroposophy , 19 6 Deaths in 2013 , 20 6 Canada , 21 6 Miley Cyrus , 22 6 Bumblebee bat , 23 6 Command economy , 24 6 IPhone , 25 6 List of Egyptian gods and goddesses

nov 2013: 1 10 Cat , 2 9 Lewis Hamilton , 3 8 Niggers in the White House , 4 8 Cold War , 5 7 Typhoon Haiyan , 6 7 One Direction , 7 7 Jesus , 8 7 Nuclear energy , 9 6 PBS Kids Go! , 10 6 Human , 11 6 Detroit Lakes, Minnesota , 12 6 Miley Cyrus , 13 6 David Cameron , 14 6 Pie , 15 6 Wikipedia , 16 6 Ribosome , 17 6 Sparta , 18 6 Buddhism , 19 5 Dutch resistance , 20 5 Don't Be Messin' 'Round , 21 5 Redirect , 22 5 National Library, Singapore , 23 5 Aminah , 24 5 Sevenoaks School , 25 5 Funny Face

dez 2013: 1 18 One Direction , 2 18 Nelson Mandela , 3 8 Choco pie , 4 8 Funny Face , 5 8 Car , 6 8 Wikipedia , 7 8 Cat , 8 7 Tsunami , 9 7 Truck , 10 7 Atom , 11 6 Abdul Quader Molla , 12 6 Third Power , 13 6 De Colores , 14 6 Parliament of England , 15 6 Ramen , 16 6 Osaka , 17 5 OFC Nations Cup , 18 5 Juan Domingo de Canaveris , 19 5 Hong Seok-cheon , 20 5 Management information system , 21 5 Thomas Chippendale , 22 5 Kuniko Inoguchi , 23 5 Neo soul , 24 5 Thinkin Bout You , 25 5 Novacane (song)

jan 2014: 1 13 Wikipedia , 2 12 Peg + Cat , 3 11 Funny Face , 4 10 List of Egyptian gods and goddesses , 5 9 Miley Cyrus , 6 8 Nelson Mandela , 7 7 Yamagata Prefecture , 8 7 One Direction , 9 7 Akita Prefecture , 10 7 Boohbah , 11 7 Simple English Wikipedia , 12 7 Kanye West , 13 7 Grey wolf , 14 7 Wiki , 15 7 Earth , 16 6 Black Point , 17 6 Euromaidan , 18 6 Prince du sang , 19 6 Mohammed Burhanuddin , 20 6 To a Mouse , 21 6 Harry Potter , 22 6 Jesus , 23 6 Car , 24 6 Lionel Messi , 25 6 Teletubbies

fev 2014: 1 9 Wikipedia , 2 8 Peg + Cat , 3 8 One Direction , 4 7 Equal Pay Act of 1963 , 5 7 Skeleton (sport) , 6 7 Barack Obama , 7 7 Polar bear , 8 7 Solar System , 9 6 Loni Nest , 10 6 List of active volcanoes , 11 6 Bill Gates , 12 6 Malaria , 13 6 Abraham Lincoln , 14 6 Wiki , 15 5 PBS Kids Go! , 16 5 Miranda v. Arizona , 17 5 2014 Winter Olympics opening ceremony , 18 5 Wohl Rose Park , 19 5 Euromaidan , 20 5 Ranua , 21 5 Maya Angelou , 22 5 Civilian , 23 5 Struggle for existence , 24 5 World War I , 25 5 Shrove Tuesday

mar 2014: 1 10 Malaysia Airlines Flight 370 , 2 9 One Direction , 3 9 Poland , 4 9 Google , 5 8 Peg + Cat , 6 7 Shraddha Kapoor , 7 7 World War I , 8 7 Volcano , 9 6 Abdel Fattah el-Sisi , 10 6 Wikipediocracy , 11 6 Anthony Horowitz , 12 6 Barack Obama , 13 6 Canada , 14 6 List of Germanic deities , 15 6 Wikipedia , 16 6 Mobile phone , 17 6 Venus , 18 5 L'Wren Scott , 19 5 Alain Resnais , 20 5 Tony Benn , 21 5 Deaths in 2014 , 22 5 Charles Laughton , 23 5 List of active volcanoes , 24 5 2011 Tōhoku earthquake and tsunami , 25 5 United States

abr 2014: 1 7 Peg + Cat , 2 7 Barack Obama , 3 6 Car , 4 6 Pope John Paul II , 5 6 Cold War , 6 5 Marie Avgeropoulos , 7 5 Deaths in 2014 , 8 5 Peaches Geldof , 9 5 Bob's Burgers , 10 5 World War II , 11 5 Bambi , 12 5 Simple English Wikipedia , 13 5 Danish language , 14 5 Abraham Lincoln , 15 5 Earth , 16 4 Wall cloud , 17 4 Wilfred Thesiger , 18 4 Expocenter of Ukraine , 19 4 C. Delores Tucker , 20 4 Lauri Törni , 21 4 Del Shannon , 22 4 Pinehurst Resort , 23 4 Justin Marie Bomboko , 24 4 Orange flower water , 25 4 Rose water

mai 2014: 1 8 German Shepherd , 2 8 Kangaroo , 3 7 Minecraft , 4 7 Car , 5 7 French Revolution , 6 7 Gay , 7 6 Marie Avgeropoulos , 8 6 List of members of the European Parliament for the United Kingdom, 2014–19 , 9 6 Rolling and wheels in the natural world , 10 6 World War I , 11 6 Kurt Cobain , 12 5 Lucy, Lady Duff-Gordon , 13 5 Harry Gordon Selfridge , 14 5 Theo James , 15 5 Conchita Wurst , 16 5 Ian Ross , 17 5 Dobermann , 18 5 Bambi , 19 5 Knights of the Round Table , 20 5 2014 , 21 5 Light bulb , 22 5 Nikola Tesla , 23 5 Great Wall of China , 24 5 Texas , 25 5 Dog

jun 2014: 1 10 Wikipedia , 2 8 Justin Bieber , 3 7 William Shakespeare , 4 6 Alexander McQueen , 5 6 Dormant volcano , 6 6 United States , 7 6 2014 FIFA World Cup , 8 5 Cass Elliot , 9 5 2014 FIFA World Cup Group G , 10 5 Eli Lilly and Company , 11 5 Clarence Darrow , 12 5 Tracy Morgan , 13 5 Chungyang Red Pepper , 14 5 Orange Caramel , 15 5 Epping Forest , 16 5 Ruby Dee , 17 5 Casting , 18 5 Lionel Messi , 19 5 David Cameron , 20 5 Mao Zedong , 21 5 Vagina , 22 5 Cheetah , 23 5 Queen Victoria , 24 4 Dying Young , 25 4 Girl power

