Estatísticas da Wikipédia vepsian

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Articles per size range / Records per namespace / Most edited articles / Zeitgeist
 
  Dec 2017: WMF Analytics Team is happy to announce the first release of Wikistats 2
  

  Wikistats has been redesigned for architectural simplicity, faster data processing, and a more dynamic and interactive user experience. The data used in the reports will also be made available for external processing.  

  First goal is to match the numbers of the current system, and to provide the most important reports, as decided by the Wikistats community (see survey).  
  Over time, we will continue to migrate reports and add new ones that you find useful. We can also analyze the data in new and interesting ways, and look forward to hearing your feedback and suggestions.  

  You can go directly to Wikipedia vepsian

  

Most metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.

Some metrics have been collected from the full archive dump which runs on lower frequency than the usual monthly cycle.
These metrics are columns F,I,J,K,M,N,O,P,Q,R from the first table.


See also metrics definitions


 
Monthly counts & Quarterly rankings: março 2018
 
DataWikipedistasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
mar 20180%   0%      +55%      +1%
fev 20180%   0%      -1%      0%
jan 20180%   0%      -38%      0%
dez 2017+1%   +1%      +37%      +1%
nov 20170%   0%      +17%      +1%
out 20170%   0%      -40%      +1%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P____Q____R____S__
mar 201873 215,7 k  12,2   547      2,8 k
fev 201873 315,7 k  12,1   353      2,7 k
jan 201873 215,7 k  12,1   357      2,7 k
dez 2017731315,7 k 112   574      2,7 k
nov 201772 215,6 k  12   418      2,7 k
out 201772 215,6 k  11,9   357      2,7 k
set 2017721215,6 k  11,9   596      2,7 k
ago 2017714415,6 k 111,8   995      2,6 k
jul 2017671115,6 k 211,7   1,3 k      2,6 k
jun 2017662315,5 k 111,5   1,3 k      2,6 k
mai 201764 325,5 k 211,4   1,3 k      2,5 k
abr 201764 415,4 k 211,3   1,5 k      2,5 k
mar 201764 115,4 k 111,1   1,0 k      2,4 k
fev 201764 115,3 k 111   647      2,3 k
jan 201764 115,3 k 210,9   804      2,3 k
dez 201664 215,3 k 210,9   1,0 k      2,2 k
nov 201664 315,2 k  10,8   376      2,2 k
out 2016641215,2 k  10,8   286      2,2 k
set 201663 215,2 k 110,8   334      2,2 k
ago 201663 315,1 k  10,8   381      2,1 k
jul 2016632525,1 k 110,7   743      2,1 k
jun 201661 315,1 k 110,6   853      2,1 k
mai 2016611315,1 k 110,5   527      2,1 k
abr 201660 3 5,0 k  10,5   126      2,1 k
mar 2016602415,0 k  10,4   375      2,1 k
fev 201658 215,0 k  10,4   411      2,1 k
jan 201658 315,0 k 110,3   330      2,0 k
dez 201558 425,0 k 110,3   487      2,0 k
nov 2015581515,0 k 110,3   487      2,0 k
out 2015571414,9 k 110,3   325      2,0 k
set 201556 214,9 k 310,2   1,2 k      2,0 k
ago 2015561524,8 k 210,2   953      2,0 k
jul 201555 324,7 k 810,1   1,4 k      1,9 k
jun 2015551324,5 k 610,3   1,0 k      1,7 k
mai 201554 524,3 k 310,5   879      1,5 k
abr 2015543514,2 k 210,5   555      1,3 k
mar 201551 214,2 k 110,5   241      1,2 k
fev 201551 214,2 k 110,6   310      1,2 k
jan 201551 314,1 k 110,6   201      1,2 k
dez 201451 2 4,1 k  10,6   76      1,1 k
nov 201451 3 4,1 k 110,6   145      1,1 k
out 201451 2 4,1 k  10,6   155      1,1 k
set 201451 314,1 k 110,6   226      1,1 k
ago 2014511414,0 k 110,6   390      1,1 k
jul 201450 214,0 k 110,5   183      1,0 k
jun 20145015 4,0 k 110,5   235      1,0 k
mai 201449 214,0 k 110,6   402      984
abr 201449 323,9 k 210,6   482      964
mar 201449 423,9 k 110,6   610      933
fev 201449 413,8 k2,1 k110,644521%3%2912,6 Mb228 k23 k1361921,0 k919
jan 201449 413,8 k2,1 k210,644121%3%7452,6 Mb224 k23 k137192996902
dez 2013491723,7 k2,0 k310,543120%3%8512,5 Mb216 k22 k172191975863
nov 2013482713,7 k1,9 k210,642119%3%3012,3 Mb206 k21 k175190938817
out 201346 313,6 k1,9 k210,641419%3%3302,3 Mb201 k20 k176184933806
set 201346 4 3,5 k1,8 k110,741519%3%2112,2 Mb197 k20 k175184917793
ago 201346 313,5 k1,8 k210,741319%3%2112,2 Mb195 k20 k168182913784
jul 201346 413,5 k1,8 k210,841319%3%3822,2 Mb193 k19 k205182910770
jun 2013461423,4 k1,7 k410,941118%3%6322,1 Mb188 k19 k215181895744
mai 201345 423,3 k1,6 k311,140518%3%5622,1 Mb179 k18 k281179873676
abr 201345 423,2 k1,6 k611,239918%3%8682,0 Mb171 k17 k376181791657
mar 201345 623,0 k1,5 k411,640118%3%3,8 k1,9 Mb163 k16 k1,3 k181747627
fev 201345 412,9 k1,4 k310,739719%3%1,5 k5,0 Mb156 k15 k134 k179713597
jan 201345 512,8 k1,4 k310,540019%3%1,6 k4,9 Mb153 k14 k131 k187704580
dez 2012453622,8 k1,3 k810,240319%3%2,4 k4,8 Mb149 k14 k128 k200691567
nov 2012422722,5 k1,3 k910,241720%3%2,3 k4,5 Mb141 k13 k119 k220637513
out 20124041022,2 k1,1 k610,442421%3%2,5 k4,2 Mb128 k11 k112 k241559447
set 2012361632,0 k969610,241820%3%3,3 k3,8 Mb114 k9,5 k104 k259486381
ago 201235 711,9 k85829,441020%3%1,3 k3,5 Mb102 k7,6 k98 k371399312
jul 201235 421,8 k81329,140520%3%1,4 k3,4 Mb97 k7,1 k95 k433366291
jun 2012351641,7 k784158,639920%3%2,9 k3,3 Mb93 k6,6 k93 k535376272
mai 2012342831,3 k681159,244924%4%2,0 k2,6 Mb78 k5,2 k75 k718311162
abr 20123225183657331256332%5%8662,1 Mb64 k3,8 k60 k768203133
mar 20123027175951031255030%5%1,0 k2,0 Mb57 k3,2 k55 k837154108
fev 2012283123665442312,256932%6%2,5 k1,8 Mb52 k2,8 k50 k94914596
jan 201225 4158638229,558233%6%2311,6 Mb47 k2,5 k46 k87412185
dez 20112516253533741058632%7%6331,5 Mb44 k2,3 k42 k80812168
nov 201124 51416256 11,360537%7%5811,2 Mb35 k2,0 k33 k56410953
out 201124121403252 10,361737%7%2201,2 Mb35 k1,9 k31 k55211050
set 20112327 395251 9,962838%8%1211,2 Mb35 k1,9 k30 k54810950
ago 20112157 38523819,861438%7%1731,1 Mb33 k1,9 k30 k52010446
jul 201116 11367220 9,959837%7%1251,1 Mb31 k1,8 k29 k5099546
jun 20111614 367215 9,553734%5%871,1 Mb28 k1,6 k29 k5127045
mai 201115 6 363210 9,453734%6%2671,1 Mb27 k1,6 k29 k5116945
abr 201115 5 361208 8,753433%6%1111,0 Mb27 k1,6 k28 k5066845
mar 201115 8235720218,550631%5%3121,0 Mb25 k1,5 k28 k5006145
fev 201115 61336185 8,145729%4%298947 kb22 k1,2 k26 k4683722
jan 20111514232917727,341927%4%622917 kb20 k1,1 k26 k4593017
dez 201014251264106 6,838020%5%214642 kb14 k95618 k3012112
nov 201012342257105 6,242121%5%297477 kb15 k89211 k2952012
out 20109   24596 5,235020%4% 260 kb12 k7824,4 k2561212
set 20109   24596 5,235020%4% 260 kb12 k7824,4 k2561212
ago 20109   24596 5,235020%4%3260 kb12 k7824,4 k2561212
jul 20109   24496 5,335120%4%7260 kb12 k7804,4 k2551212
jun 20109   24496 5,235120%4% 260 kb12 k7804,4 k2551212
mai 20109   24496 5,235120%4%5260 kb12 k7794,4 k2551212
abr 20109   24194 5,335020%4%2257 kb12 k7524,4 k2511212
mar 2010922124194 5,335020%4%168257 kb12 k7524,4 k2521212
fev 20107   23790 4,636020%4%4224 kb12 k1983,5 k247811
jan 20107   23790 4,636020%4%2224 kb12 k1983,5 k247811
dez 20097 1 23790 4,636020%4%74224 kb12 k1983,5 k246811
nov 20097 112379014,336020%4%201222 kb12 k1983,5 k246811
out 20097 112156823,828913%3%149190 kb9,2 k1793,4 k172811
set 2009712 1655414,130211%4%133163 kb7,1 k1853,3 k8588
ago 20096 1 14436 3,727410%3%692 kb5,6 k931,4 k6824
jul 20096 1 14335 3,727510%3%1491 kb5,5 k931,4 k6724
jun 20096   14132 3,726911%3% 88 kb5,3 k691,3 k6524
mai 20096   14132 3,726911%3% 88 kb5,3 k691,3 k6524
abr 2009612 14132 3,726911%3%1388 kb5,3 k691,3 k6524
mar 2009513 14030 3,625710%3%2886 kb5,1 k451,3 k6224
fev 20094 2 13528 3,525510%3%3785 kb5,0 k411,3 k6324
jan 200942411222223,62268%2%27977 kb4,1 k301,3 k6024
dez 20082 2 503 3,21334%2%1220 kb1,1 k1135516 3
nov 20082   483 3,11324%2% 16 kb1,0 k724714 3
out 20082   483 3,11324%2% 16 kb1,0 k724714 3
set 20082   483 3,11324%2% 16 kb1,0 k724714 3
ago 20082   483 3,11324%2% 16 kb1,0 k724714 3
jul 20082 1 483 3,11324%2%716 kb1,0 k724714 3
jun 20082   423 3,41465%2% 15 kb99272418 3
mai 20082 1 42313,41465%2%4215 kb99272418 3
abr 20082 2 213 4,724110%5%1510 kb88571192 3
mar 20082 1 172 4,91636% 225,1 kb4874161 3
fev 2008221 142 4,41827% 624,3 kb4592141 3
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
The following table ranks this project in relation to projects in other languages with 1000+ articles
jan 2018172 177140165  200   137      277
out 2017168 175138165  200   132      277
jul 2017179130214136164 122201   106      277
abr 2017181 134136165 118208   95      277
jan 2017178 192133164 122211   113      277
out 2016175136170128163  210   138      277
jul 2016173101125103160 136210   112      277
abr 2016177 144 160  210   160      277
jan 2016179 158139160 149209   139      277
out 2015179130145135160 143210   139      277
jul 2015179 152102159 72212   96      277
abr 201517995130143163 124208   125      277
jan 2015180 147139164 148207   159      277
out 2014178 172 163  209   152      277
jul 2014178 161132164 145207   152      277
abr 2014177 161104162 120204   119      277
jan 2014174174136136159174123203204197197114198195181227236189277
out 2013174167152121160174113204206201198125202197184227236192277
jul 2013170145133130160175113204205201200127202197184226237190277
abr 201317315314310816618087200207201199130204203187210234192277
jan 2013170151124136170182109204202196195157197206187174232196277
out 2012173769410218218684202199193192128202210193178223202277
jul 2012186146140107190197116205198193190165207215212186202210277
abr 2012186104123135219207108215214213210195219231229204170225277
jan 2012201161140132226218118214213212209240226236239213165233277
out 2011202133170137234229164213212211208248232239239227186231277
jul 2011232160196129233231167210209208205259233238238225184236277
abr 2011235152128136231228162204203202199258232236239222183244277
jan 2011233134137100234231117202201200197213240241240220187257277
out 2010247157225135237235157194193192190274253246243255207262277
jul 2010244169236144235235160190189188186273252243240253205260277
abr 2010242156219142230230161187186185184273248242239249198258277
jan 2010252150215134229230156184184183182269249241254254200261277
out 2009248150197127225235118182182181180233250245256250212261277
jul 2009249197187137233244152175175174173260258254262260235266277
abr 2009247126170147231244147172172171170262256250259259232263277
jan 200925694126122233247117167167166165209256251267257232262276
out 2008267143210137247266147161161160159268264262268262259266274
jul 2008262156194135241262150155155154152260261259267261254265273
abr 2008260152166133254261154150150148146254262259266261261263273
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
 WikipedistasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikipedistas (usuários registrados)
A = Wikipedistas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikipedistas que editaram pelo menos dez vezes desde que chegaram
C = Wikipedistas que contribuíram cinco vezes ou mais este mês
D = Wikipedistas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Artigos que contêm pelo menos uma ligação interna e 200 caracteres de texto legível, não contando códigos wiki e html,
      ligações ocultas, etc.; títulos também não contam (outras colunas são baseadas no método oficial de contagem)
G = Novos artigos por dia no mês passado
H = Número médio de revisões por artigo
I = Tamanho médio dos artigos em bytes
J = Porcentagem de artigos com pelo menos 0,5 kb de texto legível (veja F)
K = Porcentagem de artigos com pelo menos 2 kb de texto legível (veja F)

