Estatísticas da Wikipédia zealandic

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Articles per size range / Records per namespace / Most edited articles / Zeitgeist
 
Jan 31, 2019: This is the final release of Wikistats-1 dump-based reports. Part of these data are available in the first release of Wikistats 2. Read more here

 

Most metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.

Some metrics have been collected from the full archive dump which runs on lower frequency than the usual monthly cycle.
These metrics are columns F,I,J,K,M,N,O,P,Q,R from the first table.


See also metrics definitions


 
Monthly counts & Quarterly rankings: dezembro 2018
 
DataWikipedistasArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
dez 2018+1%   +3%      +171%      +1%
nov 20180%   0%      +69%      +1%
out 20180%   0%      +153%      0%
set 2018+3%   0%      +74%      0%
ago 20180%   0%      +86%      0%
jul 20180%   0%      -50%      0%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P____Q____R____S__
dez 2018681214,6 k 417,8   786      1,5 k
nov 201867 414,5 k 118,1   290      1,4 k
out 201867 114,5 k  18,2   172      1,4 k
set 20186723 4,4 k  18,1   68      1,4 k
ago 201865 1 4,4 k  18,1   39      1,4 k
jul 201865 2 4,4 k  18,1   21      1,4 k
jun 201865 2 4,4 k  18,1   42      1,4 k
mai 201865 1 4,4 k  18,1   65      1,4 k
abr 201865 214,4 k  18,1   360      1,4 k
mar 201865 2 4,4 k  18   87      1,4 k
fev 201865 314,4 k  18   790      1,4 k
jan 201865 414,4 k  17,9   200      1,4 k
dez 201765 2 4,4 k  17,9   103      1,4 k
nov 201765   4,4 k  17,9   30      1,4 k
out 20176514 4,4 k  17,9   79      1,4 k
set 201764 1 4,4 k  17,9   24      1,4 k
ago 201764   4,4 k  17,9   13      1,4 k
jul 20176412 4,4 k  17,9   28      1,4 k
jun 2017631  4,4 k  17,9   22      1,4 k
mai 201762 1 4,4 k  17,9   21      1,4 k
abr 201762 1 4,4 k  17,9   21      1,4 k
mar 201762 3 4,4 k  17,9   83      1,4 k
fev 20176213 4,4 k  17,9   63      1,4 k
jan 201761 2 4,4 k  17,9   118      1,4 k
dez 201661 314,4 k  17,9   247      1,4 k
nov 2016611414,4 k 217,8   3,6 k      1,4 k
out 201660 1 4,3 k  17,2   16      1,3 k
set 201660 1 4,3 k  17,2   23      1,3 k
ago 201660   4,3 k  17,2   22      1,3 k
jul 201660 3 4,3 k  17,2   37      1,3 k
jun 201660 1 4,3 k  17,2   31      1,3 k
mai 201660   4,3 k  17,2   17      1,3 k
abr 20166012 4,3 k  17,2   63      1,3 k
mar 201659 4 4,3 k  17,2   66      1,3 k
fev 201659 1 4,3 k  17,2   39      1,3 k
jan 20165912 4,3 k  17,2   52      1,3 k
dez 201558   4,3 k  17,2   26      1,3 k
nov 201558 2 4,3 k  17,2   54      1,3 k
out 201558   4,3 k  17,2   28      1,3 k
set 201558 1 4,3 k  17,2   36      1,3 k
ago 201558   4,3 k  17,2   38      1,3 k
jul 201558 1 4,3 k  17,2   51      1,3 k
jun 201558 1 4,3 k  17,2   14      1,3 k
mai 2015581214,3 k  17,2   147      1,3 k
abr 201557 1 4,3 k  17,1   36      1,3 k
mar 20155722 4,3 k  17,1   158      1,3 k
fev 201555 1 4,3 k  17,1   67      1,3 k
jan 201555 1 4,3 k  17,1   80      1,3 k
dez 20145511 4,3 k  17,2   89      1,3 k
nov 20145424 4,3 k  17,2   86      1,2 k
out 201452 1 4,3 k  17,2   112      1,2 k
set 20145212 4,2 k  17,2   51      1,2 k
ago 20145112 4,2 k  17,2   72      1,2 k
jul 201450   4,2 k  17,2   96      1,2 k
jun 20145013 4,2 k  17,2   147      1,2 k
mai 201449 3 4,2 k  17,2   109      1,2 k
abr 20144927 4,2 k  17,2   239      1,2 k
mar 201447 3 4,2 k  17,2   158      1,2 k
fev 2014471714,2 k3,8 k217,2156076%10%4758,4 Mb1,0 M50 k5143611,2 k1,2 k
jan 201446 414,1 k3,8 k117,3156777%10%5368,4 Mb1,0 M49 k4933541,1 k1,2 k
dez 2013462714,1 k3,7 k217,4157277%10%4468,3 Mb1,0 M49 k7273401,1 k1,2 k
nov 201344 524,1 k3,7 k117,5157977%10%6058,2 Mb997 k48 k7573261,1 k1,1 k
out 201344 424,0 k3,6 k417,5157377%10%8988,1 Mb982 k47 k7283231,0 k1,1 k
set 2013442323,9 k3,5 k417,9159678%10%5128,0 Mb962 k45 k6223159671,0 k
ago 20134211 3,8 k3,5 k 18,3162980%10%567,9 Mb954 k45 k5403159421,0 k
jul 201341 3 3,8 k3,4 k118,3162880%10%1267,9 Mb953 k45 k520316933996
jun 201341 2 3,7 k3,4 k 18,3163280%10%1247,9 Mb950 k45 k516314908985
mai 201341 113,7 k3,4 k118,4163280%10%1747,9 Mb948 k45 k656314898981
abr 201341 213,7 k3,4 k118,4162180%10%4757,8 Mb936 k45 k662303878961
mar 201341 313,7 k3,4 k118,5161580%10%4,1 k7,8 Mb924 k44 k6,9 k299853928
fev 201341 313,6 k3,4 k217,5161680%10%1,7 k12 Mb918 k44 k172 k300833915
jan 201341 513,6 k3,3 k117,3162581%10%3,7 k11 Mb907 k43 k166 k295797895
dez 201241 413,6 k3,3 k116,4161581%9%1,5 k11 Mb890 k43 k161 k293748873
nov 2012411513,5 k3,2 k216,1160581%9%1,1 k11 Mb876 k42 k159 k293711839
out 201240 413,4 k3,2 k216,1157081%9%2,0 k11 Mb841 k41 k156 k299624801
set 201240 513,4 k3,1 k315,9156381%8%1,4 k10 Mb821 k39 k152 k294576714
