Estatísticas da Wikipédia vepsian

Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Articles per size range / Records per namespace / Most edited articles / Zeitgeist
  May 2016: The major overhaul of Wikistats reports has entered a new phase.  

  First phase focused on migrating the traffic analysis reports to our new infrastructure. Those are operational now.  
  The Analytics Team will now proceed to also migrate data collection and reporting about wiki content and contributors.  
  First results are expected later this year.  

  More info at this announcement
  You can still tell us which reports you want to see preserved, in this survey.


Most metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.

Some metrics have been collected from the full archive dump which runs on lower frequency than the usual monthly cycle.
These metrics are columns F,I,J,K,M,N,O,P,Q,R from the first table.

See also metrics definitions

Monthly counts & Quarterly rankings: dezembro 2016
DataWikipedistasArtigosBase de dadosLigações
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
dez 20160%   +1%      +172%      +2%
nov 20160%   0%      +31%      +1%
out 20160%   0%      -14%      0%
set 20160%   0%      -12%      0%
ago 20160%   0%      -49%      +1%
jul 2016+3%   +1%      -13%      +1%
dez 201663 115,3 k 210,9   1,0 k      2,2 k
nov 201663 315,2 k  10,9   376      2,2 k
out 201663 215,2 k  10,8   286      2,2 k
set 201663 215,2 k 110,8   334      2,2 k
ago 201663 315,1 k  10,8   381      2,2 k
jul 2016632525,1 k 110,7   743      2,1 k
jun 201661 315,1 k 110,6   854      2,1 k
mai 2016611315,1 k 110,5   527      2,1 k
abr 201660 3 5,0 k  10,5   126      2,1 k
mar 2016602415,0 k  10,5   375      2,1 k
fev 201658 215,0 k  10,4   411      2,1 k
jan 2016581315,0 k 110,3   330      2,1 k
dez 201557 415,0 k 110,3   488      2,1 k
nov 2015571515,0 k 110,3   487      2,0 k
out 2015561414,9 k 110,3   325      2,0 k
set 201555 214,9 k 310,2   1,2 k      2,0 k
ago 2015551524,8 k 210,2   953      2,0 k
jul 201554 324,8 k 810,1   1,4 k      1,9 k
jun 2015541324,5 k 610,4   1,0 k      1,7 k
mai 201553 524,3 k 310,5   880      1,5 k
abr 2015533514,3 k 210,5   556      1,3 k
mar 201550 214,2 k 110,5   241      1,2 k
fev 201550 214,2 k 110,6   310      1,2 k
jan 201550 3 4,1 k 110,6   201      1,2 k
dez 201450 2 4,1 k  10,6   76      1,1 k
nov 201450 3 4,1 k 110,6   145      1,1 k
out 201450 2 4,1 k  10,6   155      1,1 k
set 201450 314,1 k 110,6   226      1,1 k
ago 2014501414,1 k 110,6   389      1,1 k
jul 201449 214,0 k 110,5   183      1,0 k
jun 20144915 4,0 k 110,5   228      1,0 k
mai 201448 214,0 k 110,6   403      996
abr 201448 323,9 k 210,6   484      975
mar 201448 423,9 k 110,6   610      942
fev 201448 413,8 k2,1 k110,644521%3%2912,6 Mb228 k23 k1361921,0 k928
jan 201448 413,8 k2,1 k210,644120%3%7462,6 Mb224 k23 k137192996911
dez 2013481723,8 k2,0 k310,543120%3%8512,5 Mb216 k22 k172191975871
nov 2013472713,7 k1,9 k210,642119%3%3012,3 Mb206 k21 k175190938825
out 201345 313,6 k1,9 k210,641419%3%3312,3 Mb201 k20 k176184933814
set 201345 4 3,5 k1,8 k110,741519%3%2072,2 Mb197 k20 k175184917801
ago 201345 313,5 k1,8 k210,741319%3%2152,2 Mb195 k20 k168182913792
jul 201345 413,5 k1,8 k210,841319%3%3822,2 Mb193 k19 k205182910778
jun 2013451423,4 k1,7 k410,941118%3%6312,1 Mb188 k19 k215181895752
mai 201344 423,3 k1,6 k311,140518%3%5652,1 Mb179 k18 k281179873684
abr 201344 423,2 k1,6 k611,239918%3%8722,0 Mb171 k17 k376181791664
mar 201344 613,0 k1,5 k411,640118%3%3,8 k1,9 Mb163 k16 k1,3 k181747633
fev 201344 412,9 k1,4 k310,739719%3%1,5 k5,0 Mb156 k15 k134 k179713603
jan 201344 512,8 k1,4 k310,540019%3%1,6 k4,9 Mb153 k14 k131 k187704586
dez 2012443622,8 k1,3 k810,240319%3%2,4 k4,8 Mb149 k14 k128 k200691573
nov 2012411622,5 k1,3 k910,341720%3%2,3 k4,5 Mb141 k13 k119 k220637517
out 20124041022,3 k1,1 k610,442421%3%2,5 k4,2 Mb128 k11 k112 k241559450
set 2012361632,1 k969610,241820%3%3,3 k3,8 Mb114 k9,5 k104 k259486384
ago 201235 711,9 k85829,441020%3%1,3 k3,5 Mb102 k7,6 k98 k371399315
jul 201235 421,8 k81329,140520%3%1,4 k3,4 Mb97 k7,1 k95 k433366294
jun 2012351631,7 k784158,639920%3%2,9 k3,3 Mb93 k6,6 k93 k535376275
mai 2012342631,3 k681159,344924%4%2,0 k2,6 Mb78 k5,2 k75 k718311164
abr 201232261843573311,956332%5%8772,1 Mb64 k3,8 k60 k768203135
mar 20123027176651031255029%5%1,0 k2,0 Mb57 k3,2 k55 k837154108
fev 2012283123672442312,156932%6%2,5 k1,8 Mb52 k2,8 k50 k94914596
jan 201225 4 59338229,558233%6%2421,6 Mb47 k2,5 k46 k87412185
dez 20112516254233749,958632%7%6391,5 Mb44 k2,3 k42 k80812168
nov 201124 5 419256 11,360536%7%5831,2 Mb35 k2,0 k33 k56410952
out 201124121406252 10,261737%7%2211,2 Mb35 k1,9 k31 k55211049
set 20112327 398251 9,962838%8%1211,2 Mb35 k1,9 k30 k54810949
ago 20112157 38823819,861438%7%1741,1 Mb33 k1,9 k30 k52010445
jul 201116 11370220 9,859836%7%1251,1 Mb31 k1,8 k29 k5099545
jun 20111614 370215 9,553734%5%871,1 Mb28 k1,6 k29 k5127044
mai 201115 6 366210 9,353734%5%2691,1 Mb27 k1,6 k29 k5116944
abr 201115 5 364208 8,753433%5%1111,0 Mb27 k1,6 k28 k5066844
mar 201115 8136020218,450631%5%3121,0 Mb25 k1,5 k28 k5006144
fev 201115 61339185 845729%4%298947 kb22 k1,2 k26 k4683721
jan 20111524233217727,341927%4%622917 kb20 k1,1 k26 k4593016
dez 201013151267106 6,838019%4%216642 kb14 k95618 k3012111
nov 201012342260105 6,142120%5%298477 kb15 k89211 k2952011
out 20109   24896 5,235020%4% 260 kb12 k7824,4 k2561211
set 20109   24896 5,235020%4% 260 kb12 k7824,4 k2561211
ago 20109   24896 5,235020%4%3260 kb12 k7824,4 k2561211
jul 20109   24796 5,235120%4%7260 kb12 k7804,4 k2551211
jun 20109   24796 5,235120%4%1260 kb12 k7804,4 k2551211
mai 20109   24796 5,235120%4%5260 kb12 k7794,4 k2551211
abr 20109   24494 5,235020%4%2257 kb12 k7524,4 k2511211
mar 2010922124494 5,235020%4%169257 kb12 k7524,4 k2521211
fev 20107   23990 4,636020%4%4224 kb12 k1983,5 k247811
jan 20107   23990 4,636020%4%2224 kb12 k1983,5 k247811
dez 20097 1 23990 4,636020%4%74224 kb12 k1983,5 k246811
nov 20097 112399014,336020%4%202222 kb12 k1983,5 k246811
out 20097 112176823,828912%3%150190 kb9,2 k1793,4 k172811
set 2009712 1665414,130211%4%133163 kb7,1 k1853,3 k8588
ago 20096 1 14536 3,727410%3%692 kb5,6 k931,4 k6824
jul 20096 1 14435 3,727510%3%1491 kb5,5 k931,4 k6724
jun 20096   14232 3,726911%3% 88 kb5,3 k691,3 k6524
mai 20096   14232 3,726911%3% 88 kb5,3 k691,3 k6524
abr 2009611 14232 3,726911%3%1388 kb5,3 k691,3 k6524
mar 2009513 14130 3,625710%3%2886 kb5,1 k451,3 k6224
fev 20094 2 13628 3,525510%3%3785 kb5,0 k411,3 k6324
jan 200942411232223,62268%2%28277 kb4,1 k301,3 k6024
dez 20082 2 503 3,21334%2%1220 kb1,1 k1135516 3
nov 20082   483 3,11324%2% 16 kb1,0 k724714 3
out 20082   483 3,11324%2% 16 kb1,0 k724714 3
set 20082   483 3,11324%2% 16 kb1,0 k724714 3
ago 20082   483 3,11324%2% 16 kb1,0 k724714 3
jul 20082 1 483 3,11324%2%716 kb1,0 k724714 3
jun 20082   423 3,41465%2% 15 kb99272418 3
mai 20082 1 42313,41465%2%4215 kb99272418 3
abr 20082 2 213 4,724110%5%1510 kb88571192 3
mar 20082 1 172 4,91636% 225,1 kb4874161 3
fev 2008221 142 4,41827% 624,3 kb4592141 3
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternas

> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
The following table ranks this project in relation to projects in other languages with 1000+ articles
out 2016170 172128162  194   138      237
jul 201616497123102159 136195   112      237
abr 2016172 141 158  195   157      237
jan 2016175142155136157 145195   138      237
out 2015177128144132157 143197   138      237
jul 2015177 15099156 70199   96      237
abr 201517794128142160 122196   124      237
jan 2015177 147 161 150196   158      237
out 2014177 171 160  198   148      237
jul 2014177 163129161 143197   149      237
abr 2014176 150100159 119194   119      237
jan 2014172169134136156171122193197192191115192189177213212183237
out 2013173152150121157170114193198194191125196190179213213186237
jul 2013172139133130156171114193197194193127195190179212213184237
abr 201317214814010415817687190199194191129196195181202211186237
jan 2013169147124134164177108194194189188156190198181169209188237
out 2012171779410117718184193191187186127195200187173204192237
jul 2012177139140106184192117196191187186163200205200181186197237
abr 2012181102116135205199105204203203201190208216213197165211237
jan 2012193156142140209210118203202202200218211218218200160217237
out 2011192134169131216212158202201201199222214220218209175215237
jul 2011214151191125213211160199198198196228213218216207174216237
abr 2011214141128131213209159197196196194226213217218206173220237
jan 20112129613898215212116197196196194205217219218205175225237
out 2010222148208127215215151190189189187235226221220224190229237
jul 2010219160220142215215158185184184182235225218217224189227237
abr 2010218148205135210211155182181181180234222217216220183225237
jan 2010222144200131209211152180180180179231222217225223186227237
out 2009220143193125208214118177177177176211223220227222194227237
jul 2009221189184131212218149170170170169226227222227225212230237
abr 2009219123185143210219146167167167166227226220225225210228237
jan 200922693126119210220119162162162161195225221230223210227237
out 2008230133195129220230145156156156155232228228231225226230236
jul 2008227144183131216226145150150150148225225225230224222229235
abr 2008225146159126225225146145145144142224226225229224225227235
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
 WikipedistasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikipedistas (usuários registrados)
A = Wikipedistas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikipedistas que editaram pelo menos dez vezes desde que chegaram
C = Wikipedistas que contribuíram cinco vezes ou mais este mês
D = Wikipedistas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Artigos que contêm pelo menos uma ligação interna e 200 caracteres de texto legível, não contando códigos wiki e html,
      ligações ocultas, etc.; títulos também não contam (outras colunas são baseadas no método oficial de contagem)
G = Novos artigos por dia no mês passado
H = Número médio de revisões por artigo
I = Tamanho médio dos artigos em bytes
J = Porcentagem de artigos com pelo menos 0,5 kb de texto legível (veja F)
K = Porcentagem de artigos com pelo menos 2 kb de texto legível (veja F)

Base de dados
L = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
M = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
N = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

O = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
P = Total de ligações para outras wikipédias
Q = Total de imagens apresentadas
R = Total de ligações para outros sítios
S = Total de páginas de redirecionamento

Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  5  10  100  1000  1  3  5  10  25  100  1  3  5  10  25  100  250  5  10  100 
dez 20166311111     4221   311111 11 
nov 20161143111      111    421111 11 
out 20161032211      2111   32111  11 
set 2016932221  1   6111   41111     
ago 20161533221      5321   43221     
jul 20169655321     53221  322111 1  
jun 201610333211 1   42211  611111 11 
mai 201610433311 11  8321   42211  11 
abr 201693321      721    4211   11 
mar 201616543111     321    5221   11 
fev 201612222111 11  221    62111  11 
jan 20168532211     9321   644211 11 
dez 201514543311     8532   554211 11 
nov 201514552111 1   4      52111     
out 20151554321  1   411    311    1  
set 20159222211111  104     5332111   
ago 201517553222 11  53     322221111 
jul 201515333222     422    3222222   
jun 201514532222 1   221    422222    
mai 201515655321     7321   5332211   
abr 20151455541      643    53211     
mar 2015632211      4      42211     
fev 20151022111  1   432    7211111   
jan 2015124332      6311   843111    
out 20161032211      2111   32111  11 
jul 20169655321     53221  322111 1  
abr 201693321      721    4211   11 
jan 20168532211     9321   644211 11 
out 20151554321  1   411    311    1  
jul 201515333222     422    3222222   
abr 20151455541      643    53211     
jan 2015124332      6311   843111    
out 201494222      321    6211      
jul 20141122111      5332   42221     
abr 201410332221     43211  52221     
jan 201414544411 11  74422  854311 1  
out 20135333211     4211   6211      
jul 20131654331      53321  94411     
abr 201317544222 33  53221  97421  331
jan 20131155431  15123 632111 133321  661
out 20121910108521 1383 94332  18854311762
jul 201215644221 1083 832111 2653222 66 
abr 20121466431  11102 9541   16632   53 
jan 201275442      54332  32211     
out 2011722111      1      1111      
jul 2011111111  1          21        
abr 201165541      1      21        
jan 20115444221     421    4332      
out 2010          1                
jul 2010      1          111       
abr 20101                2211      
jan 2010                           
out 2009221111             11111     
jul 20091111                        
abr 2009221                         
jan 2009444331      332    32222     
out 2008                           
jul 2008211                         
abr 2008222                         


Distribuição de edições de artigos por wikipedistas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...

Edições >=WikipedistasEdições total


6 wikipedistas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias

 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
30 dias
30 dias
30 dias
30 dias
KoiravvaUC1 010,8075904,906141out 21, 2012153155516--
SebranikUC3 02,72978682mai 15, 201216908231--
Андрей ПогадаевUC113...44--dez 08, 201622----
INeverCryUC180+14221--set 18, 2014834----
Berthold WernerUC428...11--dez 12, 201618----
RiwnodennykUC429...11--dez 12, 201618----


20 wikipedistas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

  Primeira ediçãoúltima edição
Tamara UstinovaUC29,044out 19, 20111899mai 26, 2014949
SihlaineUC42,212nov 05, 20131151set 05, 2014847
K9re11UC52,092fev 03, 20141061out 23, 2015434
МаксимUC61,502dez 29, 20111828jul 07, 2014907
IgriksUC71,461set 18, 20092660mai 14, 20131326
Игорь БродскийUC81,266fev 23, 20092867dez 04, 2015392
IketsiUC91,165jun 15, 20112025jul 30, 2014884
WolverèneUC10919mai 12, 2014963nov 17, 201643
Andrijko Z.UC11769nov 08, 20102244nov 20, 20111867
MF-WarburgUC12680fev 01, 20121794fev 07, 20131422
SuraUC13259fev 19, 20083237mar 31, 20112101
Midnight GreenUC14202ago 24, 20111955jun 25, 20121649
Анна ОзероваUC15189mai 11, 2016233jul 22, 2016161
PorbóllettUC16157nov 24, 20131132dez 28, 2015368
Triple-ADHD-ASUC17156jan 17, 20092904dez 09, 20092578
U.SteeleUC18139ago 11, 20111968jul 20, 20121624
RomaineBotUC19130mar 30, 20102467mar 30, 20102467
Connection 3UC20108jun 27, 20131282set 21, 20131196
BudelbergerUC2190dez 11, 20082941fev 22, 20092868
CastellumUC2286out 15, 20121537out 20, 20121532


Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 1.747 edições foram feitas por usuários anônimos, de um total de 57.389 edições ( 3e %)