Base de dados
L = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
M = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
N = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
O = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
P = Total de ligações para outras wikipédias
Q = Total de imagens apresentadas
R = Total de ligações para outros sítios
S = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  5  10  100  1000  1  3  5  10  25  100  1  3  5  10  25  100  250  1000  5  10  100 
mar 201815321111     211    311111  11 
fev 201814331111     411    511111  11 
jan 201813321111     1111   3111111 11 
dez 201714332111 2   2111   4321111 11 
nov 20179221111 1   311    211111     
out 201711321111 1   511    4222111    
set 201716521111     2111   4111111 11 
ago 201721843311 1   10441   5222222111 
jul 201713311111111  1111   4222211 11 
jun 2017124311111    1111   3222211 11 
mai 201711532221 1   11111  3222211111 
abr 201717642211 1   2221   2222211 11 
mar 20178311111     3222   211111  11 
fev 201715311111     31111  611111  11 
jan 201711311111     3111   511111  11 
dez 20166321111     4221   311111  11 
nov 201611432111     111    421111  11 
out 20161032211      2111   32111   11 
set 2016932221  1   6111   41111      
ago 20161533221      5321   43221      
jul 20169655321     53221  322111  1  
jun 201610333211 1   42211  611111  11 
mai 201611433311 11  8321   42211   11 
abr 201693322      721    4111    11 
mar 201616543211     321    5221    11 
fev 201612222111 11  221    62111   11 
jan 20168532211     9321   644211  11 
jan 201813321111     1111   3111111 11 
out 201711321111 1   511    4222111    
jul 201713311111111  1111   4222211 11 
abr 201717642211 1   2221   2222211 11 
jan 201711311111     3111   511111  11 
out 20161032211      2111   32111   11 
jul 20169655321     53221  322111  1  
abr 201693322      721    4111    11 
jan 20168532211     9321   644211  11 
out 20151554321  1   411    311     1  
jul 201515333222     422    3222222    
abr 201514555411     643    53211      
jan 20151243321      6311   843111     
out 201494222      321    6211       
jul 20141122211      5332   42221      
abr 201410332221     43211  52221      
jan 201414544411 11  74422  854311  1  
out 20135333211     4211   5211       
jul 20131654331      53321  94411      
abr 201318544222 33  53221  97421   331
jan 20131155431  15123 632111 123321   661
out 20121910108622 1383 94332  18854311 762
jul 201215644221 1083 832111 2653222  66 
abr 20121465431  11102 9541   16632    53 
jan 2012744421      54332  32211      
out 2011722111      1      1111       
jul 2011111111  1          21         
abr 201165541      1      21         
jan 20115444321     421    4332       
out 2010          1                 
jul 2010      1          111        
abr 20101                2211       
jan 2010                            
out 2009321111             11111      
jul 20091111                         
abr 2009222                          
jan 2009444331      332    32222      
out 2008                            
jul 2008211                          
abr 20082221                         

 

Distribuição de edições de artigos por wikipedistas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikipedistasEdições total
1541100.0%48,764100.0%
313324.6%48,18798.8%
107213.3%47,83998.1%
32397.2%47,23296.9%
100213.9%46,12294.6%
316122.2%44,48091.2%
100091.7%42,09086.3%
316220.4%29,69160.9%
1000010.2%20,68042.4%

 

15 wikipedistas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdições 
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
 agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
KoiravvaUC1 020,68049011,896205out 21, 201219861,0908--
ZelvaCZUC44+128110-dez 02, 201711891--
DARIO SEVERIUC49+622441ago 14, 2016593----
GustavoMacielUC92...77--mar 14, 20181611--
JfblancUC93+8612-fev 06, 2012224431--
Hmarskiy IIUC105+1351--abr 13, 20131812----
Miguel ChongUC165+6931--ago 03, 2016604----
FM3345FUC260...22--mar 27, 20183----
Arcad1951UC535...11--mar 09, 201821----
DandeloUC536...11--mar 16, 201814----
DwIHoffiUC537...1122mar 17, 201813----
Gerd EichmannUC538...11--mar 24, 20186----
Bowling is lifeUC539...11--mar 25, 20185----
Ksc~ruwikiUC540...11--mar 27, 20183----
OktaRama2010UC541...11--mar 29, 20181----

 

20 wikipedistas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
  Primeira ediçãoúltima edição
 posiçãototaldatadias
atrás
datadias
atrás
Tamara UstinovaUC29,011out 19, 20112354mai 26, 20141404
SebranikUC32,720mai 15, 20122145fev 08, 2017415
SihlaineUC42,215nov 05, 20131606set 05, 20141302
K9re11UC52,089fev 03, 20141516out 23, 2015889
МаксимUC61,494dez 29, 20112283jul 07, 20141362
IgriksUC71,458set 18, 20093115mai 14, 20131781
Игорь БродскийUC81,262fev 23, 20093322dez 04, 2015847
IketsiUC91,161jun 15, 20112480jul 30, 20141339
WolverèneUC10950mai 12, 20141418fev 14, 201844
Andrijko Z.UC11767nov 08, 20102699nov 20, 20112322
MF-WarburgUC12673fev 01, 20122249fev 07, 20131877
FrhdkazanUC13313jan 22, 2016798ago 19, 2017223
SuraUC14258fev 19, 20083692mar 31, 20112556
Midnight GreenUC15196ago 24, 20112410jun 25, 20122104
Анна ОзероваUC16189mai 11, 2016688jul 22, 2016616
PorbóllettUC17157nov 24, 20131587dez 28, 2015823
Triple-ADHD-ASUC18154jan 17, 20093359dez 09, 20093033
U.SteeleUC19138ago 11, 20112423jul 20, 20122079
RomaineBotUC20129mar 30, 20102922mar 30, 20102922
Connection 3UC21108jun 27, 20131737set 21, 20131651

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 3.216 edições foram feitas por usuários anônimos, de um total de 69.430 edições ( 4e %)
  