ago 201240 423,3 k3,0 k215,9155982%8%3,9 k10 Mb797 k38 k146 k232527609
jul 2012401413,2 k2,9 k315,1155182%7%1,6 k9,6 Mb777 k36 k132 k226450531
jun 2012392513,1 k2,8 k515,1155282%7%1,4 k9,1 Mb750 k35 k121 k225401495
mai 2012371313,0 k2,7 k115,3152484%6%8308,6 Mb691 k34 k112 k226366473
abr 201236 112,9 k2,7 k215,1152184%6%7548,5 Mb685 k33 k111 k227358457
mar 201236 312,9 k2,7 k 15,2154585%6%7558,3 Mb682 k33 k103 k226351454
fev 201236 4 2,9 k2,6 k 15154985%6%6788,3 Mb680 k33 k102 k226343448
jan 201236 222,9 k2,6 k114,8155285%6%8,9 k8,2 Mb679 k33 k101 k224337443
dez 201136 2 2,8 k2,6 k411,8155186%6%7248,2 Mb672 k31 k99 k93314330
nov 201136 3 2,7 k2,5 k3012155185%6%1,6 k7,9 Mb646 k30 k96 k91310327
out 20113613 1,8 k1,6 k117,1146979%9%9735,2 Mb402 k23 k77 k92297322
set 201135 211,8 k1,6 k617147579%9%1,0 k5,1 Mb395 k23 k75 k91262313
ago 20113513 1,6 k1,5 k2318,1159487%9%1,2 k4,7 Mb387 k22 k62 k87227307
jul 20113424 896802131,2148077%17%5022,6 Mb194 k16 k47 k86217307
jun 201132 1 877789131,3149177%17%6092,6 Mb191 k16 k46 k87217300
mai 201132 1 861774131,2149177%17%5452,5 Mb187 k15 k46 k86211299
abr 201132 1 821737 32149277%18%4612,4 Mb178 k15 k45 k90210296
mar 201132 2 817731 31,6149577%18%7742,4 Mb177 k15 k44 k92204294
fev 20113212 815730 30,8149677%18%3742,4 Mb177 k15 k44 k92204293
jan 20113112 814730 30,3149877%18%7142,4 Mb177 k15 k44 k92203293
dez 201030 2 812729 29,5150377%18%4962,3 Mb177 k15 k43 k92200293
nov 201030 2 811728 29150477%18%4372,3 Mb176 k15 k42 k95198293
out 201030 1 806724 28,6150877%18%3602,3 Mb176 k15 k42 k90195292
set 201030132805722 28,2150777%18%9852,3 Mb175 k15 k42 k92183292
ago 201029 1 797715 27,2151677%19%5222,3 Mb175 k15 k41 k93179289
jul 201029 1 791709 26,8152177%19%4902,2 Mb174 k15 k40 k94178284
jun 20102912 790708 26,2152377%19%7382,2 Mb174 k15 k40 k95178284
mai 201028131785704 25,4153078%19%8282,3 Mb174 k15 k39 k95176282
abr 20102711 776701 24,7154379%19%4292,2 Mb173 k15 k39 k95173278
mar 201026 2 772699 24,2154079%19%4732,2 Mb172 k15 k39 k96173278
fev 201026 1 769696 23,7153879%19%4322,2 Mb171 k15 k38 k98172278
jan 201026 4 768695 23,2153279%19%3582,2 Mb171 k15 k38 k106172277
dez 20092613 763690 22,9153779%19%4562,2 Mb170 k15 k38 k112171273
nov 200925 1 761687 22,3153779%19%4302,2 Mb170 k15 k38 k117171272
out 20092511 758685 21,8154079%19%5122,2 Mb169 k15 k37 k119170272
set 200924 2 753682 21,3154880%19%5742,1 Mb169 k15 k37 k126170270
ago 20092411 752681 20,6155280%19%6552,1 Mb169 k15 k36 k259170270
jul 200923 1 748680 19,8154980%19%6592,1 Mb168 k15 k36 k269169269
jun 200923 1 741672 19,1155880%19%4812,1 Mb167 k15 k35 k274167264
mai 200923 1 739670 18,5156080%19%3932,1 Mb167 k15 k35 k282167262
abr 200923   737668 18156480%20%5372,1 Mb167 k15 k35 k280167261
mar 200923   737668 17,3156380%20%3282,0 Mb167 k15 k34 k280167261
fev 200923   734668 16,9156981%20%2542,0 Mb167 k15 k34 k279167261
jan 200923 2 733668 16,6156981%20%6832,0 Mb167 k15 k34 k279167261
dez 20082311 730666 15,7157181%20%3312,0 Mb166 k15 k33 k276166261
nov 20082212 728665 15,3157281%20%2662,0 Mb166 k15 k33 k276166260
out 200821   724661 15157881%20%4212,0 Mb166 k14 k33 k277165256
set 200821 3 723661 14,5157881%20%4312,0 Mb166 k14 k32 k277165256
ago 200821231717655 14158481%20%5812,0 Mb165 k14 k32 k278158242
jul 200819 1 709649113,3159682%20%3942,0 Mb164 k14 k32 k276155224
jun 200819 21689626213,1156881%20%7241,9 Mb158 k13 k30 k283153220
mai 200819131618526113,5153474%20%7251,6 Mb139 k12 k27 k302128201
abr 200818372589476 12,9148669%20%1,3 k1,5 Mb128 k11 k25 k580115156
mar 200815 31574437111,1142365%19%3841,4 Mb119 k10,0 k23 k178109155
fev 200815142543396111133861%18%6911,2 Mb106 k8,9 k22 k17797147
jan 200814121505350110,4125758%16%6281,1 Mb93 k7,9 k21 k16692129
dez 200713 2 461277110,1110150%14%619955 kb75 k6,3 k19 k14685116
nov 20071313142924649,4105146%14%680852 kb67 k5,4 k17 k14185115
out 20071223 312194 10,7107748%13%405650 kb51 k4,2 k14 k11783112
set 200710 1 305189 9,6108548%13%289629 kb50 k4,2 k13 k11280112
ago 200710 1 302186 8,8108148%13%183611 kb49 k4,1 k13 k11178111
jul 20071013229918468,3106948%13%1,3 k601 kb49 k4,1 k13 k11177100
jun 2007924112711729,2181475%28%348334 kb36 k3,1 k2,8 k446339
mai 2007712 8279 10164578%23%185203 kb20 k2,0 k2,0 k403224
abr 20076   7065 9,1146377%20%27144 kb15 k1,5 k1,3 k403020
mar 20076 1 6561 9,4141275%22%50131 kb13 k1,4 k1,2 k382720
fev 2007612 6259 9145077%21%171125 kb13 k1,3 k1,0 k381918
jan 20075 1 5450 7,2145874%22%40108 kb11 k1,2 k884371715
dez 2006523 4845 7,2152473%25%90101 kb10 k1,1 k853321712
nov 20063 2 3834 6,8169379%29%6086 kb8,8 k944693311710
out 20063141302916,6190790%37%16880 kb8,3 k85366727158
set 20062   12 301122100% 54,7 kb32242113 71
