Estatísticas da Wikipédia vepsian

Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Articles per size range / Records per namespace / Most edited articles / Zeitgeist
  Dec 2017: WMF Analytics Team is happy to announce the first release of Wikistats 2

  Wikistats has been redesigned for architectural simplicity, faster data processing, and a more dynamic and interactive user experience. The data used in the reports will also be made available for external processing.  

  First goal is to match the numbers of the current system, and to provide the most important reports, as decided by the Wikistats community (see survey).  
  Over time, we will continue to migrate reports and add new ones that you find useful. We can also analyze the data in new and interesting ways, and look forward to hearing your feedback and suggestions.  

  You can go directly to Wikipedia vepsian


Most metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.

Some metrics have been collected from the full archive dump which runs on lower frequency than the usual monthly cycle.
These metrics are columns F,I,J,K,M,N,O,P,Q,R from the first table.

See also metrics definitions

Monthly counts & Quarterly rankings: novembro 2017
DataWikipedistasArtigosBase de dadosLigações
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
nov 20170%   0%      +16%      +1%
out 20170%   0%      -40%      +1%
set 2017+1%   0%      -40%      +1%
ago 2017+6%   +1%      -24%      +1%
jul 2017+2%   +1%      -1%      +1%
jun 2017+3%   +1%      -2%      +2%
nov 201772 215,7 k  12   418      2,7 k
out 201772 215,7 k  11,9   359      2,7 k
set 2017721215,6 k  11,9   596      2,7 k
ago 2017714415,6 k 111,8   995      2,7 k
jul 2017671115,6 k 211,7   1,3 k      2,6 k
jun 2017662315,5 k 111,6   1,3 k      2,6 k
mai 201764 325,5 k 211,4   1,3 k      2,5 k
abr 201764 415,4 k 211,3   1,5 k      2,5 k
mar 201764 115,4 k 111,1   1,0 k      2,4 k
fev 201764 115,3 k 111   647      2,3 k
jan 201764 115,3 k 210,9   804      2,3 k
dez 201664 215,3 k 210,9   1,0 k      2,2 k
nov 201664 315,2 k  10,8   376      2,2 k
out 2016641215,2 k  10,8   286      2,2 k
set 201663 215,2 k 110,8   334      2,2 k
ago 201663 315,1 k  10,8   381      2,1 k
jul 2016632525,1 k 110,7   743      2,1 k
jun 201661 315,1 k 110,6   854      2,1 k
mai 2016611315,1 k 110,5   527      2,1 k
abr 201660 3 5,1 k  10,5   126      2,1 k
mar 2016602415,0 k  10,5   375      2,1 k
fev 201658 215,0 k  10,4   411      2,1 k
jan 201658 315,0 k 110,3   330      2,1 k
dez 201558 425,0 k 110,3   487      2,0 k
nov 2015581515,0 k 110,3   487      2,0 k
out 2015571414,9 k 110,3   325      2,0 k
set 201556 214,9 k 310,2   1,2 k      2,0 k
ago 2015561524,8 k 210,2   953      2,0 k
jul 201555 324,8 k 810,1   1,4 k      1,9 k
jun 2015551324,5 k 610,3   1,0 k      1,7 k
mai 201554 524,3 k 310,5   880      1,5 k
abr 2015543514,3 k 210,5   556      1,3 k
mar 201551 214,2 k 110,5   241      1,2 k
fev 201551 214,2 k 110,6   310      1,2 k
jan 201551 314,1 k 110,6   201      1,2 k
dez 201451 2 4,1 k  10,6   76      1,1 k
nov 201451 3 4,1 k 110,6   145      1,1 k
out 201451 2 4,1 k  10,6   155      1,1 k
set 201451 314,1 k 110,6   226      1,1 k
ago 2014511414,1 k 110,6   390      1,1 k
jul 201450 214,0 k 110,5   183      1,0 k
jun 2014501514,0 k 110,5   238      1,0 k
mai 201449 214,0 k 110,6   402      988
abr 201449 323,9 k 210,6   482      968
mar 201449 423,9 k 110,6   610      937
fev 201449 413,8 k2,1 k110,644521%3%2912,6 Mb228 k23 k1361921,0 k923
jan 201449 413,8 k2,1 k210,644120%3%7452,6 Mb224 k23 k137192996906
dez 2013491723,8 k2,0 k310,543120%3%8512,5 Mb216 k22 k172191975867
nov 2013482713,7 k1,9 k210,642119%3%3012,3 Mb206 k21 k175190938821
out 201346 313,6 k1,9 k210,641419%3%3312,3 Mb201 k20 k176184933810
set 201346 4 3,5 k1,8 k110,741519%3%2112,2 Mb197 k20 k175184917797
ago 201346 313,5 k1,8 k210,741319%3%2152,2 Mb195 k20 k168182913788
jul 201346 413,5 k1,8 k210,841319%3%3822,2 Mb193 k19 k205182910774
jun 2013461423,4 k1,7 k410,941118%3%6322,1 Mb188 k19 k215181895748
mai 201345 423,3 k1,6 k311,140518%3%5652,1 Mb179 k18 k281179873680
abr 201345 423,2 k1,6 k611,239918%3%8722,0 Mb171 k17 k376181791660
mar 201345 623,0 k1,5 k411,640118%3%3,8 k1,9 Mb163 k16 k1,3 k181747629
fev 201345 412,9 k1,4 k310,739719%3%1,5 k5,0 Mb156 k15 k134 k179713599
jan 201345 512,8 k1,4 k310,540019%3%1,6 k4,9 Mb153 k14 k131 k187704582
dez 2012453622,8 k1,3 k810,240319%3%2,4 k4,8 Mb149 k14 k128 k200691569
nov 2012422722,5 k1,3 k910,341720%3%2,3 k4,5 Mb141 k13 k119 k220637515
out 20124041022,3 k1,1 k610,442421%3%2,5 k4,2 Mb128 k11 k112 k241559448
set 2012361632,1 k969610,241820%3%3,3 k3,8 Mb114 k9,5 k104 k259486382
ago 201235 711,9 k85829,441020%3%1,3 k3,5 Mb102 k7,6 k98 k371399313
jul 201235 421,8 k81329,140520%3%1,4 k3,4 Mb97 k7,1 k95 k433366292
jun 2012351641,7 k784158,639920%3%2,9 k3,3 Mb93 k6,6 k93 k535376273
mai 2012342831,3 k681159,344924%4%2,0 k2,6 Mb78 k5,2 k75 k718311163
abr 201232261843573311,956332%5%8772,1 Mb64 k3,8 k60 k768203134
mar 20123027176551031255029%5%1,0 k2,0 Mb57 k3,2 k55 k837154108
fev 2012283123671442312,156932%6%2,5 k1,8 Mb52 k2,8 k50 k94914596
jan 201225 4159238229,558233%6%2421,6 Mb47 k2,5 k46 k87412185
dez 20112516254133749,958632%7%6381,5 Mb44 k2,3 k42 k80812168
nov 201124 51418256 11,360536%7%5831,2 Mb35 k2,0 k33 k56410953
out 201124121405252 10,261737%7%2211,2 Mb35 k1,9 k31 k55211050
set 20112327 397251 9,962838%8%1211,2 Mb35 k1,9 k30 k54810950
ago 20112157 38723819,861438%7%1741,1 Mb33 k1,9 k30 k52010446
jul 201116 11369220 9,859836%7%1251,1 Mb31 k1,8 k29 k5099546
jun 20111614 369215 9,553734%5%871,1 Mb28 k1,6 k29 k5127045
mai 201115 6 365210 9,453734%5%2691,1 Mb27 k1,6 k29 k5116945
abr 201115 5 363208 8,753433%6%1111,0 Mb27 k1,6 k28 k5066845
mar 201115 8235920218,550631%5%3121,0 Mb25 k1,5 k28 k5006145
fev 201115 61338185 8,145729%4%298947 kb22 k1,2 k26 k4683722
jan 20111514233117727,341927%4%622917 kb20 k1,1 k26 k4593017
dez 201014251266106 6,838020%5%216642 kb14 k95618 k3012112
nov 201012342259105 6,142120%5%298477 kb15 k89211 k2952012
out 20109   24796 5,235020%4% 260 kb12 k7824,4 k2561212
set 20109   24796 5,235020%4% 260 kb12 k7824,4 k2561212
ago 20109   24796 5,235020%4%3260 kb12 k7824,4 k2561212
jul 20109   24696 5,235120%4%7260 kb12 k7804,4 k2551212
jun 20109   24696 5,235120%4%1260 kb12 k7804,4 k2551212
mai 20109   24696 5,235120%4%5260 kb12 k7794,4 k2551212
abr 20109   24394 5,335020%4%2257 kb12 k7524,4 k2511212
mar 2010922124394 5,235020%4%169257 kb12 k7524,4 k2521212
fev 20107   23990 4,636020%4%4224 kb12 k1983,5 k247811
jan 20107   23990 4,636020%4%2224 kb12 k1983,5 k247811
dez 20097 1 23990 4,636020%4%74224 kb12 k1983,5 k246811
nov 20097 112399014,336020%4%202222 kb12 k1983,5 k246811
out 20097 112176823,828912%3%150190 kb9,2 k1793,4 k172811
set 2009712 1665414,130211%4%133163 kb7,1 k1853,3 k8588
ago 20096 1 14536 3,727410%3%692 kb5,6 k931,4 k6824
jul 20096 1 14435 3,727510%3%1491 kb5,5 k931,4 k6724
jun 20096   14232 3,726911%3% 88 kb5,3 k691,3 k6524
mai 20096   14232 3,726911%3% 88 kb5,3 k691,3 k6524
abr 2009612 14232 3,726911%3%1388 kb5,3 k691,3 k6524
mar 2009513 14130 3,625710%3%2886 kb5,1 k451,3 k6224
fev 20094 2 13628 3,525510%3%3785 kb5,0 k411,3 k6324
jan 200942411232223,62268%2%28277 kb4,1 k301,3 k6024
dez 20082 2 503 3,21334%2%1220 kb1,1 k1135516 3
nov 20082   483 3,11324%2% 16 kb1,0 k724714 3
out 20082   483 3,11324%2% 16 kb1,0 k724714 3
set 20082   483 3,11324%2% 16 kb1,0 k724714 3
ago 20082   483 3,11324%2% 16 kb1,0 k724714 3
jul 20082 1 483 3,11324%2%716 kb1,0 k724714 3
jun 20082   423 3,41465%2% 15 kb99272418 3
mai 20082 1 42313,41465%2%4215 kb99272418 3
abr 20082 2 213 4,724110%5%1510 kb88571192 3
mar 20082 1 172 4,91636% 225,1 kb4874161 3
fev 2008221 142 4,41827% 624,3 kb4592141 3
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternas

> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
The following table ranks this project in relation to projects in other languages with 1000+ articles
out 2017168 174137165  201   133      277
jul 2017177130213136164 123202   106      277
abr 2017181 135136165 119209   94      277
jan 2017178 192135164 121212   113      277
out 2016174134169128163  210   138      277
jul 201617299125103160 135210   112      277
abr 2016178 143 160  210   160      277
jan 2016179 158138160 149210   139      277
out 2015179129144135160 142211   139      277
jul 2015180 151102159 72213   96      277
abr 201517995130145163 124209   125      277
jan 2015181 147136164 149208   159      277
out 2014179 171 163  210   152      277
jul 2014178 159130164 143208   152      277
abr 2014178 157104162 119205   119      277
jan 2014172173136133159174123204205200198114198195181227236189277
out 2013173167152121160174113204206201198125202197184227236192277
jul 2013170144132130160175111204205201200127202197184226237190277
abr 201317215314310816318087200207201198130204203187210234192277
jan 2013169151123135170182109204202196195157197206187174232196277
out 2012173769410318318684202199193192128202210193178223202277
jul 2012186146139107190197115205198193190164207215212186202210277
abr 2012187102116134219207108215214213210195219231229204170225277
jan 2012200160141131225218117214213212209237226236239213165233277
out 2011203133171134234229164213212211208248232239239227186231277
jul 2011232160193127233231167210209208205259233238238225184236277
abr 2011235152128136231228162205204203200258232236239222183244277
jan 2011233129137100234231117203202201198213240241240220187257277
out 2010247157225135237235157194193192190274253246243255207262277
jul 2010244170236144235235160190189188186273252243240253205260277
abr 2010242157219142230230161187186185184273248242239249198258277
jan 2010252150215134228230156184184183182269249241254254200261277
out 2009248150198126225235118182182181180233250245256250212261277
jul 2009249197188137233244152175175174173260258254262260235266277
abr 2009247125169147230244147172172171170262256250259259232263277
jan 200925693125122233247116167167166165209256251267257232262276
out 2008267143210137247266147161161160159268264262268262259266274
jul 2008262156194135241262150155155154152260261259267261254265273
abr 2008260153166133254261154150150148146254262259266261261263273
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
 WikipedistasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikipedistas (usuários registrados)
A = Wikipedistas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikipedistas que editaram pelo menos dez vezes desde que chegaram
C = Wikipedistas que contribuíram cinco vezes ou mais este mês
D = Wikipedistas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Artigos que contêm pelo menos uma ligação interna e 200 caracteres de texto legível, não contando códigos wiki e html,
      ligações ocultas, etc.; títulos também não contam (outras colunas são baseadas no método oficial de contagem)
G = Novos artigos por dia no mês passado
H = Número médio de revisões por artigo
I = Tamanho médio dos artigos em bytes
J = Porcentagem de artigos com pelo menos 0,5 kb de texto legível (veja F)
K = Porcentagem de artigos com pelo menos 2 kb de texto legível (veja F)

Base de dados
L = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
M = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
N = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

O = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
P = Total de ligações para outras wikipédias
Q = Total de imagens apresentadas
R = Total de ligações para outros sítios
S = Total de páginas de redirecionamento

Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  5  10  100  1000  1  3  5  10  25  100  1  3  5  10  25  100  250  1000  5  10  100 
nov 20179221111 1   311    211111     
out 201711321111 1   511    4222111    
set 201716521111     2111   4111111 11 
ago 201721843311 1   10441   5222222111 
jul 201713311111111  1111   4222211 11 
jun 2017134311111    1111   3222211 11 
mai 201711532221 1   11111  3222211111 
abr 20171864221111   2221   2222211 11 
mar 20178311111     3222   211111  11 
fev 201715311111     31111  611111  11 
jan 201711311111     3111   511111  11 
dez 20166321111     4221   311111  11 
nov 201611432111     111    421111  11 
out 20161032211      2111   32111   11 
set 2016932221  1   6111   41111      
ago 20161533221      5321   43221      
jul 20169655321     53221  322111  1  
jun 201610333211 1   42211  611111  11 
mai 201611433311 11  8321   42211   11 
abr 201693322      721    4111    11 
mar 201616543211     321    5221    11 
fev 201612222111 11  221    62111   11 
jan 20168532211     9321   644211  11 
dez 201514543321     8532   554211  11 
nov 201514553111 1   4      52111      
out 20151554321  1   411    311     1  
set 20159222211111  104     5332111    
ago 201517553222 11  53     3222211 11 
jul 201515333222     422    3222222    
jun 201514533222 1   221    422222     
mai 201515655321     7321   5332211    
abr 201514555411     643    53211      
mar 2015632211      4      42211      
fev 201511221111 1   432    7211111    
jan 20151243321      6311   843111     
out 201711321111 1   511    4222111    
jul 201713311111111  1111   4222211 11 
abr 20171864221111   2221   2222211 11 
jan 201711311111     3111   511111  11 
out 20161032211      2111   32111   11 
jul 20169655321     53221  322111  1  
abr 201693322      721    4111    11 
jan 20168532211     9321   644211  11 
out 20151554321  1   411    311     1  
jul 201515333222     422    3222222    
abr 201514555411     643    53211      
jan 20151243321      6311   843111     
out 201494222      321    6211       
jul 20141122211      5332   42221      
abr 201410332221     43211  52221      
jan 201414544411 11  74422  854311  1  
out 20135333211     4211   5211       
jul 20131654331      53321  94411      
abr 201318544222 33  53221  97421   331
jan 20131155431  15123 632111 133321   661
out 20121910108622 1383 94332  18854311 762
jul 201215644221 1083 832111 2653222  66 
abr 20121466431  11102 9541   16632    53 
jan 2012754421      54332  32211      
out 2011722111      1      1111       
jul 2011111111  1          21         
abr 201165541      1      21         
jan 20115444321     421    4332       
out 2010          1                 
jul 2010      1          111        
abr 20101                2211       
jan 2010                            
out 2009321111             11111      
jul 20091111                         
abr 2009222                          
jan 2009444331      332    32222      
out 2008                            
jul 2008211                          
abr 20082221                         


Distribuição de edições de artigos por wikipedistas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...

Edições >=WikipedistasEdições total


9 wikipedistas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias

 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
30 dias
30 dias
30 dias
30 dias
KoiravvaUC1 019,12739710,525206out 21, 20121865658---
WolverèneUC10 09421213-mai 12, 2014129713---
ShadowxfoxUC67+41111-mai 14, 2017199----
HöyhensUC111...5533nov 29, 2017 11--
Born2bgratisUC245+25221--ago 30, 201791----
FuturoTVUC508...11--nov 06, 20172311--
Skiamzhio84510UC509...11--nov 14, 20171511--
Babylone2090UC510...11--nov 23, 20176----
Globetrotter19UC511...11--nov 27, 20172----


20 wikipedistas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

  Primeira ediçãoúltima edição
Tamara UstinovaUC29,050out 19, 20112233mai 26, 20141283
SebranikUC32,731mai 15, 20122024fev 08, 2017294
SihlaineUC42,218nov 05, 20131485set 05, 20141181
K9re11UC52,091fev 03, 20141395out 23, 2015768
МаксимUC61,502dez 29, 20112162jul 07, 20141241
IgriksUC71,461set 18, 20092994mai 14, 20131660
Игорь БродскийUC81,264fev 23, 20093201dez 04, 2015726
IketsiUC91,165jun 15, 20112359jul 30, 20141218
Andrijko Z.UC11769nov 08, 20102578nov 20, 20112201
MF-WarburgUC12679fev 01, 20122128fev 07, 20131756
FrhdkazanUC13313jan 22, 2016677ago 19, 2017102
SuraUC14259fev 19, 20083571mar 31, 20112435
Midnight GreenUC15202ago 24, 20112289jun 25, 20121983
Анна ОзероваUC16189mai 11, 2016567jul 22, 2016495
PorbóllettUC17157nov 24, 20131466dez 28, 2015702
Triple-ADHD-ASUC18156jan 17, 20093238dez 09, 20092912
U.SteeleUC19139ago 11, 20112302jul 20, 20121958
RomaineBotUC20130mar 30, 20102801mar 30, 20102801
Connection 3UC21108jun 27, 20131616set 21, 20131530
BudelbergerUC2290dez 11, 20083275fev 22, 20093202


Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 3.093 edições foram feitas por usuários anônimos, de um total de 67.769 edições ( 4e %)