43 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições 
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
 datadias
atrás
datadias
atrás
EmausBotUC14,367fev 03, 20122247mar 14, 2018161,499-
MerlIwBotUC23,499mai 10, 20112516ago 09, 20131694319-
AddbotUC32,932mar 07, 20131849ago 19, 20131684--
XqbotUC41,816abr 16, 20122174mar 14, 2018168-
GerakibotUC5557mai 24, 20122136mar 06, 20131850--
JackieBotUC6555fev 09, 20122241mar 02, 201318544-
AvocatoBotUC7540fev 08, 20122242jul 10, 20122089--
LegobotUC8410mar 11, 20131845abr 02, 20131823--
RedBotUC9381abr 21, 20122169ago 21, 20122047--
JAnDbotUC10350fev 03, 20122247jul 02, 20131732--
Idioma-botUC11229fev 03, 20122247mar 05, 201318511-
YFdyh-botUC12204jun 24, 20122105fev 27, 20131857--
CommonsDelinkerUC13185set 30, 20093103mar 26, 20184--
Makecat-botUC14184out 26, 20121981mar 05, 20131851--
HiW-BotUC15171fev 05, 20122245nov 08, 20121968--
LaaknorBotUC16134fev 04, 20122246mar 03, 20131853--
Justincheng12345-botUC17128jun 23, 20122106jan 08, 20131907--
Luckas-botUC18114abr 01, 20122189mai 20, 20122140--
VolkovBotUC19107fev 14, 20122236mar 04, 20131852--
AvicBotUC2091jun 01, 20122128dez 09, 20121937--
EscarbotUC2186mar 06, 20122215mai 19, 20166801-
KLBot2UC2268abr 13, 20131812jul 07, 20131727--
VagobotUC2353fev 29, 20122221set 04, 20122033--
SantoshBotUC2441out 24, 20121983mar 04, 20131852--
PixelBotUC2533fev 20, 20122230mar 03, 20131853--
KamikazeBotUC2633fev 29, 20122221jan 26, 20131889--
CarsracBotUC2730fev 12, 20122238fev 24, 20131860--
SynthebotUC2825mai 16, 20122144dez 30, 20121916--
WikitanvirBotUC2920fev 04, 20122246abr 05, 20122185--
RobbotUC3019fev 04, 20122246set 02, 20122035--
タチコマ robotUC3114dez 28, 20112284nov 15, 2016500--
JotterbotUC3214jan 15, 20131900jan 26, 20131889--
DragonBotUC3311jan 12, 20131903jan 14, 20131901--
SassoBotUC349mai 29, 20122131mar 04, 20131852--
GhalyBotUC358dez 27, 20121919jan 31, 20131884--
CompBotUC367mar 24, 20122197mai 21, 20122139--
CocuBotUC377nov 30, 20121946fev 11, 20131873--
OctraBotUC387jan 28, 20151157fev 02, 20151152--
NjardarBotUC394jun 16, 20122113out 27, 20121980--
YiFeiBotUC403ago 07, 2015966dez 31, 2015820--
MastiBotUC412fev 26, 20131858fev 28, 20131856--
MalarzBOTUC421ago 18, 20122050ago 18, 20122050--
TXiKiBoTUC431dez 20, 20121926dez 20, 20121926--

 

Artigos que contêm pelo menos uma ligação interna e .. caracteres de texto legível, não contando códigos wiki e html,
ligações ocultas, etc.; títulos também não contam  (excluindo páginas de redirecionamento)

DataArtigos
 < 32 ch< 64 ch< 128 ch< 256 ch< 512 ch< 1 k ch< 2 k ch< 4 k ch< 8 k ch< 16 k ch< 32 k ch< 64 k ch

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110
mar 20188,5 k47165 71,7 k15,9 k       
fev 20188,4 k47164 71,7 k15,9 k       
jan 20188,4 k46864 71,6 k15,8 k       
dez 20178,4 k46764 71,5 k15,7 k       
nov 20178,3 k46463 71,4 k15,7 k       
out 20178,3 k46463 71,2 k15,6 k       
set 20178,3 k46463 797315,6 k       
ago 20178,2 k46361 791515,4 k       
jul 20178,1 k46260 784515,1 k       
jun 20178,0 k46059 780714,8 k       
mai 20177,9 k45959 776814,1 k       
abr 20177,7 k45959 769813,1 k       
mar 20177,5 k45959 767412,9 k       
fev 20177,4 k45959 767012,8 k       
jan 20177,3 k45759 766712,7 k       
dez 20167,2 k45656 766512,6 k       
nov 20167,0 k45456 766412,5 k       
out 20167,0 k45456 766412,5 k       
set 20167,0 k45456 766412,4 k       
ago 20166,9 k45356 766412,4 k       
jul 20166,9 k45055 766312,4 k       
jun 20166,8 k44853 766312,3 k       
mai 20166,7 k44751 766212,3 k       
abr 20166,7 k44650 766012,2 k       
mar 20166,6 k44450 766012,2 k       
fev 20166,6 k44350 765812,2 k       
jan 20166,6 k44250 765612,2 k       
dez 20156,5 k44250 765212,1 k       
nov 20156,5 k43846 764512,1 k       
out 20156,4 k43846 764512,0 k       
set 20156,4 k43846 763312,0 k       
ago 20156,3 k43646 755411,9 k       
jul 20156,1 k43646 754811,8 k       
jun 20155,7 k43546 753911,6 k       
mai 20155,3 k43446 753211,5 k       
abr 20155,1 k43345 751711,4 k       
mar 20155,0 k43145 750811,4 k       
fev 20154,9 k42945 750011,4 k       
jan 20154,8 k42445 739211,3 k       
dez 20144,8 k41645 739211,2 k       
nov 20144,8 k41545 739211,2 k       
out 20144,7 k41245 739211,1 k       
set 20144,7 k41045 739211,1 k       
ago 20144,6 k40745 738811,1 k       
jul 20144,6 k40145 736511,0 k       
jun 20144,6 k40044 735711,0 k       
mai 20144,5 k40042 635711,0 k       
abr 20144,5 k39241 635211,0 k       
mar 20144,4 k39041 634911,0 k       
fev 20144,4 k38440 63421983      280
jan 20144,3 k38140 63411980      721
dez 20134,3 k37736 63331967      839
nov 20134,1 k37435 63321962      298
out 20134,1 k37034 63231959      327
set 20134,0 k36534 63231951      148
ago 20134,0 k35234 63231950      193
jul 20133,9 k34934 63211942      361
jun 20133,8 k34434 63161941      611
mai 20133,6 k34134 63161936      527
abr 20133,6 k33533 62971912      720
mar 20133,4 k32431 62931905      378
fev 20133,2 k20030 62921897      274
jan 20133,0 k18929 62891868      240
dez 20122,9 k18326 62831839      995
nov 20122,5 k17226 62791778      1165
out 20122,1 k16523 42741689      1423
set 20121,9 k15420 42501543      2202
ago 20121,5 k14219 42301365      442
jul 20121,3 k13316 42181313      585
jun 20121,2 k11811 42001263      1692
mai 20127831068 4129 175      1113
abr 2012569977 2126 158      357
mar 2012500856 2126 143      313
fev 2012385774 2123 120      1703
jan 2012203 4  73 87      228
dez 2011201 4  73 87      458
nov 2011156 3  73 83      222
out 2011151 3  71 83      218
set 2011151 3  71 83      118
ago 2011151 3  71 83      171
jul 2011149 3  71 83      115
jun 2011148 3  69 83      71
mai 2011146 3  69 83      65
abr 2011145 3  69 83      110
mar 2011144 3  69 83      310
fev 2011137 3  45 70      295
jan 2011131 3  44 70      620
dez 2010127 3  44 70      209
nov 2010123 1  43 69      288
out 2010119 1  41 69       
set 2010119 1  41 69       
ago 2010119 1  41 69      2
jul 2010119 1  41 69       
jun 2010119 1  41 69       
mai 2010119 1  41 69      4
abr 2010118 1  41 69      1
mar 2010118 1  41 69      160
fev 2010114    24 54      2
jan 2010114    24 54       
dez 2009114    24 53      14
nov 200965    24 53      188
out 200955    14 51      138
set 200933    13 43      101
ago 200910    4 4      5
jul 20099    4 4      14
jun 20099    4 4       
mai 20099    4 4       
abr 20099    4 4      12
mar 20098    4 4      27
fev 20097              
jan 20096              
dez 20085              
nov 20085              
out 20085              
set 20085              
ago 20085              
jul 20085              
jun 20085              
mai 20085              
abr 20085              
mar 20085              
fev 20084              

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

fev 2008: 1 2 Piter , 2 1 Pätnič

mar 2008: 1 1 Šoutjärv'

abr 2008: 1 1 Šoutjärv'

mai 2008: 1 1 Šoutjärv'

jul 2008: 1 1 Mecoi

dez 2008: 1 1 Vingl

jan 2009: 1 4 Meiden Tat , 2 4 Kos'kenaluižen rajon , 3 3 Kühkjaine , 4 3 Kuruv , 5 3 Kana , 6 3 Jerusalim , 7 3 Jablokpu , 8 3 Hel'sinki , 9 3 Hab , 10 3 Biblii , 11 2 Šušt , 12 2 Šoutjärv' , 13 2 Mecantaga , 14 2 Zaiceva Nina , 15 2 Vologdan agj , 16 2 Vingl , 17 2 Vil'häl , 18 2 Vepsän rahvahaline volost' , 19 2 Vepsän , 20 2 Venäma , 21 2 Vaugedvenäma , 22 2 Uz' Zavet , 23 2 Tihvinan rajon , 24 2 Tervoil , 25 2 Suomen kel'

fev 2009: 1 2 Pälehtpol’ , 2 2 Karjalan Tazovaldkundan gimn , 3 1 Litvanma

mar 2009: 1 2 Zaiceva Nina , 2 1 Šoutjärv'

abr 2009: 1 2 Suomenma , 2 1 Vepsän

jul 2009: 1 1 Zverin lugu

ago 2009: 1 1 Suomenma

set 2009: 1 2 Pälehtpol’ , 2 1 Meiden Tat

out 2009: 1 2 Vepsän rahvahaline volost' , 2 2 Venäma , 3 2 Kuld , 4 1 Šoutjärv'

nov 2009: 1 2 Suomenma , 2 1 Zverin lugu

dez 2009: 1 2 Grekanma , 2 1 Mal't

fev 2010: 1 1 Pälehtpol’

mar 2010: 1 2 Sur' Britanii , 2 2 Pu , 3 2 Ispanii , 4 2 Hristofor Kolumb , 5 2 Saksanma , 6 2 Lönnrot Elias , 7 2 Avstrii , 8 1 Šušt