ago 20062    1  1892  43,5 kb256426  1
jul 20062    1  1869   3,5 kb253425  1
jun 20062    1  1869  23,5 kb253425  1
mai 20062    1  1711  23,5 kb235425  1
abr 20062    1  1711   3,5 kb235425  1
mar 20062    1  1711  33,5 kb235425  1
fev 20062    1  1793   3,5 kb250425  1
jan 20062    1  1793   3,5 kb250425  1
dez 20052    1  1793  13,5 kb250425  1
nov 20052    1  1611  23,1 kb227425  1
out 20052    1  1603  13,1 kb226425  1
set 200521   1  1599  23,1 kb226425  1
ago 20051    1  1595  13,1 kb225425  1
jul 2005111  1  1590  73,1 kb224425  1
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
The following table ranks this project in relation to projects in other languages with 1000+ articles
out 2018188 208149181  137   158      278
jul 2018190 187 180  140   222      278
abr 2018187 183154179  141   137      278
jan 2018187 148149178  142   159      278
out 2017184146140 177  146   182      278
jul 2017183143197 177  146   227      278
abr 2017183 207 174  148   218      278
jan 2017183 178 174  149   171      278
out 2016183 209 171  157   233      278
jul 2016182 155 169  156   194      278
abr 2016180137180 169  157   182      278
jan 2016178154188 167  158   196      278
out 2015178   164  160   216      278
jul 2015176 202 162  165   189      278
abr 2015173 219 161  165   217      278
jan 2015177 204 160  160   184      278
out 2014177 201 160  162   160      278
jul 2014178   159  161   174      278
abr 2014178124106 158  162   148      278
jan 201417917414314415614215816310180147123148141144185221183278
out 20131781681439715714291165997914598149141145172223187278
jul 20131831451511381581401531679265145163147140142194222188278
abr 20131801521821511571401581699264144150147138141189218188277
jan 20131771511281501551381581749155142119153137141156215188277
out 20121761501361381551401161799552148139152138139159216196277
jul 20121741401451431571431011779749156145154139146165224203277
abr 20121781432071451621441241779740165201159139145172222207277
jan 2012176162175104160143145172923416277156137144175222208277
out 20111691441591511811641551579346140191182156156187244210277
jul 2011173115140145210187165208207206203217207183169205246218277
abr 2011172152205136209188162203202201198209206183166205243214277
jan 2011169144183141207183162201200199196203205178160200241209277
out 2010168156207135201178157193192191189213196176158195237207277
jul 2010166169210143198175160189188187185200194172158190234204277
abr 2010164144206142193171161186185184183207189166156189234198277
jan 2010162150140134189170156183183182181196185164156185228196277
out 2009160141201137185167161181181180179188185163153181224194277
jul 2009163196195137181162152173173172171184180165149176194192277
abr 2009155146212147180160147170170169168177176160146170193192277
jan 2009153135168135173154149165165164163173168153141167187188276
out 2008155143210137167149147159159158157182162149136159182188274
jul 2008155156201134165144142152152151149185159146132156177182273
abr 2008151769599161147154147147145143131160147137156135184273
jan 2008159140182133157147152143143141140147166157143156178184269
out 200715998136136163166151141141139139171181170155161182177267
jul 20071661421409715816087134134133131105173165151153175173262
abr 2007183144194128191181143126126126124203196181168199191187257
jan 2007181125175127189178140122122122120196191180167196185193254
out 2006206126114118195178136114114114113148186173167194187189251
jul 2006205128170111238233120105105105105233230228204230228227238
abr 200619113017311123222012292929291227219218188222209221233
jan 20061681081499221419610885858584205199197168205186202215
out 2005160101131872091909981818180198190184159201169200213
jul 200517188118831991759070707070145175168146187149180202
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
 WikipedistasArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikipedistas (usuários registrados)
A = Wikipedistas que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikipedistas que editaram pelo menos dez vezes desde que chegaram
C = Wikipedistas que contribuíram cinco vezes ou mais este mês
D = Wikipedistas que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Artigos que contêm pelo menos uma ligação interna e 200 caracteres de texto legível, não contando códigos wiki e html,
      ligações ocultas, etc.; títulos também não contam (outras colunas são baseadas no método oficial de contagem)
G = Novos artigos por dia no mês passado
H = Número médio de revisões por artigo
I = Tamanho médio dos artigos em bytes
J = Porcentagem de artigos com pelo menos 0,5 kb de texto legível (veja F)
K = Porcentagem de artigos com pelo menos 2 kb de texto legível (veja F)