jul 2014: 1 11 Malaysia Airlines Flight 17 , 2 8 Car , 3 5 Nea Salamis Famagusta FC , 4 5 Prism (album) , 5 5 Selena Gomez , 6 5 Trench foot , 7 5 2014 FIFA World Cup , 8 4 Çolpan İlhan , 9 4 National Anthem of the Soviet Union , 10 4 Monk (TV series) , 11 4 Justine Greening , 12 4 Elinor Wylie , 13 4 Mrs. Parkington , 14 4 Assassination of Theo van Gogh , 15 4 Krombacher Brauerei , 16 4 Xcelerator , 17 4 Middletown, Rhode Island , 18 4 The Bar-Kays , 19 4 Alois Brunner , 20 4 Sonoma County Transit , 21 4 Jaws: The Revenge , 22 4 UEFA Euro 1996 , 23 4 Brazil v Germany (2014 FIFA World Cup) , 24 4 Love Affair (1994 movie) , 25 4 Radivoj Lazić

ago 2014: 1 7 Funny Face , 2 7 Robin Williams , 3 6 Zugzwang , 4 6 Shooting of Michael Brown , 5 6 Deaths in 2014 , 6 5 Call of Duty: Advanced Warfare , 7 5 Czechoslovak Television , 8 5 Puli , 9 5 Meuse (river) , 10 5 Cairn Terrier , 11 5 Mexico City International Airport , 12 5 Alki Larnaca F.C. , 13 5 Justin Bieber , 14 5 John F. Kennedy , 15 4 Gabrielle Blunt , 16 4 Current affairs , 17 4 Off-site data protection , 18 4 Bill Kerr , 19 4 Jean-Honorè Fragonard , 20 4 Peret , 21 4 Super Mario (series) , 22 4 Orchard , 23 4 Ángel Di Maria , 24 4 Glam metal , 25 4 Buttered cat paradox

set 2014: 1 13 List of highest-grossing Telugu movies , 2 9 Deaths in 2014 , 3 9 Quantum mechanics , 4 8 Funny Face , 5 8 World War I , 6 7 Minecraft , 7 7 Justin Bieber , 8 7 Pre-history , 9 7 September 11 attacks , 10 6 Sam Hall (writer) , 11 6 Battle of Jena-Auerstadt , 12 6 Esperanto , 13 6 Hydroelectricity , 14 5 Kit Carson , 15 5 Scottish independence referendum , 16 5 Justin Verlander , 17 5 Islamic State of Iraq and the Levant , 18 5 World War II , 19 5 Viscosity , 20 5 Moon , 21 5 English free settlers , 22 5 Joan Rivers , 23 5 Diwali , 24 5 French Revolution , 25 5 Richard I of England

out 2014: 1 15 List of highest-grossing Telugu movies , 2 13 Ebola virus , 3 10 Cat , 4 9 George Washington , 5 8 Electrical circuit , 6 7 Seville Cathedral , 7 7 Funny Face , 8 7 List of active volcanoes , 9 6 Deaths in 2014 , 10 6 London Midland , 11 6 List of Germanic deities , 12 6 AIDS , 13 6 Mouth , 14 6 Tutankhamun , 15 6 Science , 16 5 2014 shootings at Parliament Hill, Ottawa , 17 5 Bloom filter , 18 5 Bird sound , 19 5 Lassa fever , 20 5 Garajonay National Park , 21 5 Jimmy Savile , 22 5 Malala Yousafzai , 23 5 One Direction , 24 5 Electron cloud , 25 5 Shrek

nov 2014: 1 12 Christopher Columbus , 2 11 Queen Anne of Romania , 3 8 Ancient Egyptian agriculture , 4 8 Rebbeca Oswald , 5 8 Harlequin duck , 6 7 List of highest-grossing Telugu movies , 7 7 Justin Bieber , 8 7 List of Egyptian gods and goddesses , 9 7 Cat , 10 6 List of active volcanoes , 11 6 One Direction , 12 6 Minecraft , 13 6 World War I , 14 6 Bill Gates , 15 6 Thanksgiving , 16 5 Arctic Wolf , 17 5 Phil Hartman , 18 5 Mitsuhiro Kawamoto , 19 5 World War II , 20 5 Raccoon , 21 5 Ganges , 22 5 Great Depression , 23 5 Creedence Clearwater Revival , 24 5 Pyramid , 25 5 Pollution

dez 2014: 1 8 Winnipeg General Strike , 2 7 2014 Sydney hostage crisis , 3 7 Freedom of the press , 4 7 Simple English Wikipedia , 5 7 Pollution , 6 7 Christmas , 7 6 Virgin Trains , 8 6 The Holocaust , 9 5 Comrade , 10 5 Deaths in 2014 , 11 5 Murder of Linda Andersen , 12 5 Iggy Azalea , 13 5 Elam , 14 5 World War I , 15 5 Justin Bieber , 16 5 Giant panda , 17 4 Marie Avgeropoulos , 18 4 Queen Anne of Romania , 19 4 Slugterra , 20 4 Woburn, Bedfordshire , 21 4 Arlesey , 22 4 Rotte (river) , 23 4 Aurelio Gonzalez (cyclist) , 24 4 Nina Badrić , 25 4 Bret Easton Ellis

jan 2015: 1 10 Dog , 2 9 List of Egyptian gods and goddesses , 3 8 Simple English Wikipedia , 4 8 Cat , 5 7 Queen Anne of Romania , 6 7 Minecraft , 7 7 Cristiano Ronaldo , 8 6 PBS Kids Go! , 9 6 Pewter , 10 6 Vikings , 11 6 Justin Bieber , 12 6 Craigslist , 13 6 Membrane , 14 6 Leonardo da Vinci , 15 6 Game , 16 6 Football , 17 6 Earth , 18 5 Marie Avgeropoulos , 19 5 Charlie Hebdo , 20 5 PEGIDA , 21 5 William Shakespeare , 22 5 Colleen McCullough , 23 5 Child labour , 24 5 Roman army , 25 5 Electrical circuit