abr 2010: 1 1 Einštein Al'bert

mai 2010: 1 1 Kaliningradan agj

ago 2010: 1 1 Pol'šanma

nov 2010: 1 3 Kaliningradan agj , 2 2 Mecoi , 3 2 Litvanma , 4 2 Änine , 5 2 Podporožj , 6 2 Kaunas , 7 2 Karjalan keled , 8 2 Karjalan Tazovaldkund , 9 2 Kant Immanuel' , 10 2 Kaliningrad , 11 2 Kalevala , 12 2 Kajag , 13 2 Jurij Gagarin , 14 2 Italii , 15 2 Ispanii , 16 2 Irlandii , 17 2 Hel'sinki , 18 2 Haitmann Fridrih , 19 2 Grekanma , 20 2 Gent , 21 2 Flevoland , 22 2 Eva , 23 2 Estinma , 24 1 Zverin lugu

dez 2010: 1 4 Surikov Vasilii , 2 3 Vologdan agj , 3 3 Vinsent van Gog , 4 3 Tu-154 , 5 2 Čehov Anton , 6 2 Änižröunan rajon , 7 2 Migel' de Servantes Saavedra , 8 2 Mal't , 9 2 Lüksemburg , 10 2 Mocart Vol'fgang Amadeus , 11 2 Zaiceva Nina , 12 2 Gügo Viktor , 13 2 Vaugedvenäma , 14 2 Šeikspir Uil'jam , 15 2 Tervoil , 16 2 Suomalaiž-ugrilaine škol , 17 2 Sodjärv , 18 2 Päiväine , 19 2 Portugalii , 20 2 Podporožj , 21 2 Petroskoi , 22 2 Orav , 23 2 Nemž , 24 2 Leonardo da Vinči , 25 2 Kettunen Lauri

jan 2011: 1 3 Vengrii , 2 3 Ukrain , 3 3 Kazahstan , 4 3 Italijan kel' , 5 2 Ženevan järv , 6 2 Šoutjärv' , 7 2 Čehanma , 8 2 Änižröunan rajon , 9 2 Lüksemburg , 10 2 Vepsän kul'turan muzei , 11 2 Vepsän kel' , 12 2 Venäma , 13 2 Vaugedvenäma , 14 2 Vatikan , 15 2 Suomenma , 16 2 Slovenii , 17 2 Slovakii , 18 2 Serbii , 19 2 San Marino , 20 2 Pälehtpol’ , 21 2 Piter , 22 2 Petroskoi , 23 2 Nevondkundaližiden Socialistižiden Tazovaldkundoiden Ühtištuz , 24 2 Moskv , 25 2 Monak

fev 2011: 1 3 Kazahan kel' , 2 3 Kazahlaižed , 3 3 Händikaz , 4 2 Änižröunan rajon , 5 2 Litvanma , 6 2 Vepsän rahvahaline volost' , 7 2 Totaran kel' , 8 2 Suomenma , 9 2 Ročinma , 10 2 Petroskoi , 11 2 Kaži , 12 2 Kaleig , 13 2 Irlandii , 14 2 Grekanma , 15 2 Saksanma , 16 2 Estin kel' , 17 2 Daugavpils , 18 1 Šveicarii

mar 2011: 1 3 Venäma , 2 3 Moskv , 3 3 Kaunas , 4 2 Šokš , 5 2 Medvedev Dmitrii , 6 2 Rim , 7 2 Repin Il'ja , 8 2 Pälehtpol’ , 9 2 Putin Vladimir , 10 2 Piter , 11 2 Peitsemnižed , 12 2 Abramov Nikolai , 13 2 Kuz' , 14 2 Kuld , 15 2 Kolumb Hristofor , 16 2 Kazmused , 17 2 Karjalan Tazovaldkundan gimn , 18 2 Karjalan Tazovaldkund , 19 2 Kant Immanuel' , 20 2 Kaliningrad , 21 2 Jel'cin Boris , 22 2 Immanuel Kant , 23 2 Haitmann Fridrih , 24 2 Germanijan kel' , 25 2 Gagarin Jurii

abr 2011: 1 2 Venäma , 2 2 Kazahstan , 3 2 Bel'gii , 4 1 Šveicarii

mai 2011: 1 3 Süvär' , 2 2 Päiväine , 3 2 Pifagoran teorem , 4 2 Kolumb Hristofor , 5 2 Karjalan Tazovaldkundan Rahvahaline teatr , 6 1 Marok

jun 2011: 1 2 Karjalan Tazovaldkund , 2 2 Danii , 3 2 Bolgarii , 4 2 Alma-At , 5 1 Čehanma

jul 2011: 1 1 Ženevan järv

ago 2011: 1 3 Vezi , 2 3 Süvär' , 3 2 Šrenkan kuz' , 4 2 Venäma , 5 2 Vauged kuz' , 6 2 Tän'-šanine kuz' , 7 2 Turkmenistan , 8 2 Taškent , 9 2 Serbine kuz' , 10 2 Saratov , 11 2 Pifagoran teorem , 12 2 Peitsemnižed

set 2011: 1 5 Lezgin kel' , 2 3 Dagestan , 3 2 Ženevan järv , 4 2 Volgograd , 5 2 Samara , 6 2 Orenburg , 7 2 Omsk , 8 2 Kurgan , 9 2 Kaliningradan agj , 10 1 Zverin lugu

out 2011: 1 2 Vil'nüs , 2 2 Pälehtpol’ , 3 2 Lakan kel' , 4 2 Korsik , 5 1 Šušt

nov 2011: 1 3 Tähtaz , 2 3 Tu-154 , 3 3 Pälehtpol’ , 4 2 Vinsent van Gog , 5 2 Vikipedii , 6 2 Vikimedii , 7 2 Vezi , 8 2 Rim , 9 2 Pol'šanma , 10 2 Pifagoran teorem , 11 2 Petroskoi , 12 2 Pariž , 13 2 Paltog , 14 2 Moskv , 15 2 Kuruv , 16 2 Karjalan Tazovaldkund , 17 1 Šoutarv

dez 2011: 1 5 Vaugedpert' (Vašington) , 2 4 Amerikan Ühtenzoittud Valdkundad , 3 3 Mel'burn , 4 3 Lüblän , 5 3 Pälehtpol’ , 6 3 Pil'ved , 7 3 Oper , 8 3 Natrii , 9 3 Kundlimed , 10 3 Konstebl Džon , 11 3 Džasper (lidn, Minnesot) , 12 3 Bratislav , 13 3 Ankar , 14 2 Šrödinger Ervin , 15 2 Šanhai , 16 2 Čuvašan kel' , 17 2 Čai , 18 2 Mafii , 19 2 MP3-plejer , 20 2 Lüblin , 21 2 Avrora (kreiser) , 22 2 Zagreb , 23 2 Vintaž , 24 2 Vepsän kel' , 25 2 Vener (planet)

jan 2012: 1 4 Venäman Tazovaldkundad , 2 4 Internet Explorer , 3 3 Čerkessk , 4 3 Čeboksarad , 5 3 Petr I Sur' , 6 3 Mozilla Firefox , 7 3 Groznii , 8 3 Google Chrome , 9 2 Čeläbinsk , 10 2 Microsoft Windows , 11 2 Microsoft Office Word , 12 2 Microsoft Office Excel , 13 2 Vašington (lidn) , 14 2 Uraližed keled , 15 2 Skopje , 16 1 Vepsän kelen aigad

fev 2012: 1 14 Pälehtpol’ , 2 5 Sarapul , 3 5 Dagestanan Tazovaldkund , 4 4 Zaiceva Nina , 5 4 Venäma , 6 4 Särg , 7 4 Petr I Sur' , 8 4 San Francisko , 9 4 Podporožj , 10 4 Petroskoi , 11 4 Orav , 12 4 Korol' i Šut , 13 4 Kijev , 14 4 Baškiran kel' , 15 4 Azerbaidžan , 16 3 Vepsän kelen aigad , 17 3 Bolgarijan kel' , 18 3 Antofagast , 19 3 Val'paraiso , 20 3 Santjago , 21 3 Konseps'jon , 22 3 Mrongovo , 23 3 Vk.com , 24 3 Lacuna Coil , 25 3 Šveicarii

mar 2012: 1 4 Soči , 2 4 Pälehtpol’ , 3 3 Buranovon Baboid , 4 3 Narv (lidn) , 5 3 Tartu , 6 3 Linkin Park , 7 3 Čehanma , 8 2 Bardan rajon , 9 2 Šeki , 10 2 Nahičevan , 11 2 Gändž , 12 2 Gai (lidn) , 13 2 Orenburgan agj , 14 2 Moščen , 15 2 Kautokeino , 16 2 Ostrav , 17 2 Himižiden elementoiden periodine tablut , 18 2 Udmurtan kelen kändod , 19 2 Rio-de-Žaneiro , 20 2 San Paulu , 21 1 Orsk

abr 2012: 1 4 Pälehtpol’ , 2 3 Vepsän nimed , 3 3 Pol'šanman administrativiž-territorialine jagand , 4 2 666 (lugu) , 5 2 Vepsän Vikipedii , 6 2 Vodin kel' , 7 2 Lantanoidad , 8 2 Korrea Rafael' , 9 2 Ščecin , 10 2 Abdulino , 11 2 Himižiden elementoiden periodine tablut , 12 2 Melent'jeva Marija , 13 2 Zaiceva Marja , 14 2 Lämoi , 15 2 Votkinsk , 16 2 Vobl , 17 2 Jašov Viktor , 18 2 Vepsän kel' , 19 2 Šeikspir Uil'jam , 20 2 Udmurtan kel' , 21 2 Portlend (Oregon) , 22 2 Kühkjaine , 23 2 Kur'ged , 24 2 Kalitkad , 25 2 Hirb'

mai 2012: 1 7 Pälehtpol’ , 2 6 Party for Everybody , 3 5 Piter , 4 4 Piterin metropoliten , 5 4 Vepsän Vikii , 6 4 Buranovon Baboid , 7 3 MySpace , 8 3 Euphoria , 9 3 Lorin , 10 3 Should've Known Better , 11 3 Evrovizii-2012 , 12 3 Venäman millionerlidnad , 13 3 Ogeruz i aznoičend , 14 3 Teräsbetoni , 15 3 Rabat , 16 3 Glittertind , 17 3 Viski , 18 3 Unheilig , 19 3 Üebermutter , 20 3 Rammstein , 21 3 Tatarstanan Tazovaldkund , 22 3 Udmurtijan Tazovaldkund , 23 3 12 (lugu) , 24 3 11 (lugu) , 25 3 10 (lugu)