43 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
EmausBotUC14,378fev 03, 20122126set 03, 2016452--
MerlIwBotUC23,511mai 10, 20112395ago 09, 20131573--
AddbotUC32,947mar 07, 20131728ago 19, 20131563--
XqbotUC41,815abr 16, 20122053ago 20, 2017101--
GerakibotUC5559mai 24, 20122015mar 06, 20131729--
JackieBotUC6555fev 09, 20122120mar 02, 20131733--
AvocatoBotUC7542fev 08, 20122121jul 10, 20121968--
LegobotUC8411mar 11, 20131724abr 02, 20131702--
RedBotUC9381abr 21, 20122048ago 21, 20121926--
JAnDbotUC10354fev 03, 20122126jul 02, 20131611--
Idioma-botUC11229fev 03, 20122126mar 05, 20131730--
YFdyh-botUC12204jun 24, 20121984fev 27, 20131736--
Makecat-botUC13185out 26, 20121860mar 05, 20131730--
HiW-BotUC14173fev 05, 20122124nov 08, 20121847--
CommonsDelinkerUC15171set 30, 20092982nov 23, 20176--
LaaknorBotUC16134fev 04, 20122125mar 03, 20131732--
Justincheng12345-botUC17129jun 23, 20121985jan 08, 20131786--
Luckas-botUC18115abr 01, 20122068mai 20, 20122019--
VolkovBotUC19107fev 14, 20122115mar 04, 20131731--
AvicBotUC2092jun 01, 20122007dez 09, 20121816--
EscarbotUC2186mar 06, 20122094mai 19, 2016559--
KLBot2UC2269abr 13, 20131691jul 07, 20131606--
VagobotUC2353fev 29, 20122100set 04, 20121912--
SantoshBotUC2441out 24, 20121862mar 04, 20131731--
PixelBotUC2533fev 20, 20122109mar 03, 20131732--
KamikazeBotUC2633fev 29, 20122100jan 26, 20131768--
CarsracBotUC2730fev 12, 20122117fev 24, 20131739--
SynthebotUC2825mai 16, 20122023dez 30, 20121795--
WikitanvirBotUC2920fev 04, 20122125abr 05, 20122064--
RobbotUC3019fev 04, 20122125set 02, 20121914--
タチコマ robotUC3114dez 28, 20112163nov 15, 2016379--
JotterbotUC3214jan 15, 20131779jan 26, 20131768--
DragonBotUC3311jan 12, 20131782jan 14, 20131780--
SassoBotUC349mai 29, 20122010mar 04, 20131731--
GhalyBotUC358dez 27, 20121798jan 31, 20131763--
CompBotUC367mar 24, 20122076mai 21, 20122018--
CocuBotUC377nov 30, 20121825fev 11, 20131752--
OctraBotUC387jan 28, 20151036fev 02, 20151031--
NjardarBotUC394jun 16, 20121992out 27, 20121859--
YiFeiBotUC403ago 07, 2015845dez 31, 2015699--
MastiBotUC412fev 26, 20131737fev 28, 20131735--
MalarzBOTUC421ago 18, 20121929ago 18, 20121929--
TXiKiBoTUC431dez 20, 20121805dez 20, 20121805--


Artigos que contêm pelo menos uma ligação interna e .. caracteres de texto legível, não contando códigos wiki e html,
ligações ocultas, etc.; títulos também não contam  (excluindo páginas de redirecionamento)

 < 32 ch< 64 ch< 128 ch< 256 ch< 512 ch< 1 k ch< 2 k ch< 4 k ch< 8 k ch< 16 k ch< 32 k ch< 64 k ch


Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.

categorizados 1
nov 20178,4 k46563 71,4 k15,7 k       
out 20178,3 k46563 71,2 k15,6 k       
set 20178,3 k46563 797415,6 k       
ago 20178,3 k46462 791615,4 k       
jul 20178,2 k46361 784615,1 k       
jun 20178,1 k46261 780814,8 k       
mai 20178,1 k46161 776914,1 k       
abr 20177,9 k46161 769913,1 k       
mar 20177,8 k46161 767612,9 k       
fev 20177,6 k46161 767212,8 k       
jan 20177,6 k45961 766912,7 k       
dez 20167,5 k45860 766712,6 k       
nov 20167,4 k45660 766612,5 k       
out 20167,4 k45660 766612,5 k       
set 20167,3 k45660 766612,4 k       
ago 20167,3 k45560 766612,4 k       
jul 20167,3 k45357 766512,4 k       
jun 20167,2 k45157 766512,3 k       
mai 20167,2 k45055 766412,3 k       
abr 20167,1 k44955 766212,2 k       
mar 20167,1 k44655 766212,2 k       
fev 20167,1 k44555 766012,2 k       
jan 20167,1 k44455 765812,2 k       
dez 20157,1 k44455 765412,1 k       
nov 20157,0 k44154 764712,1 k       
out 20157,0 k44154 764712,0 k       
set 20156,9 k44154 763512,0 k       
ago 20156,8 k43954 756411,9 k       
jul 20156,7 k43954 755111,8 k       
jun 20156,2 k43854 754211,7 k       
mai 20155,8 k43854 753511,6 k       
abr 20155,6 k43653 752011,5 k       
mar 20155,4 k43553 751111,5 k       
fev 20155,4 k43453 750311,4 k       
jan 20155,3 k43053 739511,3 k       
dez 20145,2 k42353 739511,3 k       
nov 20145,2 k42253 739511,2 k       
out 20145,2 k42053 739411,2 k       
set 20145,2 k41853 739411,2 k       
ago 20145,1 k41453 739011,2 k       
jul 20145,1 k40653 736711,1 k       
jun 20145,0 k40552 735911,1 k       
mai 20145,0 k40448 635911,1 k       
abr 20144,9 k39646 635411,1 k       
mar 20144,8 k39444 635111,1 k       
fev 20144,8 k38843 634411,0 k      280
jan 20144,7 k38542 634311,0 k      721
dez 20134,6 k38137 63351987      839
nov 20134,5 k37936 63341966      298
out 20134,4 k37435 63261963      328
set 20134,3 k37135 63261955      148
ago 20134,3 k35735 63261954      197
jul 20134,3 k35535 63251947      361
jun 20134,2 k34935 63201946      611
mai 20134,0 k34735 63201941      530
abr 20133,9 k33834 63051917      723
mar 20133,7 k32732 63011910      378
fev 20133,5 k20531 63011904      276
jan 20133,4 k19330 63011900      240
dez 20123,3 k18727 62951896      999
nov 20123,0 k17627 62901868      1171
out 20122,7 k17124 42851785      1428
set 20122,4 k16322 42641645      2204
ago 20122,2 k15322 42461438      443
jul 20122,1 k14521 42441396      585
jun 20122,0 k13015 42201348      1694
mai 20121,5 k1159 41361225      1113
abr 20129771047 21291207      365
mar 2012873927 21281206      313
fev 2012767805 2127 190      1722
jan 2012677 4  118 179      239
dez 2011609 4  118 176      463
nov 2011471 3  115 170      222
out 2011455 3  115 170      219
set 2011447 3  115 170      118
ago 2011433 3  110 167      172
jul 2011415 3  110 166      115
jun 2011414 3  110 164      71
mai 2011410 3  110 164      65
abr 2011408 3  106 164      110
mar 2011404 3  106 164      310
fev 2011359 3  78 161      295
jan 2011347 3  77 157      620
dez 2010277 3  77 155      211
nov 2010270 3  76 155      289
out 2010258 3  75 155       
set 2010258 3  75 155       
ago 2010258 3  75 155      2
jul 2010257 3  75 155       
jun 2010257 3  72 155       
mai 2010257 3  72 155      4
abr 2010254 3  72 154      1
mar 2010254 3  71 154      161
fev 2010249 3  50 103      2
jan 2010249 3  50 103       
dez 2009249 3  50 103      14
nov 2009249 3  50 103      189
out 2009227 1  43 98      138
set 2009173    41 85      101
ago 2009149    30 35      5
jul 2009148    30 35      14
jun 2009146    30 35       
mai 2009146    30 35       
abr 2009146    30 35      12
mar 2009145    30 35      27
fev 2009140    26 33      36
jan 2009127    26 32      280
dez 200853    4 12      12
nov 200851    2 11       
out 200851    2 11       
set 200851    2 11       
ago 200851    2 11       
jul 200851    2 11      7
jun 200845    2 11       
mai 200845    2 11      42
abr 200824    1 5      15
mar 200820    1 5      21
fev 200817    1 2      58


Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons



For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

fev 2008: 1 2 Piter , 2 1 Pätnič

mar 2008: 1 1 Šoutjärv'

abr 2008: 1 1 Šoutjärv'

mai 2008: 1 1 Šoutjärv'

jul 2008: 1 1 Mecoi

dez 2008: 1 1 Vingl

jan 2009: 1 4 Meiden Tat , 2 4 Kos'kenaluižen rajon , 3 3 Kühkjaine , 4 3 Kuruv , 5 3 Kana , 6 3 Jerusalim , 7 3 Jablokpu , 8 3 Hel'sinki , 9 3 Hab , 10 3 Biblii , 11 2 Šušt , 12 2 Šoutjärv' , 13 2 Mecantaga , 14 2 Zaiceva Nina , 15 2 Vologdan agj , 16 2 Vingl , 17 2 Vil'häl , 18 2 Vepsän rahvahaline volost' , 19 2 Vepsän , 20 2 Venäma , 21 2 Vaugedvenäma , 22 2 Uz' Zavet , 23 2 Tihvinan rajon , 24 2 Tervoil , 25 2 Suomen kel'

fev 2009: 1 2 Pälehtpol’ , 2 2 Karjalan Tazovaldkundan gimn , 3 1 Litvanma

mar 2009: 1 2 Zaiceva Nina , 2 1 Šoutjärv'

abr 2009: 1 2 Suomenma , 2 1 Vepsän

jul 2009: 1 1 Zverin lugu

ago 2009: 1 1 Suomenma

set 2009: 1 2 Pälehtpol’ , 2 1 Meiden Tat

out 2009: 1 2 Vepsän rahvahaline volost' , 2 2 Venäma , 3 2 Kuld , 4 1 Šoutjärv'

nov 2009: 1 2 Suomenma , 2 1 Zverin lugu

dez 2009: 1 2 Grekanma , 2 1 Mal't

fev 2010: 1 1 Pälehtpol’

mar 2010: 1 2 Sur' Britanii , 2 2 Pu , 3 2 Ispanii , 4 2 Hristofor Kolumb , 5 2 Saksanma , 6 2 Lönnrot Elias , 7 2 Avstrii , 8 1 Šušt