43 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
EmausBotUC14,378fev 03, 20121792set 03, 2016118--
MerlIwBotUC23,510mai 10, 20112061ago 09, 20131239--
AddbotUC32,947mar 07, 20131394ago 19, 20131229--
XqbotUC41,810abr 16, 20121719mar 06, 20131395--
GerakibotUC5559mai 24, 20121681mar 06, 20131395--
JackieBotUC6555fev 09, 20121786mar 02, 20131399--
AvocatoBotUC7542fev 08, 20121787jul 10, 20121634--
LegobotUC8411mar 11, 20131390abr 02, 20131368--
RedBotUC9381abr 21, 20121714ago 21, 20121592--
JAnDbotUC10354fev 03, 20121792jul 02, 20131277--
Idioma-botUC11229fev 03, 20121792mar 05, 20131396--
YFdyh-botUC12204jun 24, 20121650fev 27, 20131402--
Makecat-botUC13185out 26, 20121526mar 05, 20131396--
HiW-BotUC14173fev 05, 20121790nov 08, 20121513--
LaaknorBotUC15134fev 04, 20121791mar 03, 20131398--
Justincheng12345-botUC16129jun 23, 20121651jan 08, 20131452--
Luckas-botUC17115abr 01, 20121734mai 20, 20121685--
VolkovBotUC18107fev 14, 20121781mar 04, 20131397--
CommonsDelinkerUC19106set 30, 20092648dez 18, 201612--
AvicBotUC2092jun 01, 20121673dez 09, 20121482--
EscarbotUC2186mar 06, 20121760mai 19, 2016225--
KLBot2UC2269abr 13, 20131357jul 07, 20131272--
VagobotUC2353fev 29, 20121766set 04, 20121578--
SantoshBotUC2441out 24, 20121528mar 04, 20131397--
PixelBotUC2533fev 20, 20121775mar 03, 20131398--
KamikazeBotUC2633fev 29, 20121766jan 26, 20131434--
CarsracBotUC2730fev 12, 20121783fev 24, 20131405--
SynthebotUC2825mai 16, 20121689dez 30, 20121461--
WikitanvirBotUC2920fev 04, 20121791abr 05, 20121730--
RobbotUC3019fev 04, 20121791set 02, 20121580--
タチコマ robotUC3114dez 28, 20111829out 21, 20121531--
JotterbotUC3214jan 15, 20131445jan 26, 20131434--
DragonBotUC3311jan 12, 20131448jan 14, 20131446--
SassoBotUC349mai 29, 20121676mar 04, 20131397--
GhalyBotUC358dez 27, 20121464jan 31, 20131429--
CompBotUC367mar 24, 20121742mai 21, 20121684--
CocuBotUC377nov 30, 20121491fev 11, 20131418--
OctraBotUC387jan 28, 2015702fev 02, 2015697--
NjardarBotUC394jun 16, 20121658out 27, 20121525--
YiFeiBotUC403ago 07, 2015511dez 31, 2015365--
MastiBotUC412fev 26, 20131403fev 28, 20131401--
MalarzBOTUC421ago 18, 20121595ago 18, 20121595--
TXiKiBoTUC431dez 20, 20121471dez 20, 20121471--


Artigos que contêm pelo menos uma ligação interna e .. caracteres de texto legível, não contando códigos wiki e html,
ligações ocultas, etc.; títulos também não contam  (excluindo páginas de redirecionamento)

 < 32 ch< 64 ch< 128 ch< 256 ch< 512 ch< 1 k ch< 2 k ch< 4 k ch< 8 k ch< 16 k ch< 32 k ch< 64 k ch


Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.

categorizados 1
dez 20167,5 k46066 768012,6 k       
nov 20167,4 k45866 767912,5 k       
out 20167,4 k45866 767912,5 k       
set 20167,3 k45866 767912,4 k       
ago 20167,3 k45766 767912,4 k       
jul 20167,3 k45563 767812,4 k       
jun 20167,2 k45363 767812,3 k       
mai 20167,2 k45261 767712,3 k       
abr 20167,1 k45161 767512,2 k       
mar 20167,1 k44861 767512,2 k       
fev 20167,1 k44761 767312,2 k       
jan 20167,1 k44661 767112,2 k       
dez 20157,1 k44661 766712,1 k       
nov 20157,0 k44360 766012,1 k       
out 20157,0 k44360 766012,0 k       
set 20156,9 k44360 764812,0 k       
ago 20156,8 k44160 757711,9 k       
jul 20156,7 k44160 756411,8 k       
jun 20156,2 k44060 755511,7 k       
mai 20155,8 k44060 754811,6 k       
abr 20155,6 k43859 753311,5 k       
mar 20155,4 k43759 752411,5 k       
fev 20155,4 k43659 751611,4 k       
jan 20155,3 k43259 740811,4 k       
dez 20145,2 k42559 740811,3 k       
nov 20145,2 k42459 740811,3 k       
out 20145,2 k42259 740711,2 k       
set 20145,2 k42059 740711,2 k       
ago 20145,1 k41659 740311,2 k       
jul 20145,1 k40758 738011,1 k       
jun 20145,0 k40657 737211,1 k       
mai 20145,0 k40551 637211,1 k       
abr 20144,9 k39749 636711,1 k       
mar 20144,8 k39547 636411,1 k       
fev 20144,8 k38946 635711,1 k      280
jan 20144,7 k38645 635611,0 k      722
dez 20134,6 k38140 63481988      839
nov 20134,5 k37939 63471967      298
out 20134,4 k37438 63391964      328
set 20134,3 k37137 63391956      144
ago 20134,3 k35736 63391955      197
jul 20134,3 k35536 63381948      361
jun 20134,2 k34936 63331947      610
mai 20134,0 k34736 63331942      530
abr 20133,9 k33835 63181918      723
mar 20133,7 k32733 63141911      378
fev 20133,5 k20532 63141905      276
jan 20133,4 k19331 63141901      240
dez 20123,3 k18728 63081897      1002
nov 20123,0 k17628 63031869      1170
out 20122,7 k17125 42981786      1427
set 20122,4 k16323 42771646      2204
ago 20122,2 k15323 42591438      439
jul 20122,1 k14521 42571396      585
jun 20122,0 k13015 42331348      1695
mai 20121,5 k1159 41491225      1113
abr 20129781047 21421207      365
mar 2012874927 21411206      313
fev 2012768805 2140 190      1723
jan 2012678 4  131 179      239
dez 2011610 4  131 176      464
nov 2011471 3  128 170      222
out 2011455 3  128 170      219
set 2011447 3  128 170      118
ago 2011433 3  123 167      172
jul 2011415 3  123 166      115
jun 2011414 3  123 164      71
mai 2011410 3  123 164      65
abr 2011408 3  119 164      110
mar 2011404 3  119 164      310
fev 2011359 3  91 161      295
jan 2011347 3  90 157      620
dez 2010277 3  90 155      211
nov 2010270 3  89 155      289
out 2010258 3  88 155       
set 2010258 3  88 155       
ago 2010258 3  88 155      2
jul 2010257 3  88 155       
jun 2010257 3  85 155       
mai 2010257 3  85 155      4
abr 2010254 3  85 154      1
mar 2010254 3  84 154      161
fev 2010249 3  63 103      2
jan 2010249 3  63 103       
dez 2009249 3  63 103      14
nov 2009249 3  63 103      189
out 2009227 1  56 98      138
set 2009173    54 85      101
ago 2009149    43 35      5
jul 2009148    43 35      14
jun 2009146    43 35       
mai 2009146    43 35       
abr 2009146    43 35      12
mar 2009145    43 35      27
fev 2009140    39 33      36
jan 2009127    39 32      280
dez 200853    4 12      12
nov 200851    2 11       
out 200851    2 11       
set 200851    2 11       
ago 200851    2 11       
jul 200851    2 11      7
jun 200845    2 11       
mai 200845    2 11      42
abr 200824    1 5      15
mar 200820    1 5      21
fev 200817    1 2      58


Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons



For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

fev 2008: 1 2 Piter , 2 1 Pätnič

mar 2008: 1 1 Šoutjärv'

abr 2008: 1 1 Šoutjärv'

mai 2008: 1 1 Šoutjärv'

jul 2008: 1 1 Mecoi

dez 2008: 1 1 Vingl

jan 2009: 1 4 Meiden Tat , 2 4 Kos'kenaluižen rajon , 3 3 Kühkjaine , 4 3 Kuruv , 5 3 Kana , 6 3 Jerusalim , 7 3 Jablokpu , 8 3 Hel'sinki , 9 3 Hab , 10 3 Biblii , 11 2 Šušt , 12 2 Šoutjärv' , 13 2 Mecantaga , 14 2 Zaiceva Nina , 15 2 Vologdan agj , 16 2 Vingl , 17 2 Vil'häl , 18 2 Vepsän rahvahaline volost' , 19 2 Vepsän , 20 2 Venäma , 21 2 Vaugedvenäma , 22 2 Uz' Zavet , 23 2 Tihvinan rajon , 24 2 Tervoil , 25 2 Suomen kel'

fev 2009: 1 2 Pälehtpol’ , 2 2 Karjalan Tazovaldkundan gimn , 3 1 Litvanma

mar 2009: 1 2 Zaiceva Nina , 2 1 Šoutjärv'

abr 2009: 1 2 Suomenma , 2 1 Vepsän

jul 2009: 1 1 Zverin lugu

ago 2009: 1 1 Suomenma

set 2009: 1 2 Pälehtpol’ , 2 1 Meiden Tat

out 2009: 1 2 Vepsän rahvahaline volost' , 2 2 Venäma , 3 2 Kuld , 4 1 Šoutjärv'

nov 2009: 1 2 Suomenma , 2 1 Zverin lugu

dez 2009: 1 2 Grekanma , 2 1 Mal't

fev 2010: 1 1 Pälehtpol’