Base de dados
L = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
M = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
N = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
O = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
P = Total de ligações para outras wikipédias
Q = Total de imagens apresentadas
R = Total de ligações para outros sítios
S = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  2500  5  10  100  1000  1  3  5  10  25  100  250  5  10  1  3  5  10  25  100  250  5  10  100 
dez 201810221111      411111   21111     
nov 20188442111      1111111  22221     
out 20181221111       11111    4211      
set 201874321       111      1         
ago 201852111                1         
jul 2018732         1111               
jun 20186321        2        1         
mai 201862111       1111     211       
abr 20187322111      21111    3211      
mar 201882211       11111    411       
fev 201814431111  1   311111   61111     
jan 20181044211       3111     3111      
dez 201792211       21111    11     1  
nov 201761     1   41       21111     
out 201711442        3        2         
set 2017511                  2         
ago 201731         1        1         
jul 20177321        1        111       
jun 201782         2        31111     
mai 2017631                  11111  1  
abr 2017721                  1         
mar 201764321       111      311       
fev 20175332    1            3         
jan 201792221   11           4         
out 20181221111       11111    4211      
jul 2018732         1111               
abr 20187322111      21111    3211      
jan 20181044211       3111     3111      
out 201711442        3        2         
jul 20177321        1        111       
abr 2017721                  1         
jan 201792221   11           4         
out 2016331         2        3         
jul 20161133         22       3         
abr 201682221       2        52        
jan 201613421        3        71        
out 201571                  1      1  
jul 20159211        1        1         
abr 20151121         5      222      11 
jan 20159211        31       62        
out 2014153111       2        622       
jul 20148      11  1        4111      
abr 2014208763       6321     11532      
jan 20141654431   111 8433     105311     
out 201314544422      74321    133222     
jul 2013124311       2        831       
abr 2013932221   44  1        7      43 
jan 201315553311  23137172211    123321  64 
out 201217744411  16104 531      12432   521
jul 20129544411  14122 521      12222   75 
abr 2012221111   15131 31       511    82 
jan 201272222211 151031422      94111  61 
out 2011123332   19142 1        9      1291
jul 201165421   1611  311      9211   62 
abr 2011831     871 3        511    95 
jan 201193221   15103 1        7111   1282
out 2010911     1381 2        111     95 
jul 2010531     1571 2        942    841
abr 201052111   147  3        73     961
jan 201074411   87  522      7321   43 
out 20095211    1511  2        5      43 
jul 200963111   1371 211      6111   41 
abr 200941     881          522    65 
jan 200952211   1082 3        175321  54 
out 20082      1171 1        1444    431
jul 200851111   1081 41       17521   421
abr 20088874222  108  11       8321      
jan 20085422111  65  42       85211  1  
out 20075432    551 7322     742       
jul 20076632221  32  76541    953311 2  
abr 200741         511      5332      
jan 20073211        311      3222   1  
out 2006754211   11  106311    197511  11 
jul 2006                              
abr 2006                              
jan 2006                              
out 20051                             
jul 2005111                            