abr 2010: 1 1 Einštein Al'bert

mai 2010: 1 1 Kaliningradan agj

ago 2010: 1 1 Pol'šanma

nov 2010: 1 3 Kaliningradan agj , 2 2 Mecoi , 3 2 Litvanma , 4 2 Änine , 5 2 Podporožj , 6 2 Kaunas , 7 2 Karjalan keled , 8 2 Karjalan Tazovaldkund , 9 2 Kant Immanuel' , 10 2 Kaliningrad , 11 2 Kalevala , 12 2 Kajag , 13 2 Jurij Gagarin , 14 2 Italii , 15 2 Ispanii , 16 2 Irlandii , 17 2 Hel'sinki , 18 2 Haitmann Fridrih , 19 2 Grekanma , 20 2 Gent , 21 2 Flevoland , 22 2 Eva , 23 2 Estinma , 24 1 Zverin lugu

dez 2010: 1 4 Surikov Vasilii , 2 3 Vologdan agj , 3 3 Vinsent van Gog , 4 3 Tu-154 , 5 2 Čehov Anton , 6 2 Änižröunan rajon , 7 2 Migel' de Servantes Saavedra , 8 2 Mal't , 9 2 Lüksemburg , 10 2 Mocart Vol'fgang Amadeus , 11 2 Zaiceva Nina , 12 2 Gügo Viktor , 13 2 Vaugedvenäma , 14 2 Šeikspir Uil'jam , 15 2 Tervoil , 16 2 Suomalaiž-ugrilaine škol , 17 2 Sodjärv , 18 2 Päiväine , 19 2 Portugalii , 20 2 Podporožj , 21 2 Petroskoi , 22 2 Orav , 23 2 Nemž , 24 2 Leonardo da Vinči , 25 2 Kettunen Lauri

jan 2011: 1 3 Vengrii , 2 3 Ukrain , 3 3 Kazahstan , 4 3 Italijan kel' , 5 2 Ženevan järv , 6 2 Šoutjärv' , 7 2 Čehanma , 8 2 Änižröunan rajon , 9 2 Lüksemburg , 10 2 Vepsän kul'turan muzei , 11 2 Vepsän kel' , 12 2 Venäma , 13 2 Vaugedvenäma , 14 2 Vatikan , 15 2 Suomenma , 16 2 Slovenii , 17 2 Slovakii , 18 2 Serbii , 19 2 San Marino , 20 2 Pälehtpol’ , 21 2 Piter , 22 2 Petroskoi , 23 2 Nevondkundaližiden Socialistižiden Tazovaldkundoiden Ühtištuz , 24 2 Moskv , 25 2 Monak

fev 2011: 1 3 Kazahan kel' , 2 3 Kazahlaižed , 3 3 Händikaz , 4 2 Änižröunan rajon , 5 2 Litvanma , 6 2 Vepsän rahvahaline volost' , 7 2 Totaran kel' , 8 2 Suomenma , 9 2 Ročinma , 10 2 Petroskoi , 11 2 Kaži , 12 2 Kaleig , 13 2 Irlandii , 14 2 Grekanma , 15 2 Saksanma , 16 2 Estin kel' , 17 2 Daugavpils , 18 1 Šveicarii

mar 2011: 1 3 Venäma , 2 3 Moskv , 3 3 Kaunas , 4 2 Šokš , 5 2 Medvedev Dmitrii , 6 2 Rim , 7 2 Repin Il'ja , 8 2 Pälehtpol’ , 9 2 Putin Vladimir , 10 2 Piter , 11 2 Peitsemnižed , 12 2 Abramov Nikolai , 13 2 Kuz' , 14 2 Kuld , 15 2 Kolumb Hristofor , 16 2 Kazmused , 17 2 Karjalan Tazovaldkundan gimn , 18 2 Karjalan Tazovaldkund , 19 2 Kant Immanuel' , 20 2 Kaliningrad , 21 2 Jel'cin Boris , 22 2 Immanuel Kant , 23 2 Haitmann Fridrih , 24 2 Germanijan kel' , 25 2 Gagarin Jurii

abr 2011: 1 2 Venäma , 2 2 Kazahstan , 3 2 Bel'gii , 4 1 Šveicarii

mai 2011: 1 3 Süvär' , 2 2 Päiväine , 3 2 Pifagoran teorem , 4 2 Kolumb Hristofor , 5 2 Karjalan Tazovaldkundan Rahvahaline teatr , 6 1 Marok

jun 2011: 1 2 Karjalan Tazovaldkund , 2 2 Danii , 3 2 Bolgarii , 4 2 Alma-At , 5 1 Čehanma

jul 2011: 1 1 Ženevan järv

ago 2011: 1 3 Vezi , 2 3 Süvär' , 3 2 Šrenkan kuz' , 4 2 Venäma , 5 2 Vauged kuz' , 6 2 Tän'-šanine kuz' , 7 2 Turkmenistan , 8 2 Taškent , 9 2 Serbine kuz' , 10 2 Saratov , 11 2 Pifagoran teorem , 12 2 Peitsemnižed

set 2011: 1 5 Lezgin kel' , 2 3 Dagestan , 3 2 Ženevan järv , 4 2 Volgograd , 5 2 Samara , 6 2 Orenburg , 7 2 Omsk , 8 2 Kurgan , 9 2 Kaliningradan agj , 10 1 Zverin lugu

out 2011: 1 2 Vil'nüs , 2 2 Pälehtpol’ , 3 2 Lakan kel' , 4 2 Korsik , 5 1 Šušt

nov 2011: 1 3 Tähtaz , 2 3 Tu-154 , 3 3 Pälehtpol’ , 4 2 Vinsent van Gog , 5 2 Vikipedii , 6 2 Vikimedii , 7 2 Vezi , 8 2 Rim , 9 2 Pol'šanma , 10 2 Pifagoran teorem , 11 2 Petroskoi , 12 2 Pariž , 13 2 Paltog , 14 2 Moskv , 15 2 Kuruv , 16 2 Karjalan Tazovaldkund , 17 1 Šoutarv

dez 2011: 1 5 Vaugedpert' (Vašington) , 2 4 Amerikan Ühtenzoittud Valdkundad , 3 3 Mel'burn , 4 3 Lüblän , 5 3 Pälehtpol’ , 6 3 Pil'ved , 7 3 Oper , 8 3 Natrii , 9 3 Kundlimed , 10 3 Konstebl Džon , 11 3 Džasper (lidn, Minnesot) , 12 3 Bratislav , 13 3 Ankar , 14 2 Šur , 15 2 Šrödinger Ervin , 16 2 Šanhai , 17 2 Čuvašan kel' , 18 2 Čai , 19 2 Mafii , 20 2 MP3-plejer , 21 2 Lüblin , 22 2 Avrora (kreiser) , 23 2 Zagreb , 24 2 Vintaž , 25 2 Vepsän kel'

jan 2012: 1 4 Venäman Tazovaldkundad , 2 4 Opera , 3 4 Internet Explorer , 4 3 Čerkessk , 5 3 Čeboksarad , 6 3 Petr I Sur' , 7 3 Mozilla Firefox , 8 3 Groznii , 9 3 Google Chrome , 10 2 Čeläbinsk , 11 2 Microsoft Windows , 12 2 Microsoft Office Word , 13 2 Microsoft Office Excel , 14 2 Vašington (lidn) , 15 2 Uraližed keled , 16 2 Skopje , 17 1 Vepsän kelen aigad

fev 2012: 1 14 Pälehtpol’ , 2 5 Sarapul , 3 5 Dagestanan Tazovaldkund , 4 4 Zaiceva Nina , 5 4 Venäma , 6 4 Särg , 7 4 Petr I Sur' , 8 4 San Francisko , 9 4 Podporožj , 10 4 Petroskoi , 11 4 Orav , 12 4 Korol' i Šut , 13 4 Kijev , 14 4 Baškiran kel' , 15 4 Azerbaidžan , 16 3 Vepsän kelen aigad , 17 3 Bolgarijan kel' , 18 3 Antofagast , 19 3 Val'paraiso , 20 3 Santjago , 21 3 Konseps'jon , 22 3 Mrongovo , 23 3 , 24 3 Lacuna Coil , 25 3 Šveicarii

mar 2012: 1 4 Soči , 2 4 Pälehtpol’ , 3 3 Buranovon Baboid , 4 3 Narv (lidn) , 5 3 Tartu , 6 3 Linkin Park , 7 3 Čehanma , 8 2 Bardan rajon , 9 2 Šeki , 10 2 Nahičevan , 11 2 Gändž , 12 2 Gai (lidn) , 13 2 Orenburgan agj , 14 2 Moščen , 15 2 Kautokeino , 16 2 Ostrav , 17 2 Himižiden elementoiden periodine tablut , 18 2 Udmurtan kelen kändod , 19 2 Rio-de-Žaneiro , 20 2 San Paulu , 21 1 Orsk

abr 2012: 1 4 Pälehtpol’ , 2 3 Vepsän nimed , 3 3 Pol'šanman administrativiž-territorialine jagand , 4 2 666 (lugu) , 5 2 Vepsän Vikipedii , 6 2 IPod , 7 2 Vodin kel' , 8 2 Lantanoidad , 9 2 Korrea Rafael' , 10 2 Ščecin , 11 2 Abdulino , 12 2 Himižiden elementoiden periodine tablut , 13 2 Melent'jeva Marija , 14 2 Zaiceva Marja , 15 2 Lämoi , 16 2 Votkinsk , 17 2 Vobl , 18 2 Jašov Viktor , 19 2 Vepsän kel' , 20 2 Šeikspir Uil'jam , 21 2 Udmurtan kel' , 22 2 Portlend (Oregon) , 23 2 Kühkjaine , 24 2 Kur'ged , 25 2 Kalitkad