fev 2015: 1 9 Data Protection Act , 2 8 Ancient Egypt , 3 7 YouTube , 4 7 Dog , 5 6 PBS Kids Go! , 6 6 Strahler number , 7 6 Michael Smerconish , 8 6 Francisco María Oreamuno Bonilla , 9 6 Islam , 10 6 Justin Bieber , 11 6 Chelsea F.C. , 12 6 Profanity , 13 6 Ebola virus , 14 5 Deaths in 2015 , 15 5 List of highest-grossing Telugu movies , 16 5 William Shakespeare , 17 5 Spanking , 18 5 Minecraft , 19 5 Lady Gaga , 20 5 World War II , 21 5 Boston Massacre , 22 5 New York City Subway , 23 5 Leonard Nimoy , 24 5 List of Egyptian gods and goddesses , 25 5 David Beckham

mar 2015: 1 9 List of highest-grossing Telugu movies , 2 8 Marie Avgeropoulos , 3 8 One Direction , 4 8 Martin Luther King, Jr. , 5 7 Katherine Applegate , 6 7 Toilet , 7 7 Dog , 8 6 Octavia E. Butler , 9 6 Grace Lin , 10 6 Cynthia Kadohata , 11 6 Jennifer L. Holm , 12 6 Rebecca Stead , 13 6 Linda Sue Park , 14 6 William Shakespeare , 15 6 Sharia , 16 6 List of Egyptian gods and goddesses , 17 6 List of Germanic deities , 18 6 Puberty , 19 6 Feces , 20 5 Human , 21 5 Paula Danziger , 22 5 Kirsten Miller , 23 5 Raina Telgemeier , 24 5 Ally Carter , 25 5 Tamora Pierce

abr 2015: 1 9 List of highest-grossing Telugu movies , 2 8 Electron cloud , 3 8 Steve Jobs , 4 8 George Washington , 5 7 List of fruits , 6 6 Marie Avgeropoulos , 7 6 Selena Gomez , 8 6 Penguin , 9 6 Abraham Lincoln , 10 6 Mahatma Gandhi , 11 6 Plant , 12 5 Human , 13 5 Larry Page , 14 5 Satisfaction , 15 5 Perro de Presa Canario , 16 5 The Biggest Loser , 17 5 Tom Kenny , 18 5 List of active volcanoes , 19 5 Sodom and Gomorrah , 20 5 Bullmastiff , 21 5 Ray Romano , 22 5 World War I , 23 5 Canada , 24 5 Justin Bieber , 25 5 Renewable resource

mai 2015: 1 9 List of active volcanoes , 2 9 Cat , 3 8 Cold War , 4 7 Poltergeist (2015 movie) , 5 7 2015 Philadelphia train derailment , 6 7 World War II , 7 7 Vikings , 8 7 Cooking , 9 6 Deaths in 2015 , 10 6 Maya Plisetskaya , 11 6 League of Legends , 12 6 Minecraft , 13 6 Fleetwood Mac , 14 6 Dog , 15 5 Grumpy Old Men , 16 5 Young Europeans Literary Award , 17 5 Princess Charlotte of Cambridge , 18 5 One Direction , 19 5 Crisis , 20 5 Christianity , 21 5 Car , 22 5 Asylum seeker , 23 5 Club Ferro Carril Oeste , 24 5 Eureka Stockade , 25 5 Exploration

jun 2015: 1 15 Smosh: The Movie , 2 10 Ghost , 3 8 Marie Avgeropoulos , 4 8 Caitlyn Jenner , 5 8 Minecraft , 6 8 Dog , 7 7 John F. Kennedy , 8 6 Charleston church shooting , 9 6 Valur , 10 6 Paradise Cay, California , 11 6 Qubool Hai , 12 6 Barack Obama , 13 6 Jesus , 14 6 Lionel Messi , 15 6 Thirteen Colonies , 16 6 Rainforest , 17 6 Vladimir Putin , 18 5 José Gaspar Rodríguez de Francia y Velasco , 19 5 Robert Brian Wilson , 20 5 Bad Blood (Taylor Swift song) , 21 5 Anne Braden , 22 5 Human , 23 5 Natural law , 24 5 Boohbah , 25 5 Battle of Waterloo

jul 2015: 1 9 List of highest-grossing Telugu movies , 2 6 Bobbi Kristina Brown , 3 6 Nicholas Winton , 4 6 Laura Branigan , 5 6 Omar Sharif , 6 6 Cat , 7 6 Earthquake , 8 5 Queen Anne of Romania , 9 5 The Shadow , 10 5 Paddington , 11 5 Achraf Baznani , 12 5 William Shakespeare , 13 5 Christianity , 14 5 Daniela Hantuchová , 15 5 Creation Museum , 16 5 Muhammad , 17 4 RCA Records Nashville , 18 4 Lee Corso , 19 4 Bret Iwan , 20 4 Basilica Cistern , 21 4 Cory Gardner , 22 4 Phil Gramm , 23 4 Peace be upon him (Islam) , 24 4 Christian Audigier , 25 4 Bridgewater, Nova Scotia

ago 2015: 1 9 103 (number) , 2 9 List of highest-grossing Telugu movies , 3 9 Triangular number , 4 7 2047 (number) , 5 7 World War II , 6 7 Simple English Wikipedia , 7 7 Pollution , 8 6 LGBT rights in Afghanistan , 9 6 Dina Carroll , 10 6 Donald Trump , 11 6 Shrek , 12 6 Wikipedia , 13 6 Adolf Hitler , 14 5 Mi querida España , 15 5 Microsoft Edge , 16 5 Tim Farron , 17 5 Nico di Angelo , 18 5 Khowar language , 19 5 Kiwi , 20 5 Jennifer Lopez , 21 5 Japan , 22 4 Marie Avgeropoulos , 23 4 PBS Kids Go! , 24 4 Super Bass , 25 4 Dorothy Kilgallen

set 2015: 1 10 Simple English Wikipedia , 2 8 Jeremy Corbyn , 3 7 Wikipedia , 4 7 Australia , 5 6 Islam , 6 6 Jesus , 7 6 Donald Trump , 8 6 Sharia , 9 6 Sun , 10 6 French and Indian War , 11 6 United States Constitution , 12 6 Environment , 13 6 George Washington , 14 6 Adolf Hitler , 15 5 Pink Friday , 16 5 Gliese 667 Cc , 17 5 Dave Foley , 18 5 Deaths in 2015 , 19 5 Neymar , 20 5 World War II , 21 5 Earth's inner core , 22 5 Cristiano Ronaldo , 23 5 Bobby Robson , 24 5 Doctor Who , 25 5 RMS Titanic