jun 2012: 1 6 Lavin Avril , 2 5 Evropan futbolan čempionat 2012 , 3 5 Vikipedii , 4 4 Lorin , 5 4 Pälehtpol’ , 6 3 Bahreinan valdkundznam , 7 3 .bs , 8 3 Bagaman Sared , 9 3 Kubanin kozakišton hor , 10 3 Vepsän flag , 11 3 Norvegijan konstitucijan päiv , 12 3 Antiguan da Barbudan flag , 13 3 Belogorsk (Amuran agj) , 14 3 Blagodarnii , 15 3 Krasnodaran rand , 16 3 Jousne , 17 3 Joudjuden statui , 18 3 .us , 19 3 .dz , 20 3 FK Zenit Piter , 21 3 .al , 22 3 .nl , 23 3 Alamaiden valdkundznam , 24 3 Afganistanan valdkundznam , 25 3 .af

jul 2012: 1 4 Pohjoižsaamen Vikipedii , 2 4 Öbok , 3 3 Udmurtan Vikipedii , 4 3 Slovenijan kel' , 5 3 Evropan futbolan čempionat 2012 , 6 3 Turkanma , 7 3 Mozilla Firefox , 8 2 Centillion , 9 2 Grekan kirjamišt , 10 2 Taimir (lehtez) , 11 2 7-Zip , 12 2 Puht , 13 2 Šujan stancii , 14 2 Meliorativnii , 15 2 Bernar Sara , 16 2 Ehtbok , 17 2 Longibok , 18 2 Homendezbok , 19 2 Päivlaskm , 20 2 Päivnouzm , 21 2 Pohjoine , 22 2 Suvi , 23 2 Salavat Kupere , 24 2 Dakk , 25 2 Bangladeš

ago 2012: 1 4 Vilämovicen kel' , 2 4 Vn 2012 Kezaolimpiadan lopmižed , 3 2 Naily , 4 2 Komin Vikipedii , 5 2 Ternopol' , 6 2 Fareran kel' , 7 2 Vagur , 8 2 Alitus , 9 2 Priozerskan rajon , 10 2 Priozersk , 11 2 Bugri (Vsevoložskan rajon) , 12 2 Vepsän ülüz , 13 2 Venäman flag , 14 2 Valaam , 15 2 .et , 16 2 Virrat , 17 2 Ferland Džodel' , 18 2 Hibbert Eleanor , 19 2 Nuori Karjala , 20 2 Breivik Anders Bering , 21 2 Regalado Tomas , 22 2 Windir , 23 2 Tanzwut , 24 2 Majami , 25 2 AÜV:oiden flag

set 2012: 1 4 Evrejan kel' , 2 4 Pälehtpol’ , 3 4 Google Chrome , 4 3 Virun kel' , 5 3 Vikingad , 6 3 Ristitun hibj , 7 3 A , 8 3 Ganter Henri , 9 3 Pussy Riot , 10 3 Ezmäine mail'man voin , 11 3 A7V , 12 3 Spalletti Lučano , 13 3 Fobijoiden nimikirjutez , 14 3 Fontanka.ru , 15 3 Modern Talking , 16 3 Polandball , 17 3 Grekan kirjamišt , 18 3 FK Zenit Piter , 19 3 Venälaižed , 20 3 Artut' , 21 3 Gändž , 22 3 Ostrav , 23 3 Brno , 24 3 Venän kel' , 25 3 Prag

out 2012: 1 4 Singapur , 2 4 Vologdan agj , 3 4 Rig , 4 3 Norvegijan Vikipedii , 5 3 Pohjoižen saldat (fil'm) , 6 3 Sar' (fil'm, Venäma, 2006) , 7 3 Dnestranrand , 8 3 Ahvenanma , 9 3 Grekanman Makedonii , 10 3 Šokolad , 11 3 Dom-2 , 12 3 Taivan' (sar') , 13 3 Pirahan (kel') , 14 3 Ternopol' , 15 3 Marti Petit Antoni , 16 3 Litvanma , 17 3 Vil'nüs , 18 3 Varšav , 19 3 Portlend (Oregon) , 20 3 Latvii , 21 3 Grekanma , 22 3 Evropan valdkundad , 23 3 Budapešt , 24 3 Berlin , 25 3 Albanii

nov 2012: 1 4 Vepsän rahvahan hor , 2 3 Lodehline aviabaz , 3 3 Kurgiden aig , 4 3 Kalarand , 5 3 «Ö»-kirjamen muštpacaz , 6 3 Mi? Kus? Konz? , 7 3 Tedr , 8 2 Pirgaine , 9 2 Randaine , 10 2 Duty free , 11 2 Jablonovskii-sild (Piter) , 12 2 Jablonovskii-sild (Krasnodar) , 13 2 Kegonpaniilind , 14 2 Pähkim , 15 2 Merikukoi , 16 2 Nug , 17 2 Habobatk , 18 2 In a Reverie , 19 2 Kodipühüt , 20 2 Kodipulo , 21 2 Jälinduine , 22 2 Kärg , 23 2 Näk , 24 2 Zor'alinduine , 25 2 Küuki

dez 2012: 1 3 Livin Vikipedii , 2 3 Gamburger , 3 3 Hot-dog , 4 3 Venäma Evrovizijal , 5 3 MySpace , 6 3 Naberežnije Čelni , 7 2 Ronson Šarlotta , 8 2 Mir (orbitine stancii) , 9 2 Bleeding Souls , 10 2 Ethereal (demo) , 11 2 Plazm , 12 2 Sleep of Right , 13 2 Lumenšur , 14 2 Hobednitid , 15 2 Kuziine om sündnu mecha , 16 2 Maseru , 17 2 Kindhad , 18 2 Truganini , 19 2 Happy Tree Friends , 20 2 Letsie III , 21 2 Suomalaine veič , 22 2 Tüp , 23 2 Nin' , 24 2 Britanijan Kuldrand , 25 2 Renault Logan

jan 2013: 1 3 Vederistmad , 2 3 Grand Theft Auto: San Andreas , 3 3 Vologdan agj , 4 2 Evenalaižed , 5 2 Evenkalaižed , 6 2 Udinalaižed , 7 2 Lumiuk , 8 2 Darginalaižed , 9 2 De Agostini , 10 2 I'm Not Afraid , 11 2 Bela Lugosi's Dead , 12 2 Wide Awake (Lacuna Coil:an pajo) , 13 2 I Won't Tell You , 14 2 Ragozina Natal'ja , 15 2 Enjoy the Silence , 16 2 Swamped , 17 2 Vepsän mifologii , 18 1 Leonardo Forti

fev 2013: 1 3 Jožin z bažin , 2 3 Pori , 3 3 Lihtenštein , 4 2 Nor'mik , 5 2 Norhein , 6 2 Habinod , 7 2 Bard (hibused) , 8 2 Real,- , 9 2 Raum , 10 2 Etimologii , 11 2 Kolan norvegijalaižed , 12 2 Lukumades , 13 2 Gitar , 14 2 Tofalaralaižed , 15 2 Doncova Dar'ja , 16 2 Lužkovan stil' , 17 2 Eht , 18 2 Orokalaižed , 19 2 Ö (aig) , 20 2 Ul'čilaižed , 21 2 Laškuzlidn , 22 2 Jugalaižed , 23 1 MOS Technology 6502

mar 2013: 1 4 Venälaine literatur , 2 4 Kitai , 3 3 Merežkovskii Dmitrii , 4 3 Bad Boys Blue , 5 3 Heitämine (serial) , 6 2 Leningradalaine zoopuišt , 7 2 Obuhovan Kaičendan prospekt , 8 2 Hamid Abdul , 9 2 Klüjev Nikolai , 10 2 Antresol' , 11 2 Lindemann Till' , 12 2 C.E.B. Reas , 13 2 Zencov Roman , 14 2 C. C. Catch , 15 2 Ph. Patrikan päiv , 16 2 Buraka Som Sistema , 17 2 Vasil'jev Boris , 18 2 Kaks'nik (starin) , 19 2 Ižand Proharčin , 20 2 Vändai (roman) , 21 2 Voin i kožmuz , 22 2 Domostroi , 23 2 Adams Duglas , 24 2 Rahvahidenkeskeine naižiden päiv , 25 2 Dahno Vladimir

abr 2013: 1 3 Kel'tižed keled , 2 3 Kečuan kel' , 3 3 Šotlandijan kel' (kel'tine) , 4 2 Dirbal , 5 2 Puhtaz, ajatud , 6 2 Sekret Uspeha , 7 2 Birbincpühäpäiv , 8 2 Šizofrenii , 9 2 Depressii , 10 2 Sanskrit , 11 2 Ficdžeral'd Ella , 12 2 Nganasanan kel' , 13 2 Subway Surfers , 14 2 Cut the Rope , 15 2 Čukačun kel' , 16 2 Hüväd öd, čočod! , 17 2 Welcome to the Heartbreak Hotel , 18 2 Kirj , 19 2 Surman kel'dand , 20 2 Haki (kel'kund) , 21 2 Guaranin kel' , 22 2 Eiler Leonard , 23 2 Tuskaroran kel' , 24 2 I Can Lose My Heart Tonight , 25 2 Kombinacija

mai 2013: 1 3 Evrovizii-1956 , 2 3 Odess , 3 3 You're My Heart, You're My Soul , 4 3 Vepsän kel' , 5 3 Pil'ved , 6 2 Likutimveneh , 7 2 Kater , 8 2 Veneh , 9 2 You Shot a Hole In My Soul , 10 2 Hear What I Say , 11 2 Čistalöv Veniamin , 12 2 Azartvänd , 13 2 Diamonds , 14 2 Jankulov Stojan , 15 2 Sport , 16 2 Jumal , 17 2 Džakart , 18 2 I'm No Rockefeller , 19 2 One In a Million , 20 2 Good Guys Only Win in Movies , 21 2 Tilli Džennifer , 22 2 Kannad , 23 2 Vägestusen päiv , 24 2 Vepsän grammatik , 25 2 Kulič