 

Distribuição de edições de artigos por wikipedistas
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikipedistasEdições total
1499100.0%27,682100.0%
312625.3%27,14698.1%
106713.4%26,80796.8%
32408.0%26,38695.3%
100234.6%25,44691.9%
316122.4%23,80386.0%
100051.0%20,00372.3%
316230.6%17,07261.7%

 

10 wikipedistas recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdições 
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
 agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
WwikixUC2 06,4927542,152302mar 17, 20161018225131--
OoswesthoesbesUC3 03,4442284-set 22, 2007411796---
LotjeUC10 04191105-out 28, 201029851---
DARIO SEVERIUC33 04816-mar 28, 201610071---
StipenstoerUC58+40137--set 21, 201810021--
ErcéUC62+41111-out 09, 20131908----
BillinghurstUC147+58315-mai 13, 20132057----
Born2bgratisUC497...11--dez 03, 201827----
FogueraCUC498...11--dez 08, 201822----
Esteban16UC499...11--dez 14, 201816----

 

20 wikipedistas recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
  Primeira ediçãoúltima edição
 posiçãototaldatadias
atrás
datadias
atrás
OuddorpUC17,136ago 24, 20112685jan 10, 2018354
TamatauengaUC41,874nov 03, 20074075nov 21, 20083691
SteinbachUC51,057jul 26, 20054905nov 07, 201853
Henk KUC6948jul 03, 20074198jul 27, 20074174
BHJ15UC7861set 19, 20131928jun 20, 2017558
WikixUC8490ago 10, 20074160ago 20, 20112689
OverkanteUC9428jun 29, 20122375jul 11, 20131998
BistromaticUC11333out 01, 20074108jun 23, 20103112
WasschappelaerUC12321mai 18, 20122417out 21, 20141531
Scottishmain in your bedroom?UC13255abr 12, 20083914abr 12, 20083914
SangamUC14233out 16, 20122266abr 30, 20141705
RobotjeUC15189ago 27, 20083777mai 09, 20112792
AndrewricereturnsUC16148set 12, 20103031set 12, 20103031
DrewesUC17137dez 20, 20131836nov 04, 201856
Suriminiworst5UC18129set 18, 20131929nov 16, 20131870
Stephan 0796UC19118mar 09, 20161026jun 08, 2017570
MagioladitisUC20116mai 10, 20151330mai 10, 20151330
SuikerdruifjeUC21108dez 06, 20064407jul 16, 20074185
Erik WarmelinkUC22106jan 11, 20103275abr 14, 20112817
CycnUC23104nov 22, 20141499nov 09, 201851

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 3.270 edições foram feitas por usuários anônimos, de um total de 81.907 edições ( 3e %)
  