out 2015: 1 10 One Direction , 2 8 Sharia , 3 7 Simple English Wikipedia , 4 7 Mayan civilization , 5 7 Wikipedia , 6 6 Nederland, Texas , 7 6 King Kong (character) , 8 6 Stuxnet , 9 6 Motal , 10 6 Edward Sims Van Zile , 11 6 Nikolay Yut , 12 6 List of Germanic deities , 13 6 Sun , 14 6 French and Indian War , 15 6 Protist , 16 6 Halloween , 17 6 India , 18 5 Toni Brunner , 19 5 Benedetta Cappa , 20 5 Home (soundtrack) , 21 5 Wilford Horace Smith , 22 5 Mabel Boll , 23 5 Iroquois , 24 5 Spain , 25 5 Car

nov 2015: 1 11 November 2015 Paris attacks , 2 11 Wikipedia , 3 10 Queen Anne of Romania , 4 10 Sharia , 5 7 Tony Abbott , 6 7 Donald Trump , 7 6 Hello (Adele song) , 8 6 Raúl Lozano , 9 6 Deaths in 2015 , 10 6 Simple English Wikipedia , 11 6 List of U.S. states by population , 12 6 Electrolysis , 13 6 Global warming , 14 6 Volcano , 15 6 Adolf Hitler , 16 6 Computer , 17 5 McDonnell Douglas AV-8B Harrier II , 18 5 Tina Turner , 19 5 Video card , 20 5 Helen Keller , 21 5 Electron cloud , 22 5 Roman Britain , 23 5 Battle of Hastings , 24 5 Diwali , 25 5 Central processing unit

dez 2015: 1 10 Sharia , 2 7 Meadowlark Lemon , 3 7 Gustavo Endres , 4 7 Deaths in 2015 , 5 6 Jason Myers , 6 6 Itanium , 7 6 Lorde , 8 6 Tropical cyclone , 9 6 Abraham Lincoln , 10 6 Earthquake , 11 5 East of England Ambulance Service , 12 5 2015 San Bernardino shooting , 13 5 Kaye Revil , 14 5 Tsunami , 15 5 Jesus , 16 5 Car , 17 5 Lionel Messi , 18 5 History of the United States , 19 5 Adele , 20 5 Donald Trump , 21 5 Steve Jobs , 22 5 Anglo-Saxons , 23 5 Meow , 24 5 Wikipedia , 25 5 Tornado

jan 2016: 1 12 Donald Trump , 2 9 List of U.S. state slogans , 3 8 Environment , 4 7 Bloons Tower Defense , 5 7 Deaths in 2016 , 6 7 Alan Rickman , 7 7 World War II , 8 7 David Bowie , 9 6 January 2016 United States blizzard , 10 6 Altenburg Abbey , 11 6 Tower defense , 12 6 XTRA Airways , 13 6 Twin Falls County, Idaho , 14 6 Knights of the Round Table , 15 6 World Wrestling Entertainment roster , 16 6 Wikipedia , 17 6 Electricity , 18 5 Marie Avgeropoulos , 19 5 Dinah Manoff , 20 5 January 2016 East Asia cold wave , 21 5 Namaste Falls , 22 5 Totterdown , 23 5 Jenean Hampton , 24 5 Laundry , 25 5 Harry Potter

fev 2016: 1 8 Lovely Professional University , 2 8 Bernie Sanders , 3 8 Simple English Wikipedia , 4 8 Donald Trump , 5 7 Me and My Gang , 6 7 Moon , 7 6 Bad Aibling rail accident , 8 6 One Direction , 9 6 Immigration to Canada , 10 6 Down syndrome , 11 6 Wikipedia , 12 6 Napoleon , 13 6 Martin Luther King, Jr. , 14 6 Adolf Hitler , 15 6 Banana , 16 5 Log Cabin Republicans , 17 5 February 2016 Ankara bombing , 18 5 John Danforth , 19 5 Manuel Vicente , 20 5 Black Mountain (Kentucky) , 21 5 Sturla Gunnarsson , 22 5 2016 Taiwan earthquake , 23 5 Melody Thomas Scott , 24 5 Biggin Hill , 25 5 Deaths in 2016

mar 2016: 1 11 2016 Brussels bombings , 2 8 Sex , 3 7 United States , 4 6 Democratic Party presidential primaries, 2016 , 5 6 Deaths in 2016 , 6 6 Viking Age , 7 6 Simple English Wikipedia , 8 6 Bobby Robson , 9 6 Sharia , 10 6 YouTube , 11 6 Hillary Clinton , 12 6 Maine , 13 6 Cat , 14 6 Google , 15 5 Heidi Cruz , 16 5 1066 Harold's Way , 17 5 Vorkuta mine explosion , 18 5 Results of the Republican Party presidential primaries, 2016 , 19 5 Bernie Sanders , 20 5 Ted Cruz , 21 5 World War I , 22 5 Islam , 23 5 Higgs boson , 24 5 Mission statement , 25 5 List of Germanic deities

abr 2016: 1 11 Ted Cruz , 2 9 South Sudan , 3 9 Prince (musician) , 4 7 Wikipedia , 5 6 Deaths in 2016 , 6 6 Canada , 7 6 United States , 8 6 Amazon rainforest , 9 6 September 11 attacks , 10 5 2016 Ecuador earthquake , 11 5 2016 Kumamoto earthquakes , 12 5 Rosendale Trestle , 13 5 William Shakespeare , 14 5 Justin Bieber , 15 5 Caesar salad , 16 5 School , 17 5 Taylor Swift , 18 5 Sacred cow , 19 5 Boston Tea Party , 20 5 Blue whale , 21 5 Sudan , 22 5 Heart , 23 5 Checkers , 24 5 Volcano , 25 5 Brain

mai 2016: 1 7 Wikipedia , 2 7 Michael Jackson , 3 7 Henry VIII of England , 4 7 George Washington , 5 6 PBS Kids Go! , 6 6 Republican Party presidential primaries, 2016 , 7 6 Ted Cruz , 8 6 South Sudan , 9 6 Paul Revere , 10 6 Aztecs , 11 6 List of fruits , 12 5 Send My Love (To Your New Lover) , 13 5 Episode , 14 5 Kraken , 15 5 United States , 16 5 Lionel Messi , 17 5 Megamouth shark , 18 5 The Jungle Book , 19 5 List of Renaissance artists , 20 5 World Wrestling Entertainment roster , 21 5 Israel , 22 5 American Revolutionary War , 23 5 Desert , 24 5 Violin , 25 5 Apartheid