mar 2010: 1 2 Sur' Britanii , 2 2 Pu , 3 2 Ispanii , 4 2 Hristofor Kolumb , 5 2 Saksanma , 6 2 Lönnrot Elias , 7 2 Avstrii , 8 1 Šušt

abr 2010: 1 1 Einštein Al'bert

mai 2010: 1 1 Kaliningradan agj

ago 2010: 1 1 Pol'šanma

nov 2010: 1 3 Kaliningradan agj , 2 2 Mecoi , 3 2 Litvanma , 4 2 Änine , 5 2 Podporožj , 6 2 Kaunas , 7 2 Karjalan keled , 8 2 Karjalan Tazovaldkund , 9 2 Kant Immanuel' , 10 2 Kaliningrad , 11 2 Kalevala , 12 2 Kajag , 13 2 Jurij Gagarin , 14 2 Italii , 15 2 Ispanii , 16 2 Irlandii , 17 2 Hel'sinki , 18 2 Haitmann Fridrih , 19 2 Grekanma , 20 2 Gent , 21 2 Flevoland , 22 2 Eva , 23 2 Estinma , 24 1 Zverin lugu

dez 2010: 1 4 Surikov Vasilii , 2 3 Vologdan agj , 3 3 Vinsent van Gog , 4 3 Tu-154 , 5 2 Čehov Anton , 6 2 Änižröunan rajon , 7 2 Migel' de Servantes Saavedra , 8 2 Mal't , 9 2 Lüksemburg , 10 2 Mocart Vol'fgang Amadeus , 11 2 Zaiceva Nina , 12 2 Gügo Viktor , 13 2 Vaugedvenäma , 14 2 Šeikspir Uil'jam , 15 2 Tervoil , 16 2 Suomalaiž-ugrilaine škol , 17 2 Sodjärv , 18 2 Päiväine , 19 2 Portugalii , 20 2 Podporožj , 21 2 Petroskoi , 22 2 Orav , 23 2 Nemž , 24 2 Leonardo da Vinči , 25 2 Kettunen Lauri

jan 2011: 1 3 Vengrii , 2 3 Ukrain , 3 3 Kazahstan , 4 3 Italijan kel' , 5 2 Ženevan järv , 6 2 Šoutjärv' , 7 2 Čehanma , 8 2 Änižröunan rajon , 9 2 Lüksemburg , 10 2 Vepsän kul'turan muzei , 11 2 Vepsän kel' , 12 2 Venäma , 13 2 Vaugedvenäma , 14 2 Vatikan , 15 2 Suomenma , 16 2 Slovenii , 17 2 Slovakii , 18 2 Serbii , 19 2 San Marino , 20 2 Pälehtpol’ , 21 2 Piter , 22 2 Petroskoi , 23 2 Nevondkundaližiden Socialistižiden Tazovaldkundoiden Ühtištuz , 24 2 Moskv , 25 2 Monak

fev 2011: 1 3 Kazahan kel' , 2 3 Kazahlaižed , 3 3 Händikaz , 4 2 Änižröunan rajon , 5 2 Litvanma , 6 2 Vepsän rahvahaline volost' , 7 2 Totaran kel' , 8 2 Suomenma , 9 2 Ročinma , 10 2 Petroskoi , 11 2 Kaži , 12 2 Kaleig , 13 2 Irlandii , 14 2 Grekanma , 15 2 Saksanma , 16 2 Estin kel' , 17 2 Daugavpils , 18 1 Šveicarii

mar 2011: 1 3 Venäma , 2 3 Moskv , 3 3 Kaunas , 4 2 Šokš , 5 2 Medvedev Dmitrii , 6 2 Rim , 7 2 Repin Il'ja , 8 2 Pälehtpol’ , 9 2 Putin Vladimir , 10 2 Piter , 11 2 Peitsemnižed , 12 2 Abramov Nikolai , 13 2 Kuz' , 14 2 Kuld , 15 2 Kolumb Hristofor , 16 2 Kazmused , 17 2 Karjalan Tazovaldkundan gimn , 18 2 Karjalan Tazovaldkund , 19 2 Kant Immanuel' , 20 2 Kaliningrad , 21 2 Jel'cin Boris , 22 2 Immanuel Kant , 23 2 Haitmann Fridrih , 24 2 Germanijan kel' , 25 2 Gagarin Jurii

abr 2011: 1 2 Venäma , 2 2 Kazahstan , 3 2 Bel'gii , 4 1 Šveicarii

mai 2011: 1 3 Süvär' , 2 2 Päiväine , 3 2 Pifagoran teorem , 4 2 Kolumb Hristofor , 5 2 Karjalan Tazovaldkundan Rahvahaline teatr , 6 1 Marok

jun 2011: 1 2 Karjalan Tazovaldkund , 2 2 Danii , 3 2 Bolgarii , 4 2 Alma-At , 5 1 Čehanma

jul 2011: 1 1 Ženevan järv

ago 2011: 1 3 Vezi , 2 3 Süvär' , 3 2 Šrenkan kuz' , 4 2 Venäma , 5 2 Vauged kuz' , 6 2 Tän'-šanine kuz' , 7 2 Turkmenistan , 8 2 Taškent , 9 2 Serbine kuz' , 10 2 Saratov , 11 2 Pifagoran teorem , 12 2 Peitsemnižed

set 2011: 1 5 Lezgin kel' , 2 3 Dagestan , 3 2 Ženevan järv , 4 2 Volgograd , 5 2 Samara , 6 2 Orenburg , 7 2 Omsk , 8 2 Kurgan , 9 2 Kaliningradan agj , 10 1 Zverin lugu

out 2011: 1 2 Vil'nüs , 2 2 Pälehtpol’ , 3 2 Lakan kel' , 4 2 Korsik , 5 1 Šušt

nov 2011: 1 3 Tähtaz , 2 3 Tu-154 , 3 3 Pälehtpol’ , 4 2 Vinsent van Gog , 5 2 Vikipedii , 6 2 Vikimedii , 7 2 Vezi , 8 2 Rim , 9 2 Pol'šanma , 10 2 Pifagoran teorem , 11 2 Petroskoi , 12 2 Pariž , 13 2 Paltog , 14 2 Moskv , 15 2 Kuruv , 16 2 Karjalan Tazovaldkund , 17 1 Šoutarv

dez 2011: 1 5 Vaugedpert' (Vašington) , 2 4 Amerikan Ühtenzoittud Valdkundad , 3 3 Mel'burn , 4 3 Lüblän , 5 3 Pälehtpol’ , 6 3 Pil'ved , 7 3 Oper , 8 3 Natrii , 9 3 Kundlimed , 10 3 Konstebl Džon , 11 3 Džasper (lidn, Minnesot) , 12 3 Bratislav , 13 3 Ankar , 14 2 Šur , 15 2 Šrödinger Ervin , 16 2 Šanhai , 17 2 Čuvašan kel' , 18 2 Čai , 19 2 Mafii , 20 2 MP3-plejer , 21 2 Lüblin , 22 2 Avrora (kreiser) , 23 2 Zagreb , 24 2 Vintaž , 25 2 Vepsän kel'

jan 2012: 1 4 Venäman Tazovaldkundad , 2 4 Opera , 3 4 Internet Explorer , 4 3 Čerkessk , 5 3 Čeboksarad , 6 3 Petr I Sur' , 7 3 Mozilla Firefox , 8 3 Groznii , 9 3 Google Chrome , 10 2 Čeläbinsk , 11 2 Microsoft Windows , 12 2 Microsoft Office Word , 13 2 Microsoft Office Excel , 14 2 Vašington (lidn) , 15 2 Uraližed keled , 16 2 Skopje , 17 1 Vepsän kelen aigad

fev 2012: 1 14 Pälehtpol’ , 2 5 Sarapul , 3 5 Dagestanan Tazovaldkund , 4 4 Zaiceva Nina , 5 4 Venäma , 6 4 Särg , 7 4 Petr I Sur' , 8 4 San Francisko , 9 4 Podporožj , 10 4 Petroskoi , 11 4 Orav , 12 4 Korol' i Šut , 13 4 Kijev , 14 4 Baškiran kel' , 15 4 Azerbaidžan , 16 3 Vepsän kelen aigad , 17 3 Bolgarijan kel' , 18 3 Antofagast , 19 3 Val'paraiso , 20 3 Santjago , 21 3 Konseps'jon , 22 3 Mrongovo , 23 3 , 24 3 Lacuna Coil , 25 3 Šveicarii

mar 2012: 1 4 Soči , 2 4 Pälehtpol’ , 3 3 Buranovon Baboid , 4 3 Narv (lidn) , 5 3 Tartu , 6 3 Linkin Park , 7 3 Čehanma , 8 2 Bardan rajon , 9 2 Šeki , 10 2 Nahičevan , 11 2 Gändž , 12 2 Gai (lidn) , 13 2 Orenburgan agj , 14 2 Moščen , 15 2 Kautokeino , 16 2 Ostrav , 17 2 Himižiden elementoiden periodine tablut , 18 2 Udmurtan kelen kändod , 19 2 Rio-de-Žaneiro , 20 2 San Paulu , 21 1 Orsk