50 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições 
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
 datadias
atrás
datadias
atrás
OwtbBotUC15,732out 10, 20074099jan 19, 20122537--
EmausBotUC25,078jul 09, 20103096nov 05, 201855233-
MerlIwBotUC35,041abr 26, 20112805ago 08, 20131970159-
XqbotUC43,470jun 22, 20093478abr 10, 201826431-
LegobotUC53,047mar 11, 20132120abr 02, 20132098--
SieBotUC62,635mai 25, 20074237jan 19, 20112902--
TXiKiBoTUC72,279jul 09, 20074192jan 09, 201321811-
Luckas-botUC82,082jul 02, 20093468mai 20, 2012241572-
EscarbotUC91,552mai 05, 20074257jan 26, 2017703353-
VolkovBotUC101,504out 30, 20074079fev 19, 2013214010-
ZéroBotUC111,367out 19, 20102994mar 06, 2013212559-
JAnDbotUC121,366fev 19, 20074332jul 01, 20132008--
WikitanvirBotUC131,360nov 07, 20102975mai 03, 2012243213-
YFdyh-botUC14982jul 01, 20122373fev 13, 20132146--
ArthurBotUC15868set 15, 20093393set 09, 20122303268-
MelancholieBotUC16817mai 12, 20083884nov 26, 20093321--
RedBotUC17807out 21, 20102992ago 22, 20122321402-
AddbotUC18795mar 07, 20132124jun 25, 20132014--
LaaknorBotUC19787jul 12, 20093458mar 03, 20132128--
CarsracBotUC20628abr 22, 20083904fev 18, 20132141--
GrouchoBotUC21486mar 28, 20103199mar 04, 20132127--
FoxBotUC22473out 01, 20093377fev 05, 201225202-
TjBotUC23452fev 20, 20112870mar 05, 20132126--
AlleborgoBotUC24434dez 18, 20074030dez 15, 20083667--
PtbotgourouUC25354set 26, 20083747mar 04, 2013212710-
KamikazeBotUC26352jul 04, 20103101jan 26, 201321641-
HRoestBotUC27336jun 24, 20103111fev 11, 201321488-
LovelessUC28315mai 12, 20074250dez 30, 20112557--
Ripchip BotUC29300mar 08, 20112854fev 18, 2012250711-
Makecat-botUC30276out 28, 20122254mar 05, 20132126--
VagobotUC31267nov 01, 20112616set 19, 201222931-
JackieBotUC32220jan 04, 20112917fev 24, 201321351-
MjbmrbotUC33219nov 04, 20102978mar 28, 20112834--
RobbotUC34199out 16, 20064458jan 03, 20132187--
AvocatoBotUC35193ago 06, 20112703mai 18, 20122417--
SynthebotUC36188dez 11, 20083671jan 27, 20132163--
Idioma-botUC37183jan 16, 20103270fev 12, 20132147--
MystBotUC38181jul 07, 20103098fev 20, 2012250586-
BotMultichillUC39180mai 28, 20074234abr 17, 20112814--
CommonsDelinkerUC40172mar 28, 20083929out 28, 201863--
Thijs!botUC41169set 01, 20083772out 15, 20122267--
AvicBotUC42168jun 18, 20112752dez 09, 20122212--
PipepBotUC43154ago 17, 20074153set 07, 20083766--
AlexbotUC44154fev 24, 20083962ago 26, 20112683--
MauritsBotUC45151jun 17, 20093483fev 01, 20103254--
Dinamik-botUC46148fev 21, 20103234dez 22, 20122199--
RubinbotUC47145jul 07, 20093463mar 02, 201321291-
DragonBotUC48123jan 13, 20132177jan 14, 20132176--
MastiBotUC49117nov 16, 20093331mar 04, 2013212712-
GerakibotUC50110jan 10, 20103276mar 06, 20132125--

 

Artigos que contêm pelo menos uma ligação interna e .. caracteres de texto legível, não contando códigos wiki e html,
ligações ocultas, etc.; títulos também não contam  (excluindo páginas de redirecionamento)