jun 2016: 1 9 Orlando nightclub shooting , 2 9 United Kingdom European Union membership referendum , 3 6 Christina Grimmie , 4 6 Jaat , 5 5 Jo Cox , 6 5 7-Eleven , 7 5 Human , 8 5 Jimmy Savile , 9 5 World War I , 10 5 The Master (Doctor Who) , 11 5 David Cameron , 12 5 Gorilla , 13 5 Osama bin Laden , 14 5 Sahara , 15 5 List of fruits , 16 4 List of programs broadcast by Star Jalsha , 17 4 Time in Egypt , 18 4 Charles Sturt University , 19 4 YaCy , 20 4 Zim, Minnesota , 21 4 Results of the Democratic Party presidential primaries, 2016 , 22 4 Planck constant , 23 4 World War II , 24 4 Canada , 25 4 Jesus

jul 2016: 1 8 2016 Nice attack , 2 7 2016 Stanley Cup Finals , 3 7 One Direction , 4 7 Theresa May , 5 6 Pokémon Go , 6 6 Carmelo Borg Pisani , 7 6 San Francisco–Oakland Bay Bridge , 8 6 Achraf Baznani , 9 6 Snake , 10 5 Kapil Dev , 11 5 Rahul Dravid , 12 5 Ruzizi River , 13 5 2015-16 Golden State Warriors season , 14 5 Virat Kohli , 15 5 Android (operating system) , 16 5 Andy Murray , 17 5 Talent , 18 5 Nice , 19 5 Volcano , 20 4 List of twin towns and sister cities in Switzerland , 21 4 The Fold , 22 4 Rise (Katy Perry song) , 23 4 Zuzana Stevulova , 24 4 2016 shooting of Dallas police officers , 25 4 Ravichandran Ashwin

ago 2016: 1 33 Queen Anne of Romania , 2 7 India , 3 6 Cantor's diagonal argument , 4 6 Pokémon Go , 5 6 World War II , 6 6 United States , 7 6 2016 Summer Olympics , 8 6 Wikipedia , 9 6 Pollution , 10 6 George Washington , 11 5 Olympic Games , 12 5 Pythagoras , 13 4 August 2016 Central Italy earthquake , 14 4 George Meade , 15 4 Joey Graceffa , 16 4 Hayes School , 17 4 Achraf Baznani , 18 4 Gomel , 19 4 United States presidential election, 2016 , 20 4 Indian Rebellion of 1857 , 21 4 Barack Obama , 22 4 Taylor Swift , 23 4 List of Egyptian gods and goddesses , 24 4 List of U.S. state nicknames , 25 4 Giant panda

set 2016: 1 8 India , 2 7 U.S. Presidential line of succession , 3 7 Earth , 4 5 Computer law , 5 5 YouTube , 6 5 French and Indian War , 7 5 Alexander the Great , 8 4 SNCF 040.DF , 9 4 Edwin Atherstone , 10 4 Nazi salute , 11 4 Bhatgaon, Raipur , 12 4 Lanyard , 13 4 Suntec City , 14 4 Electric blanket , 15 4 Susanna Griso , 16 4 Deaths in 2016 , 17 4 OK Computer , 18 4 Plague doctor costume , 19 4 World War II , 20 4 Canada , 21 4 Nail art , 22 4 Battle of Gettysburg , 23 4 Facebook , 24 4 Simple English Wikipedia , 25 4 Egyptian pyramids

out 2016: 1 9 Leonardo da Vinci , 2 8 Diwali , 3 7 United States , 4 7 Earth , 5 6 Human , 6 6 Jesus , 7 6 Car , 8 6 Elmo , 9 6 Shrek , 10 6 Dog , 11 6 Elizabeth II , 12 6 List of fruits , 13 5 School , 14 5 Palindrome , 15 5 Renewable resource , 16 5 French and Indian War , 17 5 Deforestation , 18 5 Muhammad , 19 5 Abraham Lincoln , 20 5 Christopher Columbus , 21 5 Cat , 22 4 List of members of the European Parliament for the United Kingdom, 2014–19 , 23 4 Bad (Bodo culture) , 24 4 Stronium , 25 4 Lucrezia Marinella

nov 2016: 1 9 United States , 2 7 Dilmun , 3 6 Jesus , 4 6 Drake (musician) , 5 6 Lionel Messi , 6 6 Donald Trump , 7 6 President of the United States , 8 6 List of fruits , 9 5 Mitch Hedberg , 10 5 CJ the DJ , 11 5 United States presidential election, 2016 , 12 5 Simple English Wikipedia , 13 5 History of the United States , 14 5 Kanye West , 15 5 Bonobo , 16 5 Wikipedia , 17 5 African-American people , 18 5 Fidel Castro , 19 5 Writing , 20 5 Dog , 21 5 List of countries , 22 5 Afghanistan , 23 4 Church of the Company Fire , 24 4 Roger Joseph Boscovich , 25 4 O.T. Genasis

dez 2016: 1 7 United States , 2 7 Donald Trump , 3 6 Transiting Exoplanet Survey Satellite , 4 6 Earthquake , 5 6 List of countries , 6 5 Carrie Fisher , 7 5 Canada , 8 5 Simple English Wikipedia , 9 5 Greek mythology , 10 5 Christmas , 11 5 Ten Commandments , 12 5 Atom , 13 4 Vrbas (river) , 14 4 The Grand Tour (TV series) , 15 4 Dunstanburgh Castle , 16 4 2016 Berlin attack , 17 4 Christmas music , 18 4 Multiplication table , 19 4 Brahmanas , 20 4 Paget's disease , 21 4 Debbie Reynolds , 22 4 Iron , 23 4 History of the United States , 24 4 Mordred , 25 4 Metallic bond

jan 2017: 1 8 United States , 2 8 President of the United States , 3 7 Zdeněk Svěrák , 4 6 Jesus , 5 6 United States Secretary of State , 6 6 Gautama Buddha , 7 5 Jupiter Ghosh , 8 5 Heliskiing , 9 5 Nonsense mutation , 10 5 Milada Horáková , 11 5 IvaVerse , 12 5 Carl Johnson , 13 5 Holocaust victims , 14 5 Melania Trump , 15 5 Emma Morano , 16 5 United States presidential election, 2016 , 17 5 Roblox , 18 5 2017 , 19 5 Lionel Messi , 20 5 Phineas and Ferb , 21 5 Seven Years' War , 22 5 Taj Mahal , 23 5 Santa Claus , 24 5 Vice President of the United States , 25 5 Republican Party (United States)