mai 2012: 1 7 Pälehtpol’ , 2 6 Party for Everybody , 3 5 Piter , 4 4 Piterin metropoliten , 5 4 Vepsän Vikii , 6 4 Buranovon Baboid , 7 3 MySpace , 8 3 Euphoria , 9 3 Lorin , 10 3 Should've Known Better , 11 3 Evrovizii-2012 , 12 3 Venäman millionerlidnad , 13 3 Ogeruz i aznoičend , 14 3 Teräsbetoni , 15 3 Rabat , 16 3 Glittertind , 17 3 Viski , 18 3 Unheilig , 19 3 Üebermutter , 20 3 Rammstein , 21 3 Tatarstanan Tazovaldkund , 22 3 Udmurtijan Tazovaldkund , 23 3 12 (lugu) , 24 3 11 (lugu) , 25 3 10 (lugu)

jun 2012: 1 6 Lavin Avril , 2 5 Evropan futbolan čempionat 2012 , 3 5 Vikipedii , 4 4 Lorin , 5 4 Pälehtpol’ , 6 3 Bahreinan valdkundznam , 7 3 .bs , 8 3 Bagaman Sared , 9 3 Kubanin kozakišton hor , 10 3 Vepsän flag , 11 3 Norvegijan konstitucijan päiv , 12 3 Antiguan da Barbudan flag , 13 3 Belogorsk (Amuran agj) , 14 3 Blagodarnii , 15 3 Krasnodaran rand , 16 3 Jousne , 17 3 Joudjuden statui , 18 3 .us , 19 3 .dz , 20 3 FK Zenit Piter , 21 3 .al , 22 3 .nl , 23 3 Alamaiden valdkundznam , 24 3 Afganistanan valdkundznam , 25 3 .af

jul 2012: 1 4 Pohjoižsaamen Vikipedii , 2 4 Öbok , 3 3 Udmurtan Vikipedii , 4 3 Slovenijan kel' , 5 3 Evropan futbolan čempionat 2012 , 6 3 Turkanma , 7 3 Mozilla Firefox , 8 2 Centillion , 9 2 Grekan kirjamišt , 10 2 Taimir (lehtez) , 11 2 7-Zip , 12 2 Puht , 13 2 Šujan stancii , 14 2 Meliorativnii , 15 2 Bernar Sara , 16 2 Ehtbok , 17 2 Longibok , 18 2 Homendezbok , 19 2 Päivlaskm , 20 2 Päivnouzm , 21 2 Pohjoine , 22 2 Suvi , 23 2 Salavat Kupere , 24 2 Dakk , 25 2 Bangladeš

ago 2012: 1 4 Vilämovicen kel' , 2 4 Vn 2012 Kezaolimpiadan lopmižed , 3 2 Naily , 4 2 Komin Vikipedii , 5 2 Ternopol' , 6 2 Fareran kel' , 7 2 Vagur , 8 2 Alitus , 9 2 Priozerskan rajon , 10 2 Priozersk , 11 2 Bugri (Vsevoložskan rajon) , 12 2 Vepsän ülüz , 13 2 Venäman flag , 14 2 Valaam , 15 2 .et , 16 2 Virrat , 17 2 Ferland Džodel' , 18 2 Hibbert Eleanor , 19 2 Nuori Karjala , 20 2 Breivik Anders Bering , 21 2 Regalado Tomas , 22 2 Windir , 23 2 Tanzwut , 24 2 Majami , 25 2 AÜV:oiden flag

set 2012: 1 4 Evrejan kel' , 2 4 Pälehtpol’ , 3 4 Google Chrome , 4 3 Virun kel' , 5 3 Vikingad , 6 3 Ristitun hibj , 7 3 A , 8 3 Ganter Henri , 9 3 Pussy Riot , 10 3 Ezmäine mail'man voin , 11 3 A7V , 12 3 Spalletti Lučano , 13 3 Fobijoiden nimikirjutez , 14 3 , 15 3 Modern Talking , 16 3 Polandball , 17 3 Grekan kirjamišt , 18 3 FK Zenit Piter , 19 3 Venälaižed , 20 3 Artut' , 21 3 Gändž , 22 3 Ostrav , 23 3 Brno , 24 3 Venän kel' , 25 3 Prag

out 2012: 1 4 Singapur , 2 4 Vologdan agj , 3 4 Rig , 4 3 Norvegijan Vikipedii , 5 3 Pohjoižen saldat (fil'm) , 6 3 Sar' (fil'm, Venäma, 2006) , 7 3 Dnestranrand , 8 3 Ahvenanma , 9 3 Grekanman Makedonii , 10 3 Šokolad , 11 3 Dom-2 , 12 3 Taivan' (sar') , 13 3 Pirahan (kel') , 14 3 Ternopol' , 15 3 Marti Petit Antoni , 16 3 Litvanma , 17 3 Vil'nüs , 18 3 Varšav , 19 3 Portlend (Oregon) , 20 3 Latvii , 21 3 Grekanma , 22 3 Evropan valdkundad , 23 3 Budapešt , 24 3 Berlin , 25 3 Albanii

nov 2012: 1 4 Vepsän rahvahan hor , 2 3 Lodehline aviabaz , 3 3 Kurgiden aig , 4 3 Kalarand , 5 3 «Ö»-kirjamen muštpacaz , 6 3 Mi? Kus? Konz? , 7 3 Tedr , 8 2 Pirgaine , 9 2 Randaine , 10 2 Duty free , 11 2 Jablonovskii-sild (Piter) , 12 2 Jablonovskii-sild (Krasnodar) , 13 2 Kegonpaniilind , 14 2 Pähkim , 15 2 Merikukoi , 16 2 Nug , 17 2 Habobatk , 18 2 In a Reverie , 19 2 Kodipühüt , 20 2 Kodipulo , 21 2 Jälinduine , 22 2 Kärg , 23 2 Näk , 24 2 Zor'alinduine , 25 2 Küuki

dez 2012: 1 3 Livin Vikipedii , 2 3 Gamburger , 3 3 Hot-dog , 4 3 Venäma Evrovizijal , 5 3 MySpace , 6 3 Naberežnije Čelni , 7 2 Ronson Šarlotta , 8 2 Mir (orbitine stancii) , 9 2 Bleeding Souls , 10 2 Ethereal (demo) , 11 2 Plazm , 12 2 Sleep of Right , 13 2 Lumenšur , 14 2 Hobednitid , 15 2 Kuziine om sündnu mecha , 16 2 Maseru , 17 2 Kindhad , 18 2 Truganini , 19 2 Happy Tree Friends , 20 2 Letsie III , 21 2 Suomalaine veič , 22 2 Tüp , 23 2 Nin' , 24 2 Britanijan Kuldrand , 25 2 Renault Logan

jan 2013: 1 3 Vederistmad , 2 3 Grand Theft Auto: San Andreas , 3 3 Vologdan agj , 4 2 Evenalaižed , 5 2 Evenkalaižed , 6 2 Udinalaižed , 7 2 Lumiuk , 8 2 Darginalaižed , 9 2 De Agostini , 10 2 I'm Not Afraid , 11 2 Bela Lugosi's Dead , 12 2 Wide Awake (Lacuna Coil:an pajo) , 13 2 I Won't Tell You , 14 2 Ragozina Natal'ja , 15 2 Enjoy the Silence , 16 2 Swamped , 17 2 Vepsän mifologii , 18 1 Leonardo Forti

fev 2013: 1 3 Jožin z bažin , 2 3 Pori , 3 3 Lihtenštein , 4 2 Nor'mik , 5 2 Norhein , 6 2 Habinod , 7 2 Bard (hibused) , 8 2 Real,- , 9 2 Raum , 10 2 Etimologii , 11 2 Kolan norvegijalaižed , 12 2 Lukumades , 13 2 Gitar , 14 2 Tofalaralaižed , 15 2 Doncova Dar'ja , 16 2 Lužkovan stil' , 17 2 Eht , 18 2 Orokalaižed , 19 2 Ö (aig) , 20 2 Ul'čilaižed , 21 2 Laškuzlidn , 22 2 Jugalaižed , 23 1 MOS Technology 6502

mar 2013: 1 4 Venälaine literatur , 2 4 Kitai , 3 3 Merežkovskii Dmitrii , 4 3 Bad Boys Blue , 5 3 Heitämine (serial) , 6 2 Leningradalaine zoopuišt , 7 2 Obuhovan Kaičendan prospekt , 8 2 Hamid Abdul , 9 2 Klüjev Nikolai , 10 2 Antresol' , 11 2 Lindemann Till' , 12 2 C.E.B. Reas , 13 2 Zencov Roman , 14 2 C. C. Catch , 15 2 Ph. Patrikan päiv , 16 2 Buraka Som Sistema , 17 2 Vasil'jev Boris , 18 2 Kaks'nik (starin) , 19 2 Ižand Proharčin , 20 2 Vändai (roman) , 21 2 Voin i kožmuz , 22 2 Domostroi , 23 2 Adams Duglas , 24 2 Rahvahidenkeskeine naižiden päiv , 25 2 Dahno Vladimir

abr 2013: 1 3 Kel'tižed keled , 2 3 Kečuan kel' , 3 3 Šotlandijan kel' (kel'tine) , 4 2 Dirbal , 5 2 Puhtaz, ajatud , 6 2 Sekret Uspeha , 7 2 Birbincpühäpäiv , 8 2 Šizofrenii , 9 2 Depressii , 10 2 Sanskrit , 11 2 Ficdžeral'd Ella , 12 2 Nganasanan kel' , 13 2 Subway Surfers , 14 2 Cut the Rope , 15 2 Čukačun kel' , 16 2 Hüväd öd, čočod! , 17 2 Welcome to the Heartbreak Hotel , 18 2 Kirj , 19 2 Surman kel'dand , 20 2 Haki (kel'kund) , 21 2 Guaranin kel' , 22 2 Eiler Leonard , 23 2 Tuskaroran kel' , 24 2 I Can Lose My Heart Tonight , 25 2 Kombinacija