DataArtigos
 < 32 ch< 64 ch< 128 ch< 256 ch< 512 ch< 1 k ch< 2 k ch< 4 k ch< 8 k ch< 16 k ch< 32 k ch< 64 k ch
out 20100.0%0.1%2.6%11.1%21.9%53.8%81.4%92.8%98.4%99.7%100.0%100.0%
set 20100.0%0.3%2.8%11.3%22.2%53.9%81.4%92.8%98.5%99.8%100.0%100.0%
ago 20100.0%0.3%2.8%11.3%22.0%53.7%81.2%92.7%98.4%99.7%100.0%100.0%
jul 20100.0%0.3%2.9%11.3%21.8%53.5%81.1%92.7%98.5%99.8%100.0%100.0%
jun 20100.0%0.3%2.9%11.2%21.7%53.5%81.2%92.9%98.7%100.0%100.0%100.0%
mai 20100.0%0.3%2.9%11.1%21.2%53.2%81.0%92.7%98.5%99.8%100.0%100.0%
abr 20100.0%0.0%2.0%10.7%20.6%52.6%80.7%92.5%98.4%99.7%100.0%100.0%
mar 20100.0%0.0%2.0%10.7%20.6%52.7%80.8%92.5%98.4%99.7%100.0%100.0%
fev 20100.0%0.0%2.0%10.8%20.6%52.7%80.9%92.6%98.5%99.8%100.0%100.0%
jan 20100.0%0.0%2.0%10.8%20.6%52.9%81.0%92.7%98.5%99.8%100.0%100.0%
dez 20090.0%0.0%2.0%10.9%20.5%52.7%80.8%92.6%98.5%99.7%100.0%100.0%
nov 20090.0%0.1%2.1%11.0%20.5%52.6%80.8%92.6%98.6%99.8%100.0%100.0%
out 20090.0%0.0%2.0%10.9%20.3%52.5%80.7%92.5%98.5%99.7%100.0%100.0%
set 20090.0%0.0%1.9%10.6%19.8%52.2%80.6%92.5%98.5%99.7%100.0%100.0%
ago 20090.0%0.0%1.9%10.5%19.6%52.1%80.4%92.5%98.5%99.7%100.0%100.0%
jul 20090.0%0.0%1.8%10.3%19.5%52.2%80.5%92.5%98.6%99.8%100.0%100.0%
jun 20090.0%0.0%1.8%10.2%19.2%51.9%80.5%92.5%98.6%99.8%100.0%100.0%
mai 20090.0%0.0%1.8%10.3%19.3%51.8%80.4%92.4%98.5%99.7%100.0%100.0%
abr 20090.0%0.0%1.8%10.1%19.0%51.6%80.3%92.3%98.5%99.7%100.0%100.0%
mar 20090.0%0.0%1.8%10.1%19.0%51.7%80.3%92.3%98.5%99.7%100.0%100.0%
fev 20090.0%0.0%1.6%9.7%18.6%51.4%80.1%92.2%98.4%99.6%99.9%99.9%
jan 20090.0%0.0%1.6%9.7%18.6%51.4%80.1%92.2%98.4%99.6%99.9%99.9%
dez 20080.0%0.0%1.5%9.8%18.6%51.8%80.1%92.2%98.4%99.6%99.9%99.9%
nov 20080.0%0.0%1.5%9.8%18.6%51.7%80.0%92.2%98.4%99.6%99.9%99.9%
out 20080.0%0.0%1.3%9.6%18.4%51.8%80.0%92.2%98.5%99.8%100.0%100.0%
set 20080.0%0.0%1.3%9.6%18.4%51.8%80.0%92.2%98.5%99.8%100.0%100.0%
ago 20080.0%0.0%1.3%9.7%18.3%51.8%79.9%92.2%98.5%99.8%100.0%100.0%
jul 20080.0%0.0%1.1%9.3%18.0%51.3%79.5%92.0%98.4%99.7%100.0%100.0%
jun 20080.0%0.0%1.5%10.1%18.9%51.3%80.1%92.2%98.6%99.9%100.0%100.0%
mai 20080.0%0.7%3.3%16.3%25.4%53.4%79.6%91.8%98.5%99.8%100.0%100.0%
abr 20080.2%1.1%5.9%21.1%30.2%56.9%80.5%92.1%98.6%100.0%100.0%100.0%
mar 20080.2%1.3%8.7%25.6%34.6%58.2%80.9%92.7%98.5%99.9%100.0%100.0%
fev 20080.2%1.3%9.6%29.1%38.2%60.1%82.2%93.3%98.5%99.8%100.0%100.0%
jan 20080.2%2.4%11.8%32.5%41.7%62.4%83.7%94.3%98.5%99.9%100.0%100.0%
dez 20070.2%3.0%22.4%41.8%49.7%66.9%85.5%94.7%98.8%99.7%99.9%99.9%
nov 20070.2%3.3%24.2%44.9%53.6%69.6%86.3%95.2%99.0%99.9%100.0%100.0%
out 20070.0%3.2%24.3%40.5%51.5%69.7%86.6%95.0%98.2%99.5%99.8%99.8%
set 20070.0%3.3%24.8%41.0%51.6%69.5%86.4%95.0%98.3%99.6%99.9%99.9%
ago 20070.0%3.3%25.0%41.4%51.8%69.9%86.6%95.0%98.3%99.6%99.9%99.9%
jul 20070.0%4.0%25.5%41.9%51.6%69.7%86.5%94.9%98.3%100.0%100.0%100.0%
jun 20070.0%0.8%4.7%11.8%25.2%48.0%72.4%88.9%96.8%99.9%99.9%99.9%
mai 20070.0%0.0%1.2%6.1%22.0%52.5%76.9%90.3%98.8%100.0%100.0%100.0%
abr 20070.0%0.0%1.5%7.4%20.6%54.4%79.4%92.6%100.0%100.0%100.0%100.0%
mar 20070.0%0.0%1.6%7.8%23.4%53.1%78.1%93.7%99.9%99.9%99.9%99.9%
fev 20070.0%0.0%1.6%6.5%21.3%54.1%78.7%93.5%100.0%100.0%100.0%100.0%
jan 20070.0%0.0%1.9%9.4%24.5%52.8%77.3%94.3%100.0%100.0%100.0%100.0%
dez 20060.0%0.0%2.1%8.5%25.5%55.3%74.4%93.5%99.9%99.9%99.9%99.9%
nov 20060.0%0.0%2.8%8.4%16.7%50.0%69.4%91.6%99.9%99.9%99.9%99.9%
out 20060.0%0.0%3.3%3.3%10.0%40.0%63.3%90.0%100.0%100.0%100.0%100.0%
set 20060.0%0.0%0.0%0.0%50.0%50.0%100.0%100.0%100.0%100.0%100.0%100.0%
ago 20060.0%0.0%0.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%
jul 20060.0%0.0%0.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%
jun 20060.0%0.0%0.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%
mai 20060.0%0.0%0.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%
abr 20060.0%0.0%0.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%
mar 20060.0%0.0%0.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%
fev 20060.0%0.0%0.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%
jan 20060.0%0.0%0.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%
dez 20050.0%0.0%0.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%
nov 20050.0%0.0%0.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%
out 20050.0%0.0%0.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%
set 20050.0%0.0%0.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%
ago 20050.0%0.0%0.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%
jul 20050.0%0.0%0.0%0.0%0.0%0.0%100.0%100.0%100.0%100.0%100.0%100.0%