jun 2013: 1 4 Moskv-Siti , 2 3 Kahtišti koumekümne koume , 3 3 Juhannus , 4 3 Mahfuz Nagib , 5 3 Psalmoiden kirj , 6 3 Lönnrot Elias , 7 3 Biblii , 8 2 Baltika (oludenkeituden kompanii) , 9 2 Hala , 10 2 Kall' (külä) , 11 2 Kobencl' Lüdvig fon , 12 2 Mišel' (pajatai) , 13 2 Rajan Petti , 14 2 Tullei , 15 2 Valendas , 16 2 Fasmer Maks , 17 2 Gar d'Aržikur P'jerrpon , 18 2 Optimal , 19 2 Virtanen Veikko , 20 2 Komiks , 21 2 Semönov Pötr , 22 2 Mompha edax , 23 2 Iče minä , 24 2 Marginal , 25 2 Eristalis intricarius

jul 2013: 1 3 Vepsän küläd , 2 3 Rand (külä, Vepsän rahvahaline küläkund) , 3 3 Reprua , 4 3 Latinan frazoiden nimikirjutez , 5 2 C. C. Catch:an pajod , 6 2 Keimada Grandi , 7 2 Sur' Sünd! Abuta minei jäda henghe kesked necidä surmarmastust , 8 2 Zanin Artöm , 9 2 Synodontis pardalis , 10 2 Ptychogena antarctica , 11 2 Dendrilla elegans , 12 2 Heteropoda shillongensis , 13 2 Slavine neopaganuz , 14 2 Tur de Frans , 15 2 I Will Survive , 16 2 Aksintant , 17 2 Süvärensu , 18 2 Gaudi Antonio , 19 2 Znamasižiden evrodiskoedestajiden nimikirjutez , 20 1 You Suffer

ago 2013: 1 2 Puerto Iguasu , 2 2 Ročilaine laud , 3 2 Ištui Härg , 4 2 Venä , 5 2 Kahesan nellikon identižuz , 6 2 Ruskedvauvaz vin , 7 2 Mail'manpän Sar' (ATOW1996) , 8 2 Niinistö Sauli , 9 2 Jufit Jevgenii , 10 2 Francijalaižiden fil'miden festival' Malagas , 11 2 Oksitanan kel' , 12 1 Änižen kanal

set 2013: 1 2 Gül'mamedov Dašgin , 2 2 Inkeriläižed , 3 2 Karr Sara Rouz , 4 2 Žirinovskii Vladimir , 5 2 Palatoi lugu , 6 2 Mec , 7 2 Secret Star , 8 2 I Can Lose My Heart Tonight '99 , 9 2 Kitai , 10 2 Haapsalu , 11 2 You're My Heart, You're My Soul , 12 2 Vepsän ülüz , 13 2 Saha Tazovaldkund , 14 2 Afganistan , 15 2 Možg , 16 2 Vepsän Vikipedii

out 2013: 1 2 Frigga pratensis , 2 2 Belisana strinatii , 3 2 Kelenmagii , 4 2 Nagriž , 5 2 Päč , 6 2 WASP-64 , 7 1 Boa

nov 2013: 1 3 Boršod Abaui Zemplen , 2 3 Eger (lidn) , 3 3 Heveš (agj) , 4 3 Mad'jaranman lidnad , 5 3 Japonii , 6 3 Muil , 7 3 Queen , 8 2 Jas Nad'kun Sol'nok , 9 2 Kapošvar , 10 2 D'jor , 11 2 Kečkemet , 12 2 Miškol'c , 13 2 Debrecen , 14 2 Bač Kiškun , 15 2 Pešt (agj) , 16 2 Sabol'č Satmar Bereg , 17 2 .hu , 18 2 31 (lugu) , 19 2 Tok-pisin

dez 2013: 1 4 Lindberg Čed , 2 4 Töröčik Mari , 3 3 Garipova Dina , 4 3 Blek Lukas , 5 3 Emi S'juzi , 6 3 Disnei Uolt , 7 3 Buše Viktor , 8 3 Uusberg Pärt , 9 3 Keil (lidn) , 10 3 Vas (lidn) , 11 3 Laht (lidn) , 12 3 Mad'jaranman agjad , 13 3 Peč , 14 3 Ferland Džodel' , 15 2 Itson Meri Ellen , 16 2 Volčkov Sergei Valer'jevič , 17 2 Golos , 18 2 Holodnaja Vera , 19 2 Kalašnikov Mihail , 20 2 Džerri (fil'm) , 21 2 Pekuin Anna , 22 2 Roman Pol , 23 2 Jakobi Doreen , 24 2 De Montema Damian , 25 2 Vepsläižen kodin südäin

jan 2014: 1 3 Moskv-Siti , 2 2 Karlton Lending , 3 2 Zell' , 4 2 Uorhol Endi , 5 2 Silence , 6 2 Unborn Love , 7 2 Rait Frenk Lloid , 8 2 Le Korbüz'je , 9 2 Dürer Al'breht , 10 2 Dvoržak Antonin , 11 2 Goja Fransisko , 12 2 Rubens Piter , 13 2 Umbrine škol , 14 2 Rafael' Santi , 15 2 Tverin agj , 16 2 Lendai alamalaine , 17 2 Anomalii , 18 2 Mägi , 19 2 Kalo Frida , 20 2 Protistad , 21 2 Muiktuz , 22 2 Himine ühtnend , 23 2 Biohimii , 24 2 Himii , 25 2 Need for Speed: Pigusen himo

fev 2014: 1 2 Armastusen tippud , 2 2 Heimolaižuz , 3 2 Mumbai , 4 2 Indijan štatad da territorijad , 5 2 Nothing Stands In Our Way , 6 2 Hameleonad (serial) , 7 2 Lapsed (serial, Brazilii, 2013) , 8 2 Brazilii-kolledž , 9 2 Satatadud südäikerad , 10 2 Japonine kanang , 11 2 Karusel' (serial, Brazilii, 2012) , 12 2 Vn 2014 Tal'volimpiadan lopmižed , 13 2 Laos , 14 2 Kudentoštkümnen nellikon identižuz

mar 2014: 1 2 Kall'oikahad mäged , 2 2 Bangalor , 3 2 Kriman Avtonomine Tazovaldkund , 4 2 Korejan Tazovaldkund , 5 2 Čennai , 6 2 So , 7 2 Maim , 8 2 Need for Speed: Pigusen himo , 9 2 Vepsän küläd , 10 2 Bass Sol , 11 2 Venesuel , 12 2 Uz' Zelandii , 13 2 Avstralii (valdkund) , 14 2 Arhangel'sk , 15 2 Nikaragua (valdkund) , 16 2 Igark , 17 2 Suviamerik , 18 1 Česmen jumalanpert'

abr 2014: 1 3 Urugvai , 2 3 The Doors , 3 3 Voihein , 4 2 Sevastopol' , 5 2 Feodosii , 6 2 Nellikod (kartankarv) , 7 2 Džomolungm , 8 2 Venäman federaližed ümbrikod , 9 2 Suviafrikan Tazovaldkund , 10 2 Kilimandžaro , 11 2 Sabett , 12 2 Nencan kel' , 13 2 Jumalanbembel' , 14 2 Vederistmad , 15 2 Grand Theft Auto: San Andreas , 16 2 Buenos Aires , 17 2 Hristanuskond , 18 1 Koktebel'

mai 2014: 1 3 Luganskan Rahvahaline Tazovaldkund , 2 3 Ukrain , 3 2 Suomenkel'ne Vikipedii , 4 2 Jun Hen Sik , 5 2 Seong Dže-gi , 6 2 Marijampole , 7 2 Varghuz (lidn) , 8 2 Lund , 9 2 Viborg (Danii) , 10 2 Kriman Avtonomine Tazovaldkund , 11 2 Eupithecia turpis , 12 2 Takkiž , 13 2 Kislovodsk , 14 2 Mail'man valdkundad , 15 2 Rostov Donal , 16 2 Tallidn , 17 2 Suomenma , 18 1 Deborra-Li Förness

jun 2014: 1 2 Katar , 2 2 Malaizii , 3 2 Mongolii , 4 2 Tailand , 5 2 Tadžikistan , 6 2 Kano , 7 2 Tokio , 8 2 Tün' valdmeri , 9 2 Sevastopol' , 10 2 Džeronimo , 11 2 Öhabuk , 12 2 Ortodoksine hristanuskond , 13 2 Atlantine valdmeri , 14 1 In Čžen

jul 2014: 1 2 Egipt , 2 2 Sudan , 3 2 33 (lugu) , 4 2 Uusberg Pärt , 5 2 Novodvorskaja Valerija , 6 1 Ceilon

ago 2014: 1 4 Marilaine veroline religii , 2 3 Saba Isak , 3 3 Master i Margarita , 4 3 Kodima , 5 2 Kostarik , 6 2 Sur' Munamägi , 7 2 Vil'jandi , 8 2 Sudan , 9 2 Moskvan prospekt (Piter) , 10 2 Dakk , 11 2 Nikaragua (znamoičendad) , 12 2 Viluku , 13 1 Madagaskar (valdkund)

set 2014: 1 3 Paragvai , 2 3 Ugand , 3 3 Canada , 4 3 Coca-Cola , 5 2 Järgeline pölvaz , 6 2 Kekkonen Urho , 7 2 Koivisto Mauno , 8 2 Hel'singfors , 9 2 Senegal , 10 2 Kamerun , 11 2 Bolivii , 12 2 Nauru , 13 2 Ternopol' , 14 1 Paragvain Tazovaldkund

out 2014: 1 2 Bol , 2 2 Abai (znamoičendad) , 3 2 Abai , 4 2 Al'tamir (mägionduz) , 5 2 Indonezii , 6 2 Antigua da Barbud , 7 2 Pol'šanma , 8 1 Abazilaižed

nov 2014: 1 2 Kanoe Pessespäi , 2 2 Baženov Timofei , 3 2 Baženovan reiting , 4 2 Strub , 5 2 Lobez (lidn) , 6 2 Pöud (maižanduz) , 7 2 Pöud , 8 2 Marilaižiden tradicionaline uskond , 9 2 Tadžikistan , 10 1 Karbaz