mai 2013: 1 3 Evrovizii-1956 , 2 3 Odess , 3 3 You're My Heart, You're My Soul , 4 3 Vepsän kel' , 5 3 Pil'ved , 6 2 Likutimveneh , 7 2 Kater , 8 2 Veneh , 9 2 You Shot a Hole In My Soul , 10 2 Hear What I Say , 11 2 Čistalöv Veniamin , 12 2 Azartvänd , 13 2 Diamonds , 14 2 Jankulov Stojan , 15 2 Sport , 16 2 Jumal , 17 2 Džakart , 18 2 I'm No Rockefeller , 19 2 One In a Million , 20 2 Good Guys Only Win in Movies , 21 2 Tilli Džennifer , 22 2 Kannad , 23 2 Vägestusen päiv , 24 2 Vepsän grammatik , 25 2 Kulič

jun 2013: 1 4 Moskv-Siti , 2 3 Kahtišti koumekümne koume , 3 3 Juhannus , 4 3 Mahfuz Nagib , 5 3 Psalmoiden kirj , 6 3 Lönnrot Elias , 7 3 Biblii , 8 2 Baltika (oludenkeituden kompanii) , 9 2 Hala , 10 2 Kall' (külä) , 11 2 Kobencl' Lüdvig fon , 12 2 Mišel' (pajatai) , 13 2 Rajan Petti , 14 2 Tullei , 15 2 Valendas , 16 2 Fasmer Maks , 17 2 Gar d'Aržikur P'jerrpon , 18 2 Optimal , 19 2 Virtanen Veikko , 20 2 Komiks , 21 2 Semönov Pötr , 22 2 Mompha edax , 23 2 Iče minä , 24 2 Marginal , 25 2 Eristalis intricarius

jul 2013: 1 3 Vepsän küläd , 2 3 Rand (külä, Vepsän rahvahaline küläkund) , 3 3 Reprua , 4 3 Latinan frazoiden nimikirjutez , 5 2 C. C. Catch:an pajod , 6 2 Keimada Grandi , 7 2 Sur' Sünd! Abuta minei jäda henghe kesked necidä surmarmastust , 8 2 Zanin Artöm , 9 2 Synodontis pardalis , 10 2 Ptychogena antarctica , 11 2 Dendrilla elegans , 12 2 Heteropoda shillongensis , 13 2 Slavine neopaganuz , 14 2 Tur de Frans , 15 2 I Will Survive , 16 2 Aksintant , 17 2 Süvärensu , 18 2 Gaudi Antonio , 19 2 Znamasižiden evrodiskoedestajiden nimikirjutez , 20 1 You Suffer

ago 2013: 1 2 Puerto Iguasu , 2 2 Ročilaine laud , 3 2 Ištui Härg , 4 2 Venä , 5 2 Kahesan nellikon identižuz , 6 2 Ruskedvauvaz vin , 7 2 Mail'manpän Sar' (ATOW1996) , 8 2 Niinistö Sauli , 9 2 Jufit Jevgenii , 10 2 Francijalaižiden fil'miden festival' Malagas , 11 2 Oksitanan kel' , 12 1 Änižen kanal

set 2013: 1 2 Gül'mamedov Dašgin , 2 2 Inkeriläižed , 3 2 Karr Sara Rouz , 4 2 Žirinovskii Vladimir , 5 2 Palatoi lugu , 6 2 Mec , 7 2 Secret Star , 8 2 I Can Lose My Heart Tonight '99 , 9 2 Kitai , 10 2 Haapsalu , 11 2 You're My Heart, You're My Soul , 12 2 Vepsän ülüz , 13 2 Saha Tazovaldkund , 14 2 Afganistan , 15 2 Možg , 16 2 Vepsän Vikipedii

out 2013: 1 2 Frigga pratensis , 2 2 Belisana strinatii , 3 2 Kelenmagii , 4 2 Nagriž , 5 2 Päč , 6 2 WASP-64 , 7 1 Boa

nov 2013: 1 3 Boršod Abaui Zemplen , 2 3 Eger (lidn) , 3 3 Heveš (agj) , 4 3 Mad'jaranman lidnad , 5 3 Japonii , 6 3 Muil , 7 3 Queen , 8 2 Jas Nad'kun Sol'nok , 9 2 Kapošvar , 10 2 D'jor , 11 2 Kečkemet , 12 2 Miškol'c , 13 2 Debrecen , 14 2 Bač Kiškun , 15 2 Pešt (agj) , 16 2 Sabol'č Satmar Bereg , 17 2 .hu , 18 2 31 (lugu) , 19 2 Tok-pisin

dez 2013: 1 4 Lindberg Čed , 2 4 Töröčik Mari , 3 3 Garipova Dina , 4 3 Blek Lukas , 5 3 Emi S'juzi , 6 3 Disnei Uolt , 7 3 Buše Viktor , 8 3 Uusberg Pärt , 9 3 Keil (lidn) , 10 3 Vas (lidn) , 11 3 Laht (lidn) , 12 3 Mad'jaranman agjad , 13 3 Peč , 14 3 Ferland Džodel' , 15 2 Itson Meri Ellen , 16 2 Volčkov Sergei Valer'jevič , 17 2 Golos , 18 2 Holodnaja Vera , 19 2 Kalašnikov Mihail , 20 2 Džerri (fil'm) , 21 2 Pekuin Anna , 22 2 Roman Pol , 23 2 Jakobi Doreen , 24 2 De Montema Damian , 25 2 Vepsläižen kodin südäin

jan 2014: 1 3 Moskv-Siti , 2 2 Karlton Lending , 3 2 Zell' , 4 2 Uorhol Endi , 5 2 Silence , 6 2 Unborn Love , 7 2 Rait Frenk Lloid , 8 2 Le Korbüz'je , 9 2 Dürer Al'breht , 10 2 Dvoržak Antonin , 11 2 Goja Fransisko , 12 2 Rubens Piter , 13 2 Umbrine škol , 14 2 Rafael' Santi , 15 2 Tverin agj , 16 2 Lendai alamalaine , 17 2 Anomalii , 18 2 Mägi , 19 2 Kalo Frida , 20 2 Protistad , 21 2 Muiktuz , 22 2 Himine ühtnend , 23 2 Biohimii , 24 2 Himii , 25 2 Need for Speed: Pigusen himo

fev 2014: 1 2 Armastusen tippud , 2 2 Heimolaižuz , 3 2 Mumbai , 4 2 Indijan štatad da territorijad , 5 2 Nothing Stands In Our Way , 6 2 Hameleonad (serial) , 7 2 Lapsed (serial, Brazilii, 2013) , 8 2 Brazilii-kolledž , 9 2 Satatadud südäikerad , 10 2 Japonine kanang , 11 2 Karusel' (serial, Brazilii, 2012) , 12 2 Vn 2014 Tal'volimpiadan lopmižed , 13 2 Laos , 14 2 Kudentoštkümnen nellikon identižuz

mar 2014: 1 2 Kall'oikahad mäged , 2 2 Bangalor , 3 2 Kriman Avtonomine Tazovaldkund , 4 2 Korejan Tazovaldkund , 5 2 Čennai , 6 2 So , 7 2 Maim , 8 2 Need for Speed: Pigusen himo , 9 2 Vepsän küläd , 10 2 Bass Sol , 11 2 Venesuel , 12 2 Uz' Zelandii , 13 2 Avstralii (valdkund) , 14 2 Arhangel'sk , 15 2 Nikaragua (valdkund) , 16 2 Igark , 17 2 Suviamerik , 18 1 Česmen jumalanpert'

abr 2014: 1 3 Urugvai , 2 3 The Doors , 3 3 Voihein , 4 2 Sevastopol' , 5 2 Feodosii , 6 2 Nellikod (kartankarv) , 7 2 Džomolungm , 8 2 Venäman federaližed ümbrikod , 9 2 Suviafrikan Tazovaldkund , 10 2 Kilimandžaro , 11 2 Sabett , 12 2 Nencan kel' , 13 2 Jumalanbembel' , 14 2 Vederistmad , 15 2 Grand Theft Auto: San Andreas , 16 2 Buenos Aires , 17 2 Hristanuskond , 18 1 Koktebel'

mai 2014: 1 3 Luganskan Rahvahaline Tazovaldkund , 2 3 Ukrain , 3 2 Suomenkel'ne Vikipedii , 4 2 Jun Hen Sik , 5 2 Seong Dže-gi , 6 2 Marijampole , 7 2 Varghuz (lidn) , 8 2 Lund , 9 2 Viborg (Danii) , 10 2 Kriman Avtonomine Tazovaldkund , 11 2 Eupithecia turpis , 12 2 Takkiž , 13 2 Kislovodsk , 14 2 Mail'man valdkundad , 15 2 Rostov Donal , 16 2 Tallidn , 17 2 Suomenma , 18 1 Deborra-Li Förness

jun 2014: 1 2 Katar , 2 2 Malaizii , 3 2 Mongolii , 4 2 Tailand , 5 2 Tadžikistan , 6 2 Kano , 7 2 Tokio , 8 2 Tün' valdmeri , 9 2 Sevastopol' , 10 2 Džeronimo , 11 2 Öhabuk , 12 2 Ortodoksine hristanuskond , 13 2 Atlantine valdmeri , 14 1 In Čžen

jul 2014: 1 2 Egipt , 2 2 Sudan , 3 2 33 (lugu) , 4 2 Uusberg Pärt , 5 2 Novodvorskaja Valerija , 6 1 Ceilon

ago 2014: 1 4 Marilaine veroline religii , 2 3 Saba Isak , 3 3 Master i Margarita , 4 3 Kodima , 5 2 Kostarik , 6 2 Sur' Munamägi , 7 2 Vil'jandi , 8 2 Sudan , 9 2 Moskvan prospekt (Piter) , 10 2 Dakk , 11 2 Nikaragua (znamoičendad) , 12 2 Viluku , 13 1 Madagaskar (valdkund)