abr 2012: 1 4 Pälehtpol’ , 2 3 Vepsän nimed , 3 3 Pol'šanman administrativiž-territorialine jagand , 4 2 666 (lugu) , 5 2 Vepsän Vikipedii , 6 2 IPod , 7 2 Vodin kel' , 8 2 Lantanoidad , 9 2 Korrea Rafael' , 10 2 Ščecin , 11 2 Abdulino , 12 2 Himižiden elementoiden periodine tablut , 13 2 Melent'jeva Marija , 14 2 Zaiceva Marja , 15 2 Lämoi , 16 2 Votkinsk , 17 2 Vobl , 18 2 Jašov Viktor , 19 2 Vepsän kel' , 20 2 Šeikspir Uil'jam , 21 2 Udmurtan kel' , 22 2 Portlend (Oregon) , 23 2 Kühkjaine , 24 2 Kur'ged , 25 2 Kalitkad

mai 2012: 1 7 Pälehtpol’ , 2 6 Party for Everybody , 3 5 Piter , 4 4 Piterin metropoliten , 5 4 Vepsän Vikii , 6 4 Buranovon Baboid , 7 3 MySpace , 8 3 Euphoria , 9 3 Lorin , 10 3 Should've Known Better , 11 3 Evrovizii-2012 , 12 3 Venäman millionerlidnad , 13 3 Ogeruz i aznoičend , 14 3 Teräsbetoni , 15 3 Rabat , 16 3 Glittertind , 17 3 Viski , 18 3 Unheilig , 19 3 Üebermutter , 20 3 Rammstein , 21 3 Tatarstanan Tazovaldkund , 22 3 Udmurtijan Tazovaldkund , 23 3 12 (lugu) , 24 3 11 (lugu) , 25 3 10 (lugu)

jun 2012: 1 6 Lavin Avril , 2 5 Evropan futbolan čempionat 2012 , 3 5 Vikipedii , 4 4 Lorin , 5 4 Pälehtpol’ , 6 3 Bahreinan valdkundznam , 7 3 .bs , 8 3 Bagaman Sared , 9 3 Kubanin kozakišton hor , 10 3 Vepsän flag , 11 3 Norvegijan konstitucijan päiv , 12 3 Antiguan da Barbudan flag , 13 3 Belogorsk (Amuran agj) , 14 3 Blagodarnii , 15 3 Krasnodaran rand , 16 3 Jousne , 17 3 Joudjuden statui , 18 3 .us , 19 3 .dz , 20 3 FK Zenit Piter , 21 3 .al , 22 3 .nl , 23 3 Alamaiden valdkundznam , 24 3 Afganistanan valdkundznam , 25 3 .af

jul 2012: 1 4 Pohjoižsaamen Vikipedii , 2 4 Öbok , 3 3 Udmurtan Vikipedii , 4 3 Slovenijan kel' , 5 3 Evropan futbolan čempionat 2012 , 6 3 Turkanma , 7 3 Mozilla Firefox , 8 2 Centillion , 9 2 Grekan kirjamišt , 10 2 Taimir (lehtez) , 11 2 7-Zip , 12 2 Puht , 13 2 Šujan stancii , 14 2 Meliorativnii , 15 2 Bernar Sara , 16 2 Ehtbok , 17 2 Longibok , 18 2 Homendezbok , 19 2 Päivlaskm , 20 2 Päivnouzm , 21 2 Pohjoine , 22 2 Suvi , 23 2 Salavat Kupere , 24 2 Dakk , 25 2 Bangladeš

ago 2012: 1 4 Vilämovicen kel' , 2 4 Vn 2012 Kezaolimpiadan lopmižed , 3 2 Komin Vikipedii , 4 2 Ternopol' , 5 2 Fareran kel' , 6 2 Vagur , 7 2 Alitus , 8 2 Priozerskan rajon , 9 2 Priozersk , 10 2 Bugri (Vsevoložskan rajon) , 11 2 Vepsän ülüz , 12 2 Venäman flag , 13 2 Valaam , 14 2 .et , 15 2 Virrat , 16 2 Ferland Džodel' , 17 2 Hibbert Eleonor , 18 2 Nuori Karjala , 19 2 Breivik Anders Bering , 20 2 Regalado Tomas , 21 2 Windir , 22 2 Tanzwut , 23 2 Majami , 24 2 AÜV:oiden flag , 25 2 Anus (lidn)

set 2012: 1 4 Evrejan kel' , 2 4 Pälehtpol’ , 3 4 Google Chrome , 4 3 Virun kel' , 5 3 Vikingad , 6 3 Ristitun hibj , 7 3 A , 8 3 Ganter Henri , 9 3 Pussy Riot , 10 3 Ezmäine mail'man voin , 11 3 A7V , 12 3 Spalletti Lučano , 13 3 Fobijoiden nimikirjutez , 14 3 , 15 3 Modern Talking , 16 3 Polandball , 17 3 Grekan kirjamišt , 18 3 FK Zenit Piter , 19 3 Venälaižed , 20 3 Artut' , 21 3 Gändž , 22 3 Ostrav , 23 3 Brno , 24 3 Venän kel' , 25 3 Prag

out 2012: 1 4 Singapur , 2 4 Vologdan agj , 3 4 Rig , 4 3 Norvegijan Vikipedii , 5 3 Pohjoižen saldat (fil'm) , 6 3 Sar' (fil'm, Venäma, 2006) , 7 3 Dnestranrand , 8 3 Ahvenanma , 9 3 Grekanman Makedonii , 10 3 Šokolad , 11 3 Dom-2 , 12 3 Taivan' (sar') , 13 3 Pirahan (kel') , 14 3 Ternopol' , 15 3 Marti Petit Antoni , 16 3 Litvanma , 17 3 Vil'nüs , 18 3 Varšav , 19 3 Portlend (Oregon) , 20 3 Latvii , 21 3 Grekanma , 22 3 Evropan valdkundad , 23 3 Budapešt , 24 3 Berlin , 25 3 Albanii

nov 2012: 1 4 Vepsän rahvahan hor , 2 3 Lodehline aviabaz , 3 3 Kurgiden aig , 4 3 Kalarand , 5 3 «Ö»-kirjamen muštpacaz , 6 3 Mi? Kus? Konz? , 7 3 Tedr , 8 2 Pirgaine , 9 2 Randaine , 10 2 Duty free , 11 2 Jablonovskii-sild (Piter) , 12 2 Jablonovskii-sild (Krasnodar) , 13 2 Kegonpaniilind , 14 2 Pähkim , 15 2 Merikukoi , 16 2 Nug , 17 2 Habobatk , 18 2 In a Reverie , 19 2 Kodipühüt , 20 2 Kodipulo , 21 2 Jälinduine , 22 2 Kärg , 23 2 Näk , 24 2 Zor'alinduine , 25 2 Küuki

dez 2012: 1 3 Livin Vikipedii , 2 3 Gamburger , 3 3 Hot-dog , 4 3 Venäma Evrovizijal , 5 3 MySpace , 6 3 Naberežnije Čelni , 7 2 Ronson Šarlotta , 8 2 Mir (orbitine stancii) , 9 2 Bleeding Souls , 10 2 Ethereal (demo) , 11 2 Plazm , 12 2 Sleep of Right , 13 2 Lumenšur , 14 2 Hobednitid , 15 2 Kuziine om sündnu mecha , 16 2 Maseru , 17 2 Kindhad , 18 2 Truganini , 19 2 Happy Tree Friends , 20 2 Letsie III , 21 2 Suomalaine veič , 22 2 Tüp , 23 2 Nin' , 24 2 Britanijan Kuldrand , 25 2 Renault Logan

jan 2013: 1 3 Vederistmad , 2 3 Grand Theft Auto: San Andreas , 3 3 Vologdan agj , 4 2 Evenalaižed , 5 2 Evenkalaižed , 6 2 Udinalaižed , 7 2 Lumiuk , 8 2 Darginalaižed , 9 2 De Agostini , 10 2 I'm Not Afraid , 11 2 Bela Lugosi's Dead , 12 2 Wide Awake (Lacuna Coil:an pajo) , 13 2 I Won't Tell You , 14 2 Ragozina Natal'ja , 15 2 Enjoy the Silence , 16 2 Swamped , 17 2 Vepsän mifologii , 18 1 Leonardo Forti

fev 2013: 1 3 Jožin z bažin , 2 3 Pori , 3 3 Lihtenštein , 4 2 Nor'mik , 5 2 Norhein , 6 2 Habinod , 7 2 Bard (hibused) , 8 2 Real,- , 9 2 Raum , 10 2 Etimologii , 11 2 Kolan norvegijalaižed , 12 2 Lukumades , 13 2 Gitar , 14 2 Tofalaralaižed , 15 2 Doncova Dar'ja , 16 2 Lužkovan stil' , 17 2 Eht , 18 2 Orokalaižed , 19 2 Ö (aig) , 20 2 Ul'čilaižed , 21 2 Laškuzlidn , 22 2 Jugalaižed , 23 1 MOS Technology 6502