dez 2014: 1 3 Lobez (lidn) , 2 2 Igor' Strelkov , 3 2 Gladius , 4 2 Pavlodar , 5 1 Vologdan pörutügitegim

jan 2015: 1 3 Reigan Ronal'd , 2 3 NGC 217 , 3 3 NGC 239 , 4 3 NGC 244 , 5 2 Sal'vador , 6 2 Germanii (znamoičendad) , 7 2 NGC 171 , 8 1 Suksed

fev 2015: 1 3 Modaižed sobad , 2 2 Gvinei Bisau , 3 2 Afrikan valdkundad , 4 2 Pakistan , 5 2 Heitämine (serial) , 6 2 Säs' , 7 2 Ukrain , 8 1 Grekanman Tazovaldkund

mar 2015: 1 3 Urugvai , 2 3 Sithine kuz' , 3 2 Hanko , 4 2 Uusikaupunki , 5 1 Hangö

abr 2015: 1 4 Amerikan Ühtenzoittud Valdkundad , 2 3 Lepai , 3 3 Damask , 4 3 Odess , 5 3 Vagolind , 6 3 Gorodovikovsk , 7 3 Lipeck , 8 3 Venäma , 9 3 Händikaz , 10 2 Sestrikaine , 11 2 Douson Doris , 12 2 Bridgetown , 13 2 Bridžtaun (lidn, Barbados) , 14 2 Thimphu , 15 2 Lohi , 16 2 Butan , 17 2 Naip'jido , 18 2 Pasklindud , 19 2 Džordžtaun , 20 2 Bogota , 21 2 Džordžtaun (Gajan) , 22 2 Ottav , 23 2 Dušanbe , 24 2 Ulanbatar , 25 2 Katmandu

mai 2015: 1 3 Baotou , 2 3 Valans'jen , 3 3 Klivlend , 4 3 Enn Arbor (Mičigan) , 5 3 Läojuan' , 6 3 Nagoi , 7 3 Brazzavil' , 8 3 Dakar , 9 3 Painmižpästandoiden nimikirjutez materialoidenke vepsän kelel , 10 3 Los Andželes , 11 3 Gajan , 12 3 Neue Deutsche Härte , 13 3 Kizlär , 14 3 Izberbaš , 15 3 Varšav , 16 2 Tuluz , 17 2 Fort Loderdeil , 18 2 Čikago , 19 2 Milan , 20 2 Florencii , 21 2 Šäuläi , 22 2 Panevežis , 23 2 Elgav , 24 2 Sillamäe , 25 2 Kohtla-Järve

jun 2015: 1 3 Lobez (lidn) , 2 3 Trpin' , 3 3 Zelöna Gur , 4 2 Lüneburg , 5 2 Fell'bah , 6 2 Džidd , 7 2 Štuttgart , 8 2 Sanderlend , 9 2 Sanderlend (Anglii) , 10 2 Grenobl' , 11 2 Ekseter , 12 2 Hanau , 13 2 Kassel' , 14 2 Beliz (lidn) , 15 2 Remedios (Kuba) , 16 2 Sidzuok , 17 2 Piterboro (Ontario) , 18 2 Vik (Saksanma) , 19 2 Jan'tai , 20 2 Batum , 21 2 Cincinnati , 22 2 Parm , 23 2 Sekuen' , 24 2 Subotic , 25 2 Toledo (Ogajo)

jul 2015: 1 3 Ngerulmud , 2 3 Tbilis , 3 3 Danii , 4 2 Saratamat , 5 2 Lakatoro , 6 2 Isangel , 7 2 Luganvill , 8 2 Sol (Vanuatu) , 9 2 Sjudad de la Kost , 10 2 Alei , 11 2 Sidon , 12 2 Zahle , 13 2 Tripoli (Livan) , 14 2 Galle , 15 2 Margilan , 16 2 Kokand , 17 2 Fergan , 18 2 Namangan , 19 2 El' Ain , 20 2 Kordov , 21 2 Rosario , 22 2 Mary , 23 2 Jangon , 24 2 Haidarabad , 25 2 Ahmedabad

ago 2015: 1 3 Federativižed Mikronezijan Valdkundad , 2 3 Al'met'jevsk , 3 3 Soči , 4 2 Hag , 5 2 Gorna Orähovic , 6 2 Sent Pol Kapister , 7 2 Kuritib , 8 2 Nasinu , 9 2 Koimbr , 10 2 Kuala Lumpur , 11 2 Regimägi , 12 2 Split , 13 2 Madagaskar , 14 2 Šrilank , 15 2 Nigerii , 16 2 Indii , 17 2 Sahar (produkt) , 18 2 Vitegr , 19 2 Ustüžn , 20 2 Sur' Ustüg , 21 2 Kirillov (lidn) , 22 2 Belozersk , 23 2 Babajevo , 24 2 Vologdan agjan lidnad , 25 2 Surovikino (lidn)

set 2015: 1 3 Coca-Cola , 2 2 Fareran Sared , 3 2 Dubovk , 4 2 Gorohovec , 5 2 Kiržač , 6 2 Kameškovo , 7 2 Jur'jev Pol'skii , 8 2 Aleksandrov (lidn) , 9 2 Fokino (Bränskan agj) , 10 2 Birüč , 11 2 Aleksejevk , 12 2 Narimanov , 13 2 Harabali , 14 2 Znamensk (Astrahanin agj) , 15 2 Ahtubinsk , 16 2 Belogorsk (Amuran agj) , 17 2 Bikin , 18 2 Amursk , 19 2 Budönnovsk , 20 2 Blagodarnii , 21 2 Sur' Kivi , 22 2 Spassk Dal'nii , 23 2 Nahotk , 24 2 Lesozavodsk , 25 2 Fokino (Merenrandaline rand)

out 2015: 1 3 Murasaki Sikibu , 2 3 Togo , 3 3 Kanad , 4 2 Rankagua , 5 2 Pnompen' , 6 2 Karakas , 7 2 Nepal , 8 2 Gvatemal , 9 2 Avstralii , 10 2 Peru , 11 2 Korejan Tazovaldkund , 12 2 Debrecen , 13 2 Kos'kenaluine , 14 2 Džamunan sild , 15 2 Bangladeš , 16 2 Facebook , 17 1 Feisbuk

nov 2015: 1 4 Kito , 2 4 Gvinei-Bisau , 3 2 Rävan (futbolklub) , 4 2 Käpaz (futbolklub) , 5 2 Sumgait (futbolklub) , 6 2 Zirä (futbolklub) , 7 2 Samarkand , 8 2 Nepal , 9 2 Ekvador , 10 2 Uoker Pol , 11 1 Jokoham

dez 2015: 1 3 Lugansk , 2 3 Doneck , 3 3 Kirjišt , 4 3 Lavrov Sergei , 5 3 Golos , 6 3 Makri Maurisio , 7 3 Ukrain , 8 3 Moskv , 9 2 Armastuz , 10 2 Poklonskaja Natal'ja , 11 2 Gerakl , 12 2 Apollon , 13 2 Itigran , 14 2 Gera , 15 2 Pharaoh , 16 2 Šoigu Sergei , 17 2 Gribojedovan kanal , 18 2 Satanovskii Jevgenii , 19 2 Barle , 20 2 Magadanan agj , 21 2 Mad'jaran kel' , 22 2 Lobez (lidn) , 23 2 Luganskan Rahvahaline Tazovaldkund , 24 2 Doneckan Rahvahaline Tazovaldkund , 25 2 Malindpeza (zamk)

jan 2016: 1 2 Ukrainan Rahvahaline Ühtištuz , 2 2 Suomenkel'ne Vikipedii , 3 2 Gal'špah , 4 2 Ižoran Vikipedii , 5 2 Lumenšur , 6 2 Livin Vikipedii , 7 2 Komin Vikipedii , 8 2 Udmurtan Vikipedii , 9 2 Venäkel'ne Vikipedii , 10 2 Kivi Obil , 11 2 Paksjogi , 12 2 Vepsän Vikipedii , 13 2 Kol , 14 2 Varšav , 15 2 Putin Vladimir , 16 1 Ciolkovskii (lidn)

fev 2016: 1 3 Bahmut , 2 2 Artömovsk (Doneckan agj) , 3 2 Ivanovon agj , 4 2 Muiktuz , 5 2 Himine ühtnend , 6 2 Mir , 7 2 Venälaižen valdkundan pämehed , 8 2 Päiväižen sistem , 9 2 Krasnoje Selo , 10 1 Aldan

mar 2016: 1 3 Kračkovskaja Natal'ja , 2 2 Ukrainan Rahvahaline Ühtištuz , 3 2 Astrahanin agj , 4 2 Užgorod , 5 2 Kremenčuk , 6 2 Lunkin Vitalii , 7 2 Venälaižen keitandan sömižiden nimikirjutez , 8 2 Kudrovo (Leningradan agj) , 9 2 Demidovan sild , 10 2 Trpin' , 11 2 Uz' Okkervil' , 12 2 Venäma Evrovizijal , 13 2 Zanevk , 14 2 Alauz'lidn , 15 2 Kallio Küösti , 16 2 Štol'berg Kaarlo Juho , 17 2 Latvii , 18 1 606 (kodiden serii)

abr 2016: 1 2 Nühaidai , 2 2 Rutracker.org , 3 2 8. reduku , 4 2 Krestovskii-stadion , 5 1 Futboline stadion Krestovskii-saren päivlaskmpol'žes palas

mai 2016: 1 4 Dnepropetrovsk , 2 3 Varn (lidn) , 3 3 Bugul'm , 4 3 Murmansk , 5 3 Čeboksarad , 6 3 Ulan Ude , 7 3 Moskv , 8 3 Joškar-Ol , 9 3 Elist , 10 2 Čilin valdkundznam , 11 2 Čilin flag , 12 2 Bilibino , 13 2 Elefantanvuiččed , 14 2 Pavlov Igor' , 15 2 Kaimol , 16 2 Vepsän mec , 17 2 Šugar'v , 18 2 Kamizäk , 19 2 Jeisk , 20 2 Anadir' , 21 2 Jaroslavl' , 22 2 Tümen' , 23 2 Tul , 24 2 Tomsk , 25 2 Rostov Donal