set 2014: 1 3 Paragvai , 2 3 Ugand , 3 3 Canada , 4 3 Coca-Cola , 5 2 Järgeline pölvaz , 6 2 Kekkonen Urho , 7 2 Koivisto Mauno , 8 2 Hel'singfors , 9 2 Senegal , 10 2 Kamerun , 11 2 Bolivii , 12 2 Nauru , 13 2 Ternopol' , 14 1 Paragvain Tazovaldkund

out 2014: 1 2 Bol , 2 2 Abai (znamoičendad) , 3 2 Abai , 4 2 Al'tamir (mägionduz) , 5 2 Indonezii , 6 2 Antigua da Barbud , 7 2 Pol'šanma , 8 1 Abazilaižed

nov 2014: 1 2 Kanoe Pessespäi , 2 2 Baženov Timofei , 3 2 Baženovan reiting , 4 2 Strub , 5 2 Lobez (lidn) , 6 2 Pöud (maižanduz) , 7 2 Pöud , 8 2 Marilaižiden tradicionaline uskond , 9 2 Tadžikistan , 10 1 Karbaz

dez 2014: 1 3 Lobez (lidn) , 2 2 Igor' Strelkov , 3 2 Gladius , 4 2 Pavlodar , 5 1 Vologdan pörutügitegim

jan 2015: 1 3 Reigan Ronal'd , 2 3 NGC 217 , 3 3 NGC 239 , 4 3 NGC 244 , 5 2 Sal'vador , 6 2 Germanii (znamoičendad) , 7 2 NGC 171 , 8 1 Suksed

fev 2015: 1 3 Modaižed sobad , 2 2 Gvinei Bisau , 3 2 Afrikan valdkundad , 4 2 Pakistan , 5 2 Heitämine (serial) , 6 2 Säs' , 7 2 Ukrain , 8 1 Grekanman Tazovaldkund

mar 2015: 1 3 Urugvai , 2 3 Sithine kuz' , 3 2 Hanko , 4 2 Uusikaupunki , 5 1 Hangö

abr 2015: 1 4 Amerikan Ühtenzoittud Valdkundad , 2 3 Lepai , 3 3 Damask , 4 3 Odess , 5 3 Vagolind , 6 3 Gorodovikovsk , 7 3 Lipeck , 8 3 Venäma , 9 3 Händikaz , 10 2 Sestrikaine , 11 2 Douson Doris , 12 2 Bridgetown , 13 2 Bridžtaun (lidn, Barbados) , 14 2 Thimphu , 15 2 Lohi , 16 2 Butan , 17 2 Naip'jido , 18 2 Pasklindud , 19 2 Džordžtaun , 20 2 Bogota , 21 2 Džordžtaun (Gajan) , 22 2 Ottav , 23 2 Dušanbe , 24 2 Ulanbatar , 25 2 Katmandu

mai 2015: 1 3 Baotou , 2 3 Valans'jen , 3 3 Klivlend , 4 3 Enn Arbor (Mičigan) , 5 3 Läojuan' , 6 3 Nagoi , 7 3 Brazzavil' , 8 3 Dakar , 9 3 Painmižpästandoiden nimikirjutez materialoidenke vepsän kelel , 10 3 Los Andželes , 11 3 Gajan , 12 3 Neue Deutsche Härte , 13 3 Kizlär , 14 3 Izberbaš , 15 3 Varšav , 16 2 Tuluz , 17 2 Fort Loderdeil , 18 2 Čikago , 19 2 Milan , 20 2 Florencii , 21 2 Šäuläi , 22 2 Panevežis , 23 2 Elgav , 24 2 Sillamäe , 25 2 Kohtla-Järve

jun 2015: 1 3 Lobez (lidn) , 2 3 Trpin' , 3 3 Zelöna Gur , 4 2 Lüneburg , 5 2 Fell'bah , 6 2 Džidd , 7 2 Štuttgart , 8 2 Sanderlend , 9 2 Sanderlend (Anglii) , 10 2 Grenobl' , 11 2 Ekseter , 12 2 Hanau , 13 2 Kassel' , 14 2 Beliz (lidn) , 15 2 Remedios (Kuba) , 16 2 Sidzuok , 17 2 Piterboro (Ontario) , 18 2 Vik (Saksanma) , 19 2 Jan'tai , 20 2 Batum , 21 2 Cincinnati , 22 2 Parm , 23 2 Sekuen' , 24 2 Subotic , 25 2 Toledo (Ogajo)

jul 2015: 1 3 Ngerulmud , 2 3 Tbilis , 3 3 Danii , 4 2 Saratamat , 5 2 Lakatoro , 6 2 Isangel , 7 2 Luganvill , 8 2 Sol (Vanuatu) , 9 2 Sjudad de la Kost , 10 2 Alei , 11 2 Sidon , 12 2 Zahle , 13 2 Tripoli (Livan) , 14 2 Galle , 15 2 Margilan , 16 2 Kokand , 17 2 Fergan , 18 2 Namangan , 19 2 El' Ain , 20 2 Kordov , 21 2 Rosario , 22 2 Mary , 23 2 Jangon , 24 2 Haidarabad , 25 2 Ahmedabad

ago 2015: 1 3 Federativižed Mikronezijan Valdkundad , 2 3 Al'met'jevsk , 3 3 Soči , 4 2 Hag , 5 2 Gorna Orähovic , 6 2 Sent Pol Kapister , 7 2 Kuritib , 8 2 Nasinu , 9 2 Koimbr , 10 2 Kuala Lumpur , 11 2 Regimägi , 12 2 Split , 13 2 Madagaskar , 14 2 Šrilank , 15 2 Nigerii , 16 2 Indii , 17 2 Sahar (produkt) , 18 2 Vitegr , 19 2 Ustüžn , 20 2 Sur' Ustüg , 21 2 Kirillov , 22 2 Belozersk , 23 2 Babajevo , 24 2 Vologdan agjan lidnad , 25 2 Surovikino (lidn)

set 2015: 1 3 Coca-Cola , 2 2 Fareran Sared , 3 2 Dubovk , 4 2 Gorohovec , 5 2 Kiržač , 6 2 Kameškovo , 7 2 Jur'jev Pol'skii , 8 2 Aleksandrov (lidn) , 9 2 Fokino (Bränskan agj) , 10 2 Birüč , 11 2 Aleksejevk , 12 2 Narimanov , 13 2 Harabali , 14 2 Znamensk (Astrahanin agj) , 15 2 Ahtubinsk , 16 2 Belogorsk (Amuran agj) , 17 2 Bikin , 18 2 Amursk , 19 2 Budönnovsk , 20 2 Blagodarnii , 21 2 Sur' Kivi , 22 2 Spassk Dal'nii , 23 2 Nahotk , 24 2 Lesozavodsk , 25 2 Fokino (Merenrandaline rand)

out 2015: 1 3 Murasaki Sikibu , 2 3 Togo , 3 3 Kanad , 4 2 Rankagua , 5 2 Pnompen' , 6 2 Karakas , 7 2 Nepal , 8 2 Gvatemal , 9 2 Avstralii , 10 2 Peru , 11 2 Korejan Tazovaldkund , 12 2 Debrecen , 13 2 Kos'kenaluine , 14 2 Džamunan sild , 15 2 Bangladeš , 16 2 Facebook , 17 1 Feisbuk

nov 2015: 1 4 Kito , 2 4 Gvinei-Bisau , 3 2 Rävan (futbolklub) , 4 2 Käpaz (futbolklub) , 5 2 Sumgait (futbolklub) , 6 2 Zirä (futbolklub) , 7 2 Samarkand , 8 2 Nepal , 9 2 Ekvador , 10 2 Uoker Pol , 11 1 Jokoham

dez 2015: 1 3 Lugansk , 2 3 Doneck , 3 3 Kirjišt , 4 3 Lavrov Sergei , 5 3 Golos , 6 3 Makri Maurisio , 7 3 Ukrain , 8 3 Moskv , 9 2 Armastuz , 10 2 Poklonskaja Natal'ja , 11 2 Gerakl , 12 2 Apollon , 13 2 Itigran , 14 2 Gera , 15 2 Pharaoh , 16 2 Šoigu Sergei , 17 2 Gribojedovan kanal , 18 2 Satanovskii Jevgenii , 19 2 Barle , 20 2 Magadanan agj , 21 2 Mad'jaran kel' , 22 2 Lobez (lidn) , 23 2 Luganskan Rahvahaline Tazovaldkund , 24 2 Doneckan Rahvahaline Tazovaldkund , 25 2 Malindpeza (zamk)

jan 2016: 1 2 Ukrainan Rahvahaline Ühtištuz , 2 2 Suomenkel'ne Vikipedii , 3 2 Gal'špah , 4 2 Ižoran Vikipedii , 5 2 Lumenšur , 6 2 Livin Vikipedii , 7 2 Komin Vikipedii , 8 2 Udmurtan Vikipedii , 9 2 Venäkel'ne Vikipedii , 10 2 Kivi Obil , 11 2 Paksjogi , 12 2 Vepsän Vikipedii , 13 2 Kol , 14 2 Varšav , 15 2 Putin Vladimir , 16 1 Ciolkovskii (lidn)

fev 2016: 1 3 Bahmut , 2 2 Artömovsk (Doneckan agj) , 3 2 Ivanovon agj , 4 2 Muiktuz , 5 2 Himine ühtnend , 6 2 Mir , 7 2 Venälaižen valdkundan pämehed , 8 2 Päiväižen sistem , 9 2 Krasnoje Selo , 10 1 Aldan

mar 2016: 1 3 Kračkovskaja Natal'ja , 2 2 Ukrainan Rahvahaline Ühtištuz , 3 2 Astrahanin agj , 4 2 Užgorod , 5 2 Kremenčuk , 6 2 Lunkin Vitalii , 7 2 Venälaižen keitandan sömižiden nimikirjutez , 8 2 Kudrovo (Leningradan agj) , 9 2 Demidovan sild , 10 2 Trpin' , 11 2 Uz' Okkervil' , 12 2 Venäma Evrovizijal , 13 2 Zanevk , 14 2 Alauz'lidn , 15 2 Kallio Küösti , 16 2 Štol'berg Kaarlo Juho , 17 2 Latvii , 18 1 606 (kodiden serii)