fev 2017: 1 10 World War II , 2 9 Barack Obama , 3 8 PewDiePie , 4 7 School , 5 7 Chocolate , 6 6 Kendra Lust , 7 6 Betsy DeVos , 8 6 William Shakespeare , 9 6 LGBT rights in Palestine , 10 6 Minecraft , 11 6 Ductility , 12 6 Michael Jackson , 13 6 Pollution , 14 6 President of the United States , 15 6 Dog , 16 5 Luke M. Griswold , 17 5 Human , 18 5 Emma Morano , 19 5 Basic English , 20 5 United States , 21 5 Doha , 22 5 American Revolutionary War , 23 5 SpongeBob SquarePants , 24 5 Apartheid , 25 5 Abraham Lincoln

mar 2017: 1 12 Cat , 2 11 List of emotions , 3 9 Minecraft , 4 9 Masturbation , 5 9 Adolf Hitler , 6 9 Earthquake , 7 8 World War II , 8 8 Drake (musician) , 9 8 Renewable resource , 10 8 List of U.S. states , 11 7 Rosalind Franklin , 12 7 Pokémon , 13 7 Simple English Wikipedia , 14 7 Donald Trump , 15 7 Sacred cow , 16 7 J. Robert Oppenheimer , 17 7 Animal Farm , 18 7 England , 19 6 Mary Somerville , 20 6 Ada Yonath , 21 6 2020 United States presidential election , 22 6 Caroline Herschel , 23 6 Irène Joliot-Curie , 24 6 One Direction , 25 6 Ada Lovelace

abr 2017: 1 7 AlphaBay , 2 7 World War II , 3 7 Wikipedia , 4 6 2017 Stockholm attack , 5 6 Aaron Hernandez , 6 6 LGBT rights in Palestine , 7 6 Simple English Wikipedia , 8 6 Muhammad , 9 6 Electricity , 10 6 Dinosaur , 11 6 List of countries , 12 5 2017 Saint Petersburg Metro bombing , 13 5 Minecraft , 14 5 Hydra (mythology) , 15 5 Whopper , 16 5 Alcoholism , 17 5 Renewable resource , 18 5 Animal Farm , 19 5 Feminism , 20 5 Penguin , 21 5 Martin Luther King, Jr. , 22 4 Soyarabai , 23 4 Heat of combustion , 24 4 Pleione , 25 4 Violet Brown

mai 2017: 1 11 Homosexuality , 2 9 Allen Ginsberg , 3 8 Fidget spinner , 4 8 Lionel Messi , 5 7 Origin of life , 6 7 Republic P-47 Thunderbolt , 7 7 Wikipedia , 8 7 Holocaust denial , 9 7 Cat , 10 7 Potato , 11 6 Douglas A-26 Invader , 12 6 Bell P-39 Airacobra , 13 6 Curtiss P-40 Warhawk , 14 6 Grumman F4F Wildcat , 15 6 Grumman F6F Hellcat , 16 6 Boeing B-29 Superfortress , 17 6 U.S. Presidential line of succession , 18 6 Boeing B-17 Flying Fortress , 19 6 LGBT , 20 6 George Washington , 21 6 List of emotions , 22 5 Violet Brown , 23 5 World War II , 24 5 Canada , 25 5 Justin Bieber

jun 2017: 1 14 Lesbian , 2 10 England , 3 9 Computer , 4 8 Black people , 5 8 Communism , 6 7 Michael Jackson , 7 7 Dinosaur , 8 7 Cat , 9 6 Fidget spinner , 10 6 Violet Brown , 11 6 Steve Bannon , 12 6 Mitch McConnell , 13 6 Simple English Wikipedia , 14 6 Conservative Party (UK) , 15 6 Plastic , 16 6 God , 17 5 Subpoena , 18 5 Lesbian feminism , 19 5 Goji , 20 5 PewDiePie , 21 5 World War II , 22 5 Justin Bieber , 23 5 Knights of the Round Table , 24 5 Hinduism , 25 5 Brad Pitt

jul 2017: 1 9 Donald Trump , 2 9 Muhammad , 3 8 History of the United States , 4 8 India , 5 7 United States , 6 7 List of U.S. state slogans , 7 7 Homosexuality , 8 6 Violet Brown , 9 6 Lesbian kiss episode , 10 6 Nair , 11 6 Simple English Wikipedia , 12 6 CNN , 13 5 Shanghainese food , 14 5 Pennsauken Township, New Jersey , 15 5 Maryam Mirzakhani , 16 5 Justin Bieber , 17 5 Chester Bennington , 18 5 Volcanic eruption , 19 5 John Dalton , 20 5 Solar System , 21 5 Google , 22 4 Ram Nath Kovind , 23 4 Notes from the psychoanalysis of Knut Hamsun , 24 4 Kataragama temple , 25 4 Marc-André Fleury

ago 2017: 1 12 Zoe Cramond , 2 9 Justin Bieber , 3 8 Ten Commandments , 4 7 Violet Brown , 5 7 YouTube , 6 7 Names of God in Islam , 7 6 Teenager , 8 6 India , 9 5 Natural law , 10 5 Bruce Forsyth , 11 5 Roblox , 12 5 United States , 13 5 Kanye West , 14 5 List of U.S. state capitals , 15 5 Evolution , 16 5 Abraham Lincoln , 17 5 DNA , 18 5 Coal , 19 5 Photosynthesis , 20 5 Egypt , 21 5 Earth , 22 4 2017 Unite the Right rally , 23 4 Oldest people , 24 4 Nabi Tajima , 25 4 Dick Gregory

set 2017: 1 12 Ten Commandments , 2 9 Renewable resource , 3 8 Sue Wallace , 4 8 History of the United States , 5 8 Wikipedia , 6 8 Child , 7 8 Google , 8 7 Hurricane Irma , 9 7 Johnny Gaudreau , 10 7 United States , 11 7 List of Egyptian gods and goddesses , 12 6 Hydroelectricity , 13 6 Teenager , 14 6 George Washington , 15 6 DNA , 16 5 Human geography , 17 5 List of scientists from Europe , 18 5 2017 Chiapas earthquake , 19 5 Howard Hawks , 20 5 Jeremy Corbyn , 21 5 Merian C. Cooper , 22 5 Dating , 23 5 Barack Obama , 24 5 Drake (musician) , 25 5 Brigham Young University