mar 2013: 1 4 Venälaine literatur , 2 4 Kitai , 3 3 Merežkovskii Dmitrii , 4 3 Bad Boys Blue , 5 3 Heitämine (serial) , 6 2 Leningradalaine zoopuišt , 7 2 Obuhovan Kaičendan prospekt , 8 2 Hamid Abdul , 9 2 Klüjev Nikolai , 10 2 Antresol' , 11 2 Lindemann Till' , 12 2 C.E.B. Reas , 13 2 Zencov Roman , 14 2 C. C. Catch , 15 2 Ph. Patrikan päiv , 16 2 Buraka Som Sistema , 17 2 Vasil'jev Boris , 18 2 Kaks'nik (starin) , 19 2 Ižand Proharčin , 20 2 Vändai (roman) , 21 2 Voin i kožmuz , 22 2 Domostroi , 23 2 Adams Duglas , 24 2 Rahvahankeskeine naižiden päiv , 25 2 Dahno Vladimir

abr 2013: 1 3 Kel'tižed keled , 2 3 Kečuan kel' , 3 3 Šotlandijan kel' (kel'tine) , 4 2 Dirbal , 5 2 Puhtaz, ajatud , 6 2 Sekret Uspeha , 7 2 Birbincpühäpäiv , 8 2 Šizofrenii , 9 2 Depressii , 10 2 Sanskrit , 11 2 Ficdžeral'd Ella , 12 2 Nganasanan kel' , 13 2 Subway Surfers , 14 2 Cut the Rope , 15 2 Čukačun kel' , 16 2 Hüväd öd, čočod! , 17 2 Welcome to the Heartbreak Hotel , 18 2 Kirj , 19 2 Surman kel'dand , 20 2 Haki (kel'kanz) , 21 2 Guaranin kel' , 22 2 Eiler Leonard , 23 2 Tuskaroran kel' , 24 2 I Can Lose My Heart Tonight , 25 2 Kombinacija

mai 2013: 1 3 Evrovizii-1956 , 2 3 Odess , 3 3 You're My Heart, You're My Soul , 4 3 Vepsän kel' , 5 3 Pil'ved , 6 2 Likutimveneh , 7 2 Kater , 8 2 Veneh , 9 2 You Shot a Hole In My Soul , 10 2 Hear What I Say , 11 2 Čistalöv Veniamin , 12 2 Azartvänd , 13 2 Diamonds , 14 2 Jankulov Stojan , 15 2 Sport , 16 2 Jumal , 17 2 Džakart , 18 2 I'm No Rockefeller , 19 2 One In a Million , 20 2 Good Guys Only Win in Movies , 21 2 Tilli Džennifer , 22 2 Kannad , 23 2 Vägestusen päiv , 24 2 Vepsän grammatik , 25 2 Kulič

jun 2013: 1 4 Moskv-Siti , 2 3 Kahtišti koumekümne koume , 3 3 Juhannus , 4 3 Mahfuz Nagib , 5 3 Psalmoiden kirj , 6 3 Lönnrot Elias , 7 3 Biblii , 8 2 Baltika (oludenkeituden kompanii) , 9 2 Hala , 10 2 Kall' (külä) , 11 2 Kobencl' Lüdvig fon , 12 2 Mišel' (pajatai) , 13 2 Petti Rajan , 14 2 Tullei , 15 2 Valendas , 16 2 Fasmer Maks , 17 2 Gar d'Aržikur P'jerrpon , 18 2 Optimal , 19 2 Virtanen Veikko , 20 2 Komiks , 21 2 Semönov Pötr , 22 2 Mompha edax , 23 2 Iče minä , 24 2 Marginal , 25 2 Eristalis intricarius

jul 2013: 1 3 Vepsän küläd , 2 3 Rand (külä, Vepsän rahvahaline küläkund) , 3 3 Reprua , 4 3 Latinan frazoiden nimikirjutez , 5 2 C. C. Catch:an pajod , 6 2 Keimada Grandi , 7 2 Sur' Sünd! Abuta minei jäda henghe kesked necidä surmarmastust , 8 2 Zanin Artöm , 9 2 Synodontis pardalis , 10 2 Ptychogena antarctica , 11 2 Dendrilla elegans , 12 2 Heteropoda shillongensis , 13 2 Slavine neopaganuz , 14 2 Tur de Frans , 15 2 I Will Survive , 16 2 Aksintant , 17 2 Süvärensu , 18 2 Gaudi Antonio , 19 2 Znamasižiden evrodiskoedestajiden nimikirjutez , 20 1 You Suffer

ago 2013: 1 2 Puerto Iguasu , 2 2 Ročilaine laud , 3 2 Ištui Härg , 4 2 Venä , 5 2 Kahesan nellikon identižuz , 6 2 Ruskedvauvaz vin , 7 2 Mail'manpän Sar' (ATOW1996) , 8 2 Niinistö Sauli , 9 2 Jufit Jevgenii , 10 2 Francijalaižiden fil'miden festival' Malagas , 11 2 Oksitanan kel' , 12 1 Änižen kanal

set 2013: 1 2 Inkeriläižed , 2 2 Karr Sara Rouz , 3 2 Žirinovskii Vladimir , 4 2 Palatoi lugu , 5 2 Mec , 6 2 Secret Star , 7 2 I Can Lose My Heart Tonight '99 , 8 2 Kitai , 9 2 Haapsalu , 10 2 You're My Heart, You're My Soul , 11 2 Vepsän ülüz , 12 2 Saha Tazovaldkund , 13 2 Afganistan , 14 2 Možg , 15 2 Vepsän Vikipedii , 16 1 Koreb Elidaspäi

out 2013: 1 2 Frigga pratensis , 2 2 Belisana strinatii , 3 2 Kelenmagii , 4 2 Nagriž , 5 2 Päč , 6 2 WASP-64 , 7 1 Boa

nov 2013: 1 3 Boršod Abaui Zemplen , 2 3 Eger (lidn) , 3 3 Heveš (agj) , 4 3 Mad'jaranman lidnad , 5 3 Japonii , 6 3 Muil , 7 3 Queen , 8 2 Jas Nad'kun Sol'nok , 9 2 Kapošvar , 10 2 D'jor , 11 2 Kečkemet , 12 2 Miškol'c , 13 2 Debrecen , 14 2 Bač Kiškun , 15 2 Pešt (agj) , 16 2 Sabol'č Satmar Bereg , 17 2 .hu , 18 2 31 (lugu) , 19 2 Tok-pisin

dez 2013: 1 4 Lindberg Čed , 2 4 Töröčik Mari , 3 3 Garipova Dina , 4 3 Blek Lukas , 5 3 Emi S'juzi , 6 3 Disnei Uolt , 7 3 Buše Viktor , 8 3 Uusberg Pärt , 9 3 Keil (lidn) , 10 3 Vas (lidn) , 11 3 Laht (lidn) , 12 3 Mad'jaranman agjad , 13 3 Peč , 14 3 Ferland Džodel' , 15 2 Itson Meri Ellen , 16 2 Volčkov Sergei Valer'jevič , 17 2 Golos , 18 2 Holodnaja Vera , 19 2 Kalašnikov Mihail , 20 2 Džerri (fil'm) , 21 2 Pekuin Anna , 22 2 Roman Pol , 23 2 Jakobi Doreen , 24 2 De Montema Damian , 25 2 Vepsläižen kodin südäin

jan 2014: 1 3 Moskv-Siti , 2 2 Karlton Lending , 3 2 Zell' , 4 2 Uorhol Endi , 5 2 Silence , 6 2 Unborn Love , 7 2 Rait Frenk Lloid , 8 2 Le Korbüz'je , 9 2 Dürer Al'breht , 10 2 Dvoržak Antonin , 11 2 Goja Fransisko , 12 2 Rubens Piter , 13 2 Umbrine škol , 14 2 Rafael' Santi , 15 2 Tverin agj , 16 2 Lendai alamalaine , 17 2 Anomalii , 18 2 Mägi , 19 2 Kalo Frida , 20 2 Protistad , 21 2 Muiktuz , 22 2 Himine ühtnend , 23 2 Biohimii , 24 2 Himii , 25 2 Need for Speed: Pigusen himo

fev 2014: 1 2 Armastusen tippud , 2 2 Heimolaižuz , 3 2 Mumbai , 4 2 Indijan štatad da territorijad , 5 2 Nothing Stands In Our Way , 6 2 Hameleonad (serial) , 7 2 Lapsed (serial, Brazilii, 2013) , 8 2 Brazilii-kolledž , 9 2 Satatadud südäikerad , 10 2 Japonine kanang , 11 2 Karusel' (serial, Brazilii, 2012) , 12 2 Vn 2014 Tal'volimpiadan lopmižed , 13 2 Laos , 14 2 Kudentoštkümnen nellikon identižuz