abr 2016: 1 2 Nühaidai , 2 2 , 3 2 8. reduku , 4 2 Krestovskii-stadion , 5 1 Futboline stadion Krestovskii-saren päivlaskmpol'žes palas

mai 2016: 1 4 Dnepropetrovsk , 2 3 Varn (lidn) , 3 3 Bugul'm , 4 3 Murmansk , 5 3 Čeboksarad , 6 3 Ulan Ude , 7 3 Moskv , 8 3 Joškar-Ol , 9 3 Elist , 10 2 Čilin valdkundznam , 11 2 Čilin flag , 12 2 Bilibino , 13 2 Elefantanvuiččed , 14 2 Pavlov Igor' , 15 2 Kaimol , 16 2 Vepsän mec , 17 2 Šugar'v , 18 2 Kamizäk , 19 2 Jeisk , 20 2 Anadir' , 21 2 Jaroslavl' , 22 2 Tümen' , 23 2 Tul , 24 2 Tomsk , 25 2 Rostov Donal

jun 2016: 1 3 Dnepropetrovsk , 2 3 Radajad lähttas \"Lümjer\"-fabrikaspäi , 3 3 Vologd , 4 3 Ukrain , 5 3 Kijev , 6 2 Gagarin (Smolenskan agj) , 7 2 Isil'kul' , 8 2 Tükalinsk , 9 2 Oblučje , 10 2 Pevek , 11 2 Dimitrovgrad (Venäma) , 12 2 Bariš (lidn) , 13 2 Berözovskii (Sverdlovskan agj) , 14 2 Artömovskii , 15 2 Asbest (lidn) , 16 2 Alapajevsk , 17 2 Aramil' , 18 2 Simferopol' , 19 2 De Agostini , 20 2 Lisičansk , 21 2 Lermontov (lidn) , 22 2 Kizlär , 23 2 Tomsk , 24 2 Kirov , 25 2 Kemerovo

jul 2016: 1 4 Aleksandr Maršal , 2 3 Ani Lorak , 3 3 Jegor Krid , 4 3 Nüša , 5 3 1984 , 6 3 Preslava , 7 3 Kirkorov Filipp , 8 3 Leont'jev Valerii , 9 2 Meladze Valerii , 10 2 Timur Rodrigez , 11 2 Dobrič , 12 2 1949 , 13 2 1967 , 14 2 1956 , 15 2 Noskov Nikolai , 16 2 Gagarin (Smolenskan agj) , 17 2 Bilibino , 18 2 Zaharova Marija , 19 2 Elgav , 20 2 Jurmal , 21 2 Alušt , 22 2 Venälaižen keitandan sömižiden nimikirjutez , 23 2 Loks , 24 2 Serafimovič , 25 2 Suraž

ago 2016: 1 4 Noskov Nikolai , 2 3 Sendak Moris , 3 3 Serbin (Tehas) , 4 3 Petuhov Anatolii , 5 2 Vorsm , 6 2 Tar (lidn) , 7 2 Paragvai , 8 2 Peru , 9 2 Pugačova Alla , 10 2 Šotlandii , 11 2 Savičeva Julija , 12 1 Dišu tišinoi

set 2016: 1 2 For You , 2 2 DruGoy , 3 2 Vibirat' čudo , 4 2 Dišu tišinoi , 5 2 Paranoja (al'bom) , 6 2 Po pojas v nebe , 7 2 Blaž , 8 2 Meladze Valerii , 9 2 Aleksandr Maršal , 10 2 Noskov Nikolai , 11 2 Dnepropetrovsk , 12 1 Šeksn (Šeksnan rajon)

out 2016: 1 2 1965 , 2 2 VIA Gra , 3 2 Ani Lorak , 4 2 Seišelan Sared , 5 2 Tova Mageina , 6 2 Bateti , 7 2 Moskv-Siti , 8 2 Estinma

nov 2016: 1 2 Čelentano Adriano , 2 2 Gott Karel , 3 2 Han Šahruh , 4 2 Douson Doris , 5 2 Lindemann Till' , 6 2 YouTube , 7 2 Kropyvnytsky , 8 2 Moldov , 9 2 Bolgarii , 10 1 Sergei Mihejev

dez 2016: 1 2 Lugansk , 2 2 Uz' Devätkino , 3 2 Litvanma , 4 2 Mustmägi , 5 2 Bosnii da Gercegovin , 6 1 Jen

jan 2017: 1 2 Phumipon Adul'jadet , 2 2 Koumanden planetan peituz , 3 2 Kosmine Harlok-merirazbainik (fil'm) , 4 2 Tel' Aviv , 5 2 Marsel' , 6 1 Hufun piramid

fev 2017: 1 2 Pušilin Denis , 2 2 Marakai , 3 2 Tokio , 4 2 Nitrugižbobaine , 5 2 Kropyvnytsky , 6 2 Pohjoižosetijan — Alanijan Tazovaldkund , 7 2 Afganistanan valdkundznam , 8 2 Siktivkar , 9 1 Vjetnaman Vikipedii

mar 2017: 1 2 Gakt , 2 2 Kriman Avtonomine Tazovaldkund , 3 2 Franklin Rozalind , 4 2 Severodvinsk , 5 1 Nikolai Drozdov

abr 2017: 1 4 Azii , 2 3 Evrop , 3 2 Sasmi Angun Čipta , 4 2 Devgan Adžai , 5 2 Kan Son , 6 2 Šiprage , 7 2 Bel'mondo Žan Pol' , 8 2 Pettis Kaillu , 9 2 Bhatt Alija , 10 2 Aleksandr Maršal , 11 2 Kremenčuk , 12 2 Cin' Šihuandi , 13 2 Bahčisarai , 14 2 Franklin Rozalind , 15 2 Alöna Mun , 16 2 Sennheiser , 17 2 Adams Duglas , 18 2 Al'gardi Mikelandželo , 19 2 Oreo , 20 2 Bolen Diter , 21 2 Balabanov Aleksei , 22 2 Ahmatova Anna , 23 2 Beriša Sali , 24 2 Tatarstanan Tazovaldkund , 25 2 Venäman Tazovaldkundad

mai 2017: 1 2 Sobral Salvador , 2 2 Napoleon I Bonapart , 3 2 Gai Julii Cezar' , 4 2 Dikkens Čarl'z , 5 2 Phumipon Adul'jadet , 6 2 Satanovskii Jevgenii , 7 2 Murasaki Sikibu , 8 2 Aslino Fransua , 9 2 Samoilova Tat'jana , 10 2 Demidov Ivan (pokervändai) , 11 2 Uorhol Endi , 12 2 Dali Sal'vador , 13 2 Dvoržak Antonin , 14 2 Disnei Uolt , 15 2 Savant Merilin vos , 16 2 Franklin Rozalind , 17 2 Sendak Moris , 18 2 Fasmer Maks , 19 2 Semönov Pötr , 20 2 Petri Julius Rihard , 21 2 Vernadskii Vladimir , 22 2 Merežkovskii Dmitrii , 23 2 Dahno Vladimir , 24 2 Čaves Ugo , 25 2 Štil'mark Robert

jun 2017: 1 3 Šiprage , 2 2 Kirovograd , 3 2 Rube , 4 2 Vestonicen Vener , 5 2 Ukrainan Vikipedii , 6 2 Kondjanbol , 7 2 Kropyvnytsky , 8 2 Anglii , 9 2 Santa Marija Podžo , 10 2 Alamad , 11 1 Themin

jul 2017: 1 2 Kara , 2 2 Leps Grigorii , 3 2 Makron Emmanuel' , 4 2 VIA Gra , 5 2 Doneck , 6 2 Ekseter , 7 2 Peipusjärv , 8 2 Omsk , 9 2 Brüssel' , 10 1 .ba

ago 2017: 1 7 Lugansk , 2 7 Doneck , 3 2 Maidanov Denis , 4 2 Poklonskaja Natal'ja , 5 2 Vičenc , 6 1 Vasilii Livanov

set 2017: 1 6 Thejön Kim , 2 2 Vas'kov Miku , 3 2 Aigan irdpoles , 4 2 Vavilonii , 5 2 Čon Džessika , 6 2 Peru , 7 2 Užur , 8 1 Miku Vas'kov

out 2017: 1 3 Evrejan kel' , 2 2 Aig armastada , 3 2 Tegendad päzutandha näht , 4 2 Makati , 5 2 Vepsän kel' , 6 1 Tempo de Amar

nov 2017: 1 2 Litmanen Jari , 2 2 Nimidä ei jä mugoman-žo , 3 2 Angelan mod (Brazilijan TV-serial, 2016) , 4 2 Sestrikaine , 5 2 Zimbabve , 6 2 Niinistö Sauli , 7 1 Jari Litmanen

Wikipedias are initially ordered by number of speakers of the language

Speakers: Number of speakers of a language is the estimated total of primary and secondary speakers, is in many cases a very rough estimation (based on the page on the English Wikipedia about that language)
Regions are parts of the world where the language is spoken in substantial amounts (compared to total number of speakers). Regions where a language gained presence only by a recent diaspora are generally not included.
Region codes: AF:Africa, AS:Asia, EU:Europe, NA:North America, OC:Oceania, SA:South America, W:World Wide, CL:Constructed Language

Estatísticas geradas em Segunda-feira, 18 de dezembro 2017 17:28

Dump file vepwiki-20171201-stub-meta-history.xml.gz (edits only), size 6.4 Mb as gz -> 44 Mb
Dump processed till Nov 30, 2017, on server stat1005, ready at Fri-08/12/2017-14:09 after 45 sec.

Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### =
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.