out 2017: 1 24 Google , 2 21 Playground , 3 20 The Lightning Thief , 4 19 Frame (vehicle) , 5 19 Boeing 747 , 6 16 Charlie Sheen , 7 15 Masaccio , 8 14 Doreen Mantle , 9 14 Islam , 10 13 Simple English Wikipedia , 11 13 List of Egyptian gods and goddesses , 12 11 Indonesia AirAsia Flight 8501 , 13 11 Ten Commandments , 14 10 Yahoo! , 15 9 Harold Goodwin , 16 9 Gabrielle Blunt , 17 9 Hydroelectricity , 18 8 Sue Wallace , 19 8 Gordon Peters , 20 8 Canada , 21 8 Renewable resource , 22 8 Coal , 23 8 Science , 24 7 Geoffrey Chater , 25 7 Jesus

nov 2017: 1 12 Wikipedia , 2 9 Joe Keery , 3 9 List of Egyptian gods and goddesses , 4 9 Cat , 5 8 Ajit Pai , 6 8 United States , 7 8 Jesus , 8 8 American Revolutionary War , 9 7 Jake Paul , 10 7 U.S. Presidential line of succession , 11 7 Jon Bon Jovi , 12 7 Earth , 13 6 Justin Bieber , 14 6 Simple English Wikipedia , 15 6 Animal Farm , 16 6 Snake , 17 6 Hydroelectricity , 18 6 Moose , 19 6 George Washington , 20 6 Elizabeth II , 21 6 India , 22 6 Google , 23 5 Sutherland Springs church shooting , 24 5 Don River, Russia , 25 5 Formic acid

dez 2017: 1 10 Barack Obama , 2 10 Pollution , 3 9 United States , 4 9 North Korea , 5 8 Protestant Reformation , 6 8 Christmas , 7 7 Voov , 8 7 LeBron James , 9 7 Fibreglass , 10 7 Nazi Germany , 11 7 Apple Inc. , 12 6 Conor McGregor , 13 6 Kim Jong-un , 14 6 Judaism , 15 6 History of the United States , 16 6 Blizzard , 17 6 Earth's crust , 18 6 Santa Claus , 19 6 Ten Commandments , 20 6 God , 21 6 France , 22 5 List of places in Cornwall , 23 5 Jake Paul , 24 5 Deaths in 2017 , 25 5 Bitcoin

jan 2018: 1 12 Shanghai Water Gate Museum , 2 12 Doreen Mantle , 3 12 Simple English Wikipedia , 4 11 Slash (punctuation) , 5 11 Wikipedia , 6 10 Bill Clinton , 7 10 Ten Commandments , 8 8 Kundali Bhagya , 9 8 United States , 10 8 History of the United States , 11 8 Jay-Z , 12 8 Google , 13 7 Deaths in 2018 , 14 7 The Lightning Thief , 15 7 Barack Obama , 16 7 Justin Bieber , 17 7 McDonald's , 18 7 Feces , 19 7 Death penalty , 20 7 North Korea , 21 7 Computer , 22 6 Famous places in Shanghai , 23 6 Ingvar Kamprad , 24 6 Islam , 25 6 Drake (musician)

fev 2018: 1 11 Wikipedia , 2 10 Jesus , 3 9 List of Egyptian gods and goddesses , 4 9 Abraham Lincoln , 5 9 Internet , 6 8 Ireland , 7 8 Google , 8 7 Ishq Subhan Allah , 9 7 Jake Paul , 10 7 Jacob Zuma , 11 7 Death zone , 12 7 Earth's crust , 13 7 Pollution , 14 7 Martin Luther King, Jr. , 15 7 Cold War , 16 7 Ten Commandments , 17 7 India , 18 7 Earth , 19 6 Aap Ke Aa Jane Se , 20 6 IPhone X , 21 6 Intensive farming , 22 6 Kim Jong-un , 23 6 Erosion , 24 6 Japanese American internment , 25 6 Judaism

mar 2018: 1 15 Kaduna State , 2 11 Google , 3 9 Chinese people , 4 9 Alan Jackson , 5 9 Canada , 6 9 U.S. Presidential line of succession , 7 9 Big Ben , 8 9 Wikipedia , 9 9 Boeing 747 , 10 9 Cat , 11 8 Jake Paul , 12 8 Charlie Sheen , 13 8 Supreme Court of the United States , 14 8 Stephen Hawking , 15 8 Abraham Lincoln , 16 7 Howard Zinn , 17 7 Akon , 18 7 George Washington , 19 7 Penis , 20 7 California , 21 6 David Benton , 22 6 Frame (vehicle) , 23 6 List of Nazi concentration camps , 24 6 Wiz Khalifa , 25 6 Roblox

abr 2018: 1 23 Kaduna State , 2 15 List of countries , 3 14 Capsaicin , 4 11 Alan Jackson , 5 10 Where Were You (When the World Stopped Turning) , 6 10 United States , 7 10 Hulk Hogan , 8 9 Jake Paul , 9 9 The Elder Scrolls V: Skyrim , 10 9 Wiz Khalifa , 11 9 Google , 12 8 Prince Louis of Cambridge , 13 8 Xi Jinping , 14 8 Netflix , 15 8 YouTube , 16 8 The Eagles , 17 8 Roman , 18 7 Fortnite Battle Royale , 19 7 Roblox , 20 7 Grey wolf , 21 7 Abraham Lincoln , 22 6 Pig War (1859) , 23 6 Li Xiaoxia , 24 6 Office central de lutte contre les crimes contre l'humanité , 25 6 Oxalaia

mai 2018: 1 12 Fortnite Battle Royale , 2 12 Justin Bieber , 3 12 Adolf Hitler , 4 10 Devo , 5 9 Where Were You (When the World Stopped Turning) , 6 9 Kim Jong-un , 7 9 Wikipedia , 8 9 The Eagles , 9 8 Kaduna State , 10 8 Simple English Wikipedia , 11 8 Rabbit , 12 8 Stephen Hawking , 13 8 Google , 14 7 Randy Meisner , 15 7 RÚV , 16 7 Meghan, Duchess of Sussex , 17 7 Jake Paul , 18 7 Minecraft , 19 7 Alan Jackson , 20 7 Fanta , 21 7 James I of England , 22 7 Penguin , 23 7 Football , 24 7 Cat , 25 6 Naagin 3