mar 2014: 1 2 Kall'oikahad mäged , 2 2 Bangalor , 3 2 Krim (Ukrainan region) , 4 2 Korejan Tazovaldkund , 5 2 Čennai , 6 2 So , 7 2 Maim , 8 2 Need for Speed: Pigusen himo , 9 2 Vepsän küläd , 10 2 Bass Sol , 11 2 Venesuel , 12 2 Uz' Zelandii , 13 2 Avstralii (valdkund) , 14 2 Arhangel'sk , 15 2 Nikaragua (valdkund) , 16 2 Igark , 17 2 Suviamerik , 18 1 Česmen jumalanpert'

abr 2014: 1 3 Urugvai , 2 3 The Doors , 3 3 Voihein , 4 2 Sevastopol' , 5 2 Feodosii , 6 2 Nellikod (kartankarv) , 7 2 Džomolungm , 8 2 Venäman federaližed ümbrikod , 9 2 Suviafrikan Tazovaldkund , 10 2 Kilimandžaro , 11 2 Sabett , 12 2 Nencan kel' , 13 2 Jumalanbembel' , 14 2 Vederistmad , 15 2 Grand Theft Auto: San Andreas , 16 2 Buenos Aires , 17 2 Hristanuskond , 18 1 Koktebel'

mai 2014: 1 3 Luganskan Rahvahaline Tazovaldkund , 2 3 Ukrain , 3 2 Suomen Vikipedii , 4 2 Jun Hen Sik , 5 2 Seong Dže-gi , 6 2 Marijampole , 7 2 Varghuz (lidn) , 8 2 Lund , 9 2 Viborg (Danii) , 10 2 Krim (Ukrainan region) , 11 2 Eupithecia turpis , 12 2 Takkiž , 13 2 Kislovodsk , 14 2 Mail'man valdkundad , 15 2 Rostov Donal , 16 2 Tallidn , 17 2 Suomenma , 18 1 Deborra-Li Förness

jun 2014: 1 2 Katar , 2 2 Malaizii , 3 2 Mongolii , 4 2 Tailand , 5 2 Tadžikistan , 6 2 Kano , 7 2 Tokio , 8 2 Tün' valdmeri , 9 2 Sevastopol' , 10 2 Džeronimo , 11 2 Öhabuk , 12 2 Ortodoksine hristanuskond , 13 2 Atlantine valdmeri , 14 1 In Čžen

jul 2014: 1 2 Egipt , 2 2 Sudan , 3 2 33 (lugu) , 4 2 Uusberg Pärt , 5 2 Novodvorskaja Valerija , 6 1 Ceilon

ago 2014: 1 4 Marilaine veroline religii , 2 3 Saba Isak , 3 3 Master i Margarita , 4 3 Kodima , 5 2 Kostarik , 6 2 Sur' Munamägi , 7 2 Vil'jandi , 8 2 Sudan , 9 2 Moskvan prospekt (Piter) , 10 2 Dakk , 11 2 Nikaragua (znamoičendad) , 12 2 Viluku , 13 1 Madagaskar (valdkund)

set 2014: 1 3 Paragvai , 2 3 Ugand , 3 3 Canada , 4 3 Coca-Cola , 5 2 Järgeline pölvaz , 6 2 Kekkonen Urho , 7 2 Koivisto Mauno , 8 2 Hel'singfors , 9 2 Senegal , 10 2 Kamerun , 11 2 Bolivii , 12 2 Nauru , 13 2 Ternopol' , 14 1 Paragvain Tazovaldkund

out 2014: 1 2 Bol , 2 2 Abai (znamoičendad) , 3 2 Abai , 4 2 Al'tamir (mägionduz) , 5 2 Indonezii , 6 2 Antigua da Barbud , 7 2 Pol'šanma , 8 1 Abazilaižed

nov 2014: 1 2 Kanoe Pessespäi , 2 2 Baženov Timofei , 3 2 Baženovan reiting , 4 2 Strub , 5 2 Lobez (lidn) , 6 2 Pöud (maižanduz) , 7 2 Pöud , 8 2 Marilaižiden tradicionaline uskond , 9 2 Tadžikistan , 10 1 Karbaz

dez 2014: 1 3 Lobez (lidn) , 2 2 Igor' Strelkov , 3 2 Gladius , 4 2 Pavlodar , 5 1 Vologdan pörutügitegim

jan 2015: 1 3 Reigan Ronal'd , 2 3 NGC 217 , 3 3 NGC 239 , 4 3 NGC 244 , 5 2 Sal'vador , 6 2 Germanii (znamoičendad) , 7 2 NGC 171 , 8 1 Suksed

fev 2015: 1 3 Modaižed sobad , 2 2 Gvinei Bisau , 3 2 Afrikan valdkundad , 4 2 Pakistan , 5 2 Heitämine (serial) , 6 2 Säs' , 7 2 Ukrain , 8 1 Grekanman Tazovaldkund

mar 2015: 1 3 Urugvai , 2 3 Sithine kuz' , 3 2 Hanko , 4 2 Uusikaupunki , 5 1 Hangö

abr 2015: 1 4 Amerikan Ühtenzoittud Valdkundad , 2 3 Lepai , 3 3 Damask , 4 3 Odess , 5 3 Vagolind , 6 3 Gorodovikovsk , 7 3 Lipeck , 8 3 Venäma , 9 3 Händikaz , 10 2 Sestrikaine , 11 2 Douson Doris , 12 2 Bridgetown , 13 2 Bridžtaun (lidn, Barbados) , 14 2 Thimphu , 15 2 Lohi , 16 2 Butan , 17 2 Naip'jido , 18 2 Pasklindud , 19 2 Džordžtaun , 20 2 Bogota , 21 2 Džordžtaun (Gajan) , 22 2 Ottav , 23 2 Dušanbe , 24 2 Ulanbatar , 25 2 Katmandu

mai 2015: 1 3 Baotou , 2 3 Valans'jen , 3 3 Klivlend , 4 3 Enn Arbor (Mičigan) , 5 3 Läojuan' , 6 3 Nagoi , 7 3 Brazzavil' , 8 3 Dakar , 9 3 Painmižpästandoiden nimikirjutez materialoidenke vepsän kelel , 10 3 Los Andželes , 11 3 Gajan , 12 3 Neue Deutsche Härte , 13 3 Kizlär , 14 3 Izberbaš , 15 3 Varšav , 16 2 Tuluz , 17 2 Fort Loderdeil , 18 2 Čikago , 19 2 Milan , 20 2 Florencii , 21 2 Šäuläi , 22 2 Panevežis , 23 2 Elgav , 24 2 Sillamäe , 25 2 Kohtla-Järve

jun 2015: 1 3 Lobez (lidn) , 2 3 Trpin' , 3 3 Zelöna Gur , 4 2 Lüneburg , 5 2 Fell'bah , 6 2 Džidd , 7 2 Štutgart , 8 2 Sanderlend , 9 2 Sanderlend (Anglii) , 10 2 Grenobl' , 11 2 Ekseter , 12 2 Hanau , 13 2 Kassel' , 14 2 Beliz (lidn) , 15 2 Remedios (Kuba) , 16 2 Sidzuok , 17 2 Piterboro (Ontario) , 18 2 Vik (Saksanma) , 19 2 Jan'tai , 20 2 Batum , 21 2 Cincinnati , 22 2 Parm , 23 2 Sekuen' , 24 2 Subotic , 25 2 Toledo (Ogajo)

jul 2015: 1 3 Ngerulmud , 2 3 Tbilis , 3 3 Danii , 4 2 Saratamat , 5 2 Lakatoro , 6 2 Isangel , 7 2 Luganvill , 8 2 Sol (Vanuatu) , 9 2 Sjudad de la Kost , 10 2 Alei , 11 2 Sidon , 12 2 Zahle , 13 2 Tripoli (Livan) , 14 2 Galle , 15 2 Margilan , 16 2 Kokand , 17 2 Fergan , 18 2 Namangan , 19 2 El' Ain , 20 2 Kordov , 21 2 Rosario , 22 2 Mary , 23 2 Jangon , 24 2 Haidarabad , 25 2 Ahmedabad

ago 2015: 1 3 Federativižed Mikronezijan Valdkundad , 2 3 Al'met'jevsk , 3 3 Soči , 4 2 Hag , 5 2 Gorna Orähovic , 6 2 Sent Pol Kapister , 7 2 Kuritib , 8 2 Nasinu , 9 2 Koimbr , 10 2 Kuala Lumpur , 11 2 Regimägi , 12 2 Split , 13 2 Madagaskar , 14 2 Šrilank , 15 2 Nigerii , 16 2 Indii , 17 2 Sahar (produkt) , 18 2 Vitegr , 19 2 Ustüžn , 20 2 Sur' Ustüg , 21 2 Kirillov , 22 2 Belozersk , 23 2 Babajevo , 24 2 Vologdan agjan lidnad , 25 2 Surovikino (lidn)

set 2015: 1 3 Coca-Cola , 2 2 Fareran Sared , 3 2 Dubovk , 4 2 Gorohovec , 5 2 Kiržač , 6 2 Kameškovo , 7 2 Jur'jev Pol'skii , 8 2 Aleksandrov , 9 2 Fokino (Bränskan agj) , 10 2 Birüč , 11 2 Aleksejevk , 12 2 Narimanov , 13 2 Harabali , 14 2 Znamensk (Astrahanin agj) , 15 2 Ahtubinsk , 16 2 Belogorsk (Amuran agj) , 17 2 Bikin , 18 2 Amursk , 19 2 Budönnovsk , 20 2 Blagodarnii , 21 2 Sur' Kivi , 22 2 Spassk Dal'nii , 23 2 Nahotk , 24 2 Lesozavodsk , 25 2 Fokino (Merenrandaline rand)