jun 2016: 1 3 Dnepropetrovsk , 2 3 Radajad lähttas \"Lümjer\"-fabrikaspäi , 3 3 Vologd , 4 3 Ukrain , 5 3 Kijev , 6 2 Gagarin (Smolenskan agj) , 7 2 Isil'kul' , 8 2 Tükalinsk , 9 2 Oblučje , 10 2 Pevek , 11 2 Dimitrovgrad (Venäma) , 12 2 Bariš (lidn) , 13 2 Berözovskii (Sverdlovskan agj) , 14 2 Artömovskii , 15 2 Asbest (lidn) , 16 2 Alapajevsk , 17 2 Aramil' , 18 2 Simferopol' , 19 2 De Agostini , 20 2 Lisičansk , 21 2 Lermontov (lidn) , 22 2 Kizlär , 23 2 Tomsk , 24 2 Kirov , 25 2 Kemerovo

jul 2016: 1 4 Aleksandr Maršal , 2 3 Ani Lorak , 3 3 Jegor Krid , 4 3 Nüša , 5 3 1984 , 6 3 Preslava , 7 3 Kirkorov Filipp , 8 3 Leont'jev Valerii , 9 2 Meladze Valerii , 10 2 Timur Rodrigez , 11 2 Dobrič , 12 2 1949 , 13 2 1967 , 14 2 1956 , 15 2 Noskov Nikolai , 16 2 Gagarin (Smolenskan agj) , 17 2 Bilibino , 18 2 Zaharova Marija , 19 2 Elgav , 20 2 Jurmal , 21 2 Alušt , 22 2 Venälaižen keitandan sömižiden nimikirjutez , 23 2 Loks , 24 2 Serafimovič , 25 2 Suraž

ago 2016: 1 4 Noskov Nikolai , 2 3 Sendak Moris , 3 3 Serbin (Tehas) , 4 3 Petuhov Anatolii , 5 2 Vorsm , 6 2 Tar (lidn) , 7 2 Paragvai , 8 2 Peru , 9 2 Pugačova Alla , 10 2 Šotlandii , 11 2 Savičeva Julija , 12 1 Dišu tišinoi

set 2016: 1 2 For You , 2 2 DruGoy , 3 2 Vibirat' čudo , 4 2 Dišu tišinoi , 5 2 Paranoja (al'bom) , 6 2 Po pojas v nebe , 7 2 Blaž , 8 2 Meladze Valerii , 9 2 Aleksandr Maršal , 10 2 Noskov Nikolai , 11 2 Dnepropetrovsk , 12 1 Šeksn (Šeksnan rajon)

out 2016: 1 2 1965 , 2 2 VIA Gra , 3 2 Ani Lorak , 4 2 Seišelan Sared , 5 2 Tova Mageina , 6 2 Bateti , 7 2 Moskv-Siti , 8 2 Estinma

nov 2016: 1 2 Čelentano Adriano , 2 2 Gott Karel , 3 2 Han Šahruh , 4 2 Douson Doris , 5 2 Lindemann Till' , 6 2 YouTube , 7 2 Kropyvnytsky , 8 2 Moldov , 9 2 Bolgarii , 10 1 Sergei Mihejev

dez 2016: 1 2 Lugansk , 2 2 Uz' Devätkino , 3 2 Litvanma , 4 2 Mustmägi , 5 2 Bosnii da Gercegovin , 6 1 Jen

jan 2017: 1 2 Phumipon Adul'jadet , 2 2 Koumanden planetan peituz , 3 2 Kosmine Harlok-merirazbainik (fil'm) , 4 2 Tel' Aviv , 5 2 Marsel' , 6 1 Hufun piramid

fev 2017: 1 2 Pušilin Denis , 2 2 Marakai , 3 2 Tokio , 4 2 Nitrugižbobaine , 5 2 Kropyvnytsky , 6 2 Pohjoižosetijan — Alanijan Tazovaldkund , 7 2 Afganistanan valdkundznam , 8 2 Siktivkar , 9 1 Vjetnaman Vikipedii

mar 2017: 1 2 Gakt , 2 2 Kriman Avtonomine Tazovaldkund , 3 2 Franklin Rozalind , 4 2 Severodvinsk , 5 1 Nikolai Drozdov

abr 2017: 1 4 Azii , 2 3 Evrop , 3 2 Sasmi Angun Čipta , 4 2 Devgan Adžai , 5 2 Kan Son , 6 2 Šiprage , 7 2 Bel'mondo Žan Pol' , 8 2 Bhatt Alija , 9 2 Aleksandr Maršal , 10 2 Kremenčuk , 11 2 Cin' Šihuandi , 12 2 Bahčisarai , 13 2 Franklin Rozalind , 14 2 Alöna Mun , 15 2 Sennheiser , 16 2 Adams Duglas , 17 2 Al'gardi Mikelandželo , 18 2 Oreo , 19 2 Bolen Diter , 20 2 Balabanov Aleksei , 21 2 Ahmatova Anna , 22 2 Beriša Sali , 23 2 Tatarstanan Tazovaldkund , 24 2 Venäman Tazovaldkundad , 25 2 Abramov Nikolai

mai 2017: 1 2 Sobral Salvador , 2 2 Napoleon I Bonapart , 3 2 Gai Julii Cezar' , 4 2 Dikkens Čarl'z , 5 2 Phumipon Adul'jadet , 6 2 Satanovskii Jevgenii , 7 2 Murasaki Sikibu , 8 2 Aslino Fransua , 9 2 Samoilova Tat'jana , 10 2 Demidov Ivan (pokervändai) , 11 2 Uorhol Endi , 12 2 Dali Sal'vador , 13 2 Dvoržak Antonin , 14 2 Disnei Uolt , 15 2 Savant Merilin vos , 16 2 Franklin Rozalind , 17 2 Sendak Moris , 18 2 Fasmer Maks , 19 2 Semönov Pötr , 20 2 Petri Julius Rihard , 21 2 Vernadskii Vladimir , 22 2 Merežkovskii Dmitrii , 23 2 Dahno Vladimir , 24 2 Čaves Ugo , 25 2 Štil'mark Robert

jun 2017: 1 3 Šiprage , 2 2 Kirovograd , 3 2 Rube , 4 2 Vestonicen Vener , 5 2 Ukrainan Vikipedii , 6 2 Kondjanbol , 7 2 Kropyvnytsky , 8 2 Anglii , 9 2 Santa Marija Podžo , 10 2 Alamad , 11 1 Themin

jul 2017: 1 2 Kara , 2 2 Leps Grigorii , 3 2 Makron Emmanuel' , 4 2 VIA Gra , 5 2 Doneck , 6 2 Ekseter , 7 2 Peipusjärv , 8 2 Omsk , 9 2 Brüssel' , 10 1 .ba

ago 2017: 1 7 Lugansk , 2 7 Doneck , 3 2 Maidanov Denis , 4 2 Poklonskaja Natal'ja , 5 2 Vičenc , 6 1 Vasilii Livanov

set 2017: 1 6 Thejön Kim , 2 2 Vas'kov Miku , 3 2 Aigan irdpoles , 4 2 Vavilonii , 5 2 Čon Džessika , 6 2 Peru , 7 2 Užur , 8 1 Miku Vas'kov

out 2017: 1 3 Evrejan kel' , 2 2 Aig armastada , 3 2 Tegendad päzutandha näht , 4 2 Makati , 5 2 Vepsän kel' , 6 1 Tempo de Amar

nov 2017: 1 2 Litmanen Jari , 2 2 Nimidä ei jä mugoman-žo , 3 2 Angelan mod (Brazilijan TV-serial, 2016) , 4 2 Sestrikaine , 5 2 Zimbabve , 6 2 Niinistö Sauli , 7 1 Jari Litmanen

dez 2017: 1 3 Tropikanka , 2 3 Viipur , 3 2 .cz , 4 2 Pržibram , 5 2 Slovakan kel' , 6 2 Liberec , 7 2 Wanna One , 8 2 Pl'zen' , 9 2 Olomouc , 10 2 Muštatišiden kirj , 11 1 Artöm

jan 2018: 1 2 Čehijan kron , 2 2 El'b , 3 2 Vltav , 4 2 Pržibram , 5 2 Ciolkovskii (lidn) , 6 2 Protomelas annectens , 7 2 Raštvad , 8 2 Födorova Oksana , 9 2 Mägr

fev 2018: 1 2 Aigan irdpoles , 2 2 Beregovo , 3 2 Emi S'juzi , 4 2 Anžero-Sudžensk , 5 2 Drozdenko Aleksandr , 6 2 Etilspirt , 7 2 Beatriks , 8 2 Čerepovec , 9 2 Tu-154 , 10 1 Primorsk (lidn, Leningradan agj)

mar 2018: 1 2 Džekson Maikl , 2 2 Pragan metropoliten , 3 2 Kurosava Akira , 4 2 Nakhonratčasim , 5 2 Mjanmar , 6 2 Peru , 7 2 Ristit , 8 2 Bad Boys Blue , 9 2 Buddizm , 10 2 Kalug , 11 2 System of a Down , 12 1 Höna

Wikipedias are initially ordered by number of speakers of the language

Speakers: Number of speakers of a language is the estimated total of primary and secondary speakers, is in many cases a very rough estimation (based on the page on the English Wikipedia about that language)
Regions are parts of the world where the language is spoken in substantial amounts (compared to total number of speakers). Regions where a language gained presence only by a recent diaspora are generally not included.
Region codes: AF:Africa, AS:Asia, EU:Europe, NA:North America, OC:Oceania, SA:South America, W:World Wide, CL:Constructed Language

Estatísticas geradas em Terça-feira, 17 de abril 2018 21:36

Dump file vepwiki-20180401-stub-meta-history.xml.gz (edits only), size 6.6 Mb as gz -> 46 Mb
Dump processed till Mar 31, 2018, on server stat1005, ready at Sat-07/04/2018-17:00 after 33 sec.

Autor:Erik Zachte (Sítio web)
Endereço:ezachte@### (no spam: ### = wikimedia.org)
Documentation / Scripts / CSV files: About WikiStats

All data and images on this page are in the public domain.