jun 2018: 1 23 Planes (movie) , 2 22 Stephen Colbert , 3 22 Boeing 747 , 4 22 Google , 5 21 Jimmy Wales , 6 18 Netflix , 7 16 Bomis , 8 15 The Lightning Thief , 9 12 Charlie Sheen , 10 11 Frame (vehicle) , 11 11 Playground , 12 10 Deaths in 2018 , 13 9 United States , 14 9 Adolf Hitler , 15 9 Earthquake , 16 8 2018 FIFA World Cup , 17 8 History of the United States , 18 7 Fortnite , 19 7 England , 20 6 XXXTentacion , 21 6 Aryankavu , 22 6 Fortnite Battle Royale , 23 6 Kaduna State , 24 6 List of longest-living state leaders , 25 6 Kim Jong-un

jul 2018: 1 7 Simple English Wikipedia , 2 7 FIFA World Cup , 3 6 2018 FIFA World Cup knockout stage , 4 6 Constitutional republic , 5 6 Schaffhausen , 6 6 YouTube , 7 5 Manoj (given name) , 8 5 Chirashizushi , 9 5 Goheimochi , 10 5 Matthew Waterhouse , 11 5 Indigenous marriage in South Africa , 12 5 NatWest , 13 5 Erica Yohn , 14 5 Len Carlson , 15 5 Neymar , 16 5 Victoria Wood , 17 5 Justin Bieber , 18 5 Black people , 19 5 Eminem , 20 5 List of emotions , 21 5 Republic of China , 22 5 People's Republic of China , 23 5 Jupiter , 24 5 China , 25 4 Marie Avgeropoulos

ago 2018: 1 13 Asteroid impact prediction , 2 9 Pope Gelasius I , 3 8 Pope Adeodatus I , 4 8 Pope Symmachus , 5 8 Pope Hormisdas , 6 7 Doreen Mantle , 7 7 Gabrielle Blunt , 8 7 John McCain , 9 7 Wikipedia , 10 6 Pope Liberius , 11 6 Ponte Morandi , 12 6 Kisumu , 13 6 Lucky Dube , 14 6 Hulk Hogan , 15 6 Donald Trump , 16 6 Thoth , 17 6 Aretha Franklin , 18 5 Antoine Griezmann , 19 5 N'Golo Kanté , 20 5 Alan Garner , 21 5 Harold Goodwin , 22 5 Takeshi Onaga , 23 5 Pimple , 24 5 Keeping Up Appearances , 25 5 Islam

set 2018: 1 9 Donald Trump , 2 9 Falun Gong , 3 8 Islam , 4 7 Deaths in 2018 , 5 7 List of Egyptian gods and goddesses , 6 7 Environment , 7 7 List of planets , 8 6 Machine Gun Kelly (rapper) , 9 6 Pluto , 10 6 Rock (geology) , 11 6 Wall Street Crash of 1929 , 12 6 List of religions , 13 5 Japan Victor Company , 14 5 Eugene Thomas Long , 15 5 Hurricane Florence , 16 5 Lista Roja de Ecosistemas de la UICN , 17 5 Crimean Tatar Wikipedia , 18 5 National Museum of Brazil , 19 5 Quaker State 400 , 20 5 Pope Hormisdas , 21 5 2018 Atlantic hurricane season , 22 5 President of India , 23 5 Villi , 24 5 Temperate zone , 25 5 Gay

out 2018: 1 10 Falun Gong , 2 10 Ten Commandments , 3 9 Adolf Hitler , 4 8 Fortnite , 5 8 Islam , 6 8 Hades , 7 7 Hurricane Michael , 8 7 List of U.S. state slogans , 9 7 Grass , 10 7 Supreme Court of the United States , 11 7 George Washington , 12 7 List of vegetables , 13 7 Elephant , 14 6 Deaths in 2018 , 15 6 United States , 16 6 Samuel de Champlain , 17 6 List of national rulers , 18 6 Mansa Musa , 19 6 History of Christianity , 20 6 U.S. Presidential line of succession , 21 6 Baby , 22 6 John F. Kennedy , 23 6 Big Bang , 24 6 Communism , 25 6 India

nov 2018: 1 10 YouTube , 2 10 Wikipedia , 3 9 Adolf Hitler , 4 8 World War II , 5 8 Five Pillars of Islam , 6 8 U.S. Presidential line of succession , 7 8 India , 8 7 Fortnite , 9 7 President of India , 10 7 History of Christianity , 11 7 Pollution , 12 7 Volcano , 13 6 Xuanwu Lake , 14 6 Radha Krishn , 15 6 Tyson Fury , 16 6 Markiplier , 17 6 Air pollution , 18 6 Diwali , 19 6 Supreme Court of the United States , 20 6 Mormonism , 21 6 Middle Ages , 22 6 Earthquake , 23 6 London , 24 5 Hongshan Zoo , 25 5 Nanjing Presidential Palace

dez 2018: 1 8 PewDiePie , 2 8 Alan Jackson , 3 8 Five Pillars of Islam , 4 8 YouTube , 5 8 George Washington , 6 7 Where Were You (When the World Stopped Turning) , 7 7 Supreme Court of the United States , 8 7 Hades , 9 7 John F. Kennedy , 10 6 Justin Bieber , 11 6 Debito Arudou , 12 6 Anime , 13 6 Pollution , 14 6 Christmas , 15 6 India , 16 5 Mahesh Athirala , 17 5 Newar people , 18 5 Bajlo Tomar Alor Benu , 19 5 Stone City , 20 5 Darwiish State , 21 5 Randy Meisner , 22 5 Deaths in 2018 , 23 5 Islam , 24 5 Eureka Stockade , 25 5 Koppa (letter)

Wikipedias are initially ordered by number of speakers of the language

Speakers: Number of speakers of a language is the estimated total of primary and secondary speakers, is in many cases a very rough estimation (based on the page on the English Wikipedia about that language)
Regions are parts of the world where the language is spoken in substantial amounts (compared to total number of speakers). Regions where a language gained presence only by a recent diaspora are generally not included.
Region codes: AF:Africa, AS:Asia, EU:Europe, NA:North America, OC:Oceania, SA:South America, W:World Wide, CL:Constructed Language

Estatísticas geradas em Sexta-feira, 1 de fevereiro 2019 08:45 (final run)

Dump file simplewiki-20190101-stub-meta-history.xml.gz (edits only), size 406 Mb as gz -> 2.6 Gb
Dump processed till Dec 31, 2018, on server stat1007, ready at Sun-06/01/2019-00:58 after 18 min, 33 sec.

Autor:Erik Zachte (2002-Jan 2019) (Sítio web)
Endereço:erikzachte@### (no spam: ### = infodisiac.com)
Documentation / Scripts / CSV files: About WikiStats

You can download the English version of these reports here (also download common_files.zip)
You can download aggregated data here

All data and images on this page are in the public domain.