out 2015: 1 3 Murasaki Sikibu , 2 3 Togo , 3 3 Kanad , 4 2 Rankagua , 5 2 Pnompen' , 6 2 Karakas , 7 2 Nepal , 8 2 Gvatemal , 9 2 Avstralii , 10 2 Peru , 11 2 Korejan Tazovaldkund , 12 2 Debrecen , 13 2 Kos'kenaluine , 14 2 Džamunan sild , 15 2 Bangladeš , 16 2 Facebook , 17 1 Feisbuk

nov 2015: 1 4 Kito , 2 4 Gvinei-Bisau , 3 2 Rävan (futbolklub) , 4 2 Käpaz (futbolklub) , 5 2 Sumgait (futbolklub) , 6 2 Zirä (futbolklub) , 7 2 Samarkand , 8 2 Nepal , 9 2 Ekvador , 10 2 Uoker Pol , 11 1 Jokoham

dez 2015: 1 3 Lugansk , 2 3 Doneck , 3 3 Kirjišt , 4 3 Lavrov Sergei , 5 3 Golos , 6 3 Makri Maurisio , 7 3 Ukrain , 8 3 Moskv , 9 2 Armastuz , 10 2 Poklonskaja Natal'ja , 11 2 Gerakl , 12 2 Apollon , 13 2 Itigran , 14 2 Gera , 15 2 Pharaoh , 16 2 Šoigu Sergei , 17 2 Gribojedovan kanal , 18 2 Satanovskii Jevgenii , 19 2 Barle , 20 2 Magadanan agj , 21 2 Mad'jaran kel' , 22 2 Lobez (lidn) , 23 2 Luganskan Rahvahaline Tazovaldkund , 24 2 Doneckan Rahvahaline Tazovaldkund , 25 2 Malindpeza (zamk)

jan 2016: 1 2 Ukrainan Rahvahaline Ühtištuz , 2 2 Suomen Vikipedii , 3 2 Gal'špah , 4 2 Ižoran Vikipedii , 5 2 Lumenšur , 6 2 Livin Vikipedii , 7 2 Komin Vikipedii , 8 2 Udmurtan Vikipedii , 9 2 Venäkel'ne Vikipedii , 10 2 Kivi Obil , 11 2 Paksjogi , 12 2 Vepsän Vikipedii , 13 2 Kol , 14 2 Varšav , 15 2 Putin Vladimir , 16 1 Ciolkovskii (lidn)

fev 2016: 1 3 Bahmut , 2 2 Artömovsk (Doneckan agj) , 3 2 Ivanovon agj , 4 2 Muiktuz , 5 2 Himine ühtnend , 6 2 Mir , 7 2 Venälaižen valdkundan pämehed , 8 2 Päiväižen sistem , 9 2 Krasnoje Selo , 10 1 Aldan

mar 2016: 1 3 Kračkovskaja Natal'ja , 2 2 Ukrainan Rahvahaline Ühtištuz , 3 2 Astrahanin agj , 4 2 Užgorod , 5 2 Kremenčuk , 6 2 Lunkin Vitalii , 7 2 Venälaižen keitandan sömižiden nimikirjutez , 8 2 Kudrovo (Leningradan agj) , 9 2 Demidovan sild , 10 2 Trpin' , 11 2 Uz' Okkervil' , 12 2 Venäma Evrovizijal , 13 2 Zanevk , 14 2 Alauz'lidn , 15 2 Kallio Küösti , 16 2 Štol'berg Kaarlo Juho , 17 2 Latvii , 18 1 606 (kodiden serii)

abr 2016: 1 2 Nühaidai , 2 2 , 3 2 8. reduku , 4 2 Krestovskii-stadion , 5 1 Futboline stadion Krestovskii-saren päivlaskmpol'žes palas

mai 2016: 1 4 Dnepropetrovsk , 2 3 Varn (lidn) , 3 3 Bugul'm , 4 3 Murmansk , 5 3 Čeboksarad , 6 3 Ulan Ude , 7 3 Moskv , 8 3 Joškar-Ol , 9 3 Elist , 10 2 Čilin valdkundznam , 11 2 Čilin flag , 12 2 Bilibino , 13 2 Elefantanvuiččed , 14 2 Pavlov Igor' , 15 2 Kaimol , 16 2 Vepsän mec , 17 2 Šugar'v , 18 2 Kamizäk , 19 2 Jeisk , 20 2 Anadir' , 21 2 Jaroslavl' , 22 2 Tümen' , 23 2 Tul , 24 2 Tomsk , 25 2 Rostov Donal

jun 2016: 1 3 Dnepropetrovsk , 2 3 Radajad lähttas \"Lümjer\"-fabrikaspäi , 3 3 Vologd , 4 3 Ukrain , 5 3 Kijev , 6 2 Gagarin (Smolenskan agj) , 7 2 Isil'kul' , 8 2 Tükalinsk , 9 2 Oblučje , 10 2 Pevek , 11 2 Dimitrovgrad (Venäma) , 12 2 Bariš (lidn) , 13 2 Berözovskii (Sverdlovskan agj) , 14 2 Artömovskii , 15 2 Asbest (lidn) , 16 2 Alapajevsk , 17 2 Aramil' , 18 2 Simferopol' , 19 2 De Agostini , 20 2 Lisičansk , 21 2 Lermontov (lidn) , 22 2 Kizlär , 23 2 Tomsk , 24 2 Kirov , 25 2 Kemerovo

jul 2016: 1 4 Aleksandr Maršal , 2 3 Ani Lorak , 3 3 Jegor Krid , 4 3 Nüša , 5 3 1984 , 6 3 Preslava , 7 3 Kirkorov Filipp , 8 3 Leont'jev Valerii , 9 2 Meladze Valerii , 10 2 Timur Rodrigez , 11 2 Dobrič , 12 2 1949 , 13 2 1967 , 14 2 1956 , 15 2 Noskov Nikolai , 16 2 Gagarin (Smolenskan agj) , 17 2 Bilibino , 18 2 Zaharova Marija , 19 2 Elgav , 20 2 Jurmal , 21 2 Alušt , 22 2 Venälaižen keitandan sömižiden nimikirjutez , 23 2 Loks , 24 2 Serafimovič , 25 2 Suraž

ago 2016: 1 4 Noskov Nikolai , 2 3 Sendak Moris , 3 3 Serbin (Tehas) , 4 3 Petuhov Anatolii , 5 2 Vorsm , 6 2 Tar (lidn) , 7 2 Paragvai , 8 2 Peru , 9 2 Pugačova Alla , 10 2 Šotlandii , 11 2 Savičeva Julija , 12 1 Dišu tišinoi

set 2016: 1 2 For You , 2 2 DruGoy , 3 2 Vibirat' čudo , 4 2 Dišu tišinoi , 5 2 Paranoja (al'bom) , 6 2 Po pojäs v nebe , 7 2 Blaž , 8 2 Meladze Valerii , 9 2 Aleksandr Maršal , 10 2 Noskov Nikolai , 11 2 Dnepropetrovsk , 12 1 Šeksn (Šeksnan rajon)

out 2016: 1 2 1965 , 2 2 VIA Gra , 3 2 Ani Lorak , 4 2 Seišelan Sared , 5 2 Tova Mageina , 6 2 Bateti , 7 2 Moskv-Siti , 8 2 Estinma

nov 2016: 1 2 Čelentano Adriano , 2 2 Gott Karel , 3 2 Han Šahruh , 4 2 Douson Doris , 5 2 Lindemann Till' , 6 2 YouTube , 7 2 Kirovograd , 8 2 Moldov , 9 2 Bolgarii , 10 1 Sergei Mihejev

dez 2016: 1 2 Lugansk , 2 2 Uz' Devätkino , 3 2 Litvanma , 4 2 Mustmägi , 5 2 Bosnii da Gercegovin , 6 1 Jen

Wikipedias are initially ordered by number of speakers of the language

Speakers: Number of speakers of a language is the estimated total of primary and secondary speakers, is in many cases a very rough estimation (based on the page on the English Wikipedia about that language)
Regions are parts of the world where the language is spoken in substantial amounts (compared to total number of speakers). Regions where a language gained presence only by a recent diaspora are generally not included.
Region codes: AF:Africa, AS:Asia, EU:Europe, NA:North America, OC:Oceania, SA:South America, W:World Wide, CL:Constructed Language

Estatísticas geradas em Sexta-feira, 13 de janeiro 2017 04:52

Dump file vepwiki-20170101-stub-meta-history.xml.gz (edits only), size 5.3 Mb as gz -> 36 Mb
Dump processed till Dec 31, 2016, on server stat1002, ready at Mon-09/01/2017-03:06 after 34 sec.

Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### =
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.