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.

See also Category Overview Complete
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110Png
dez 20186,1 k8905511242747706       1
nov 20185,9 k8905511242737686       1
out 20185,9 k8905211242737674       1
set 20185,9 k8895211242727668       1
ago 20185,9 k8895211242727668       1
jul 20185,9 k8895211242727668       1
jun 20185,9 k8895211242727668       1
mai 20185,9 k8885211242727668       1
abr 20185,9 k8885211242727664       1
mar 20185,8 k8875211242727659       1
fev 20185,8 k8875211242717659       1
jan 20185,8 k8845211242717636       1
dez 20175,8 k8845111242717633       1
nov 20175,8 k8825111242717633       1
out 20175,8 k8665111242717633       1
set 20175,8 k8655111242717633       1
ago 20175,8 k8645111242717633       1
jul 20175,8 k8635111242717633       1
jun 20175,8 k8635111242717627       1
mai 20175,8 k8635111242717580       1
abr 20175,8 k8635111242717580       1
mar 20175,8 k8635111242717579       1
fev 20175,8 k8635111242717577       1
jan 20175,8 k8615111242717576       1
dez 20165,7 k8615111242717575       1
nov 20165,7 k8615111242717569       1
out 20165,6 k8615111242697335       1
set 20165,6 k8605111242697335       1
ago 20165,6 k8595111242697335       1
jul 20165,6 k8585111242697335       1
jun 20165,6 k8575111242697335       1
mai 20165,6 k8575111242697335       1
abr 20165,6 k8565111242697335       1
mar 20165,6 k8545111242697333       1
fev 20165,6 k8525111242697333       1
jan 20165,6 k8515111242697333       1
dez 20155,6 k8505111242697333       1
nov 20155,6 k8475111242697333       1
out 20155,6 k8474911242697332       1
set 20155,6 k8474911242627332       1
ago 20155,6 k8464911242627332       1
jul 20155,6 k8464911242617331       1
jun 20155,6 k8454911242617330       1
mai 20155,6 k8444911242617330       1
abr 20155,6 k8444811242617330       1
mar 20155,6 k8434811242617330       1
fev 20155,5 k8424811242617324       1
jan 20155,5 k8384811242617324       1
dez 20145,5 k8344811242617322       1
nov 20145,5 k8324811242607321       1
out 20145,5 k8304811242607317       1
set 20145,5 k8284811242606316       1
ago 20145,5 k8244811242606315       1
jul 20145,5 k8174811242606314       1
jun 20145,5 k8174811242516314       1
mai 20145,5 k8154711242516313       1
abr 20145,4 k8084711242506313       1
mar 20145,4 k8054511242506309       1
fev 20145,4 k8004411242506309      4451
jan 20145,3 k7853911242446307      2951
dez 20135,3 k7813611242445306      3711
nov 20135,2 k7773211242435304      5571
out 20135,1 k7663011242385304      8741
set 20134,9 k7622711242305299      4691
ago 20134,8 k7482611242285294      381
jul 20134,8 k7462611242285294      1081
jun 20134,7 k7412611242285293      791
mai 20134,7 k7392611242285293      1401
abr 20134,7 k7332611242285293      2351
mar 20134,6 k7272611242285293      2091
fev 20134,6 k6022511242285292      2971
jan 20134,5 k5932511242285290      3831
dez 20124,4 k5902311242265289      2781
nov 20124,4 k5792311242233288      4251
out 20124,2 k5742011242181282      4991
set 20124,1 k5672011242171272      6781
ago 20123,9 k5622011242161261      8361
jul 20123,7 k5542011242161253      5741
jun 20123,6 k5461911242161245      7161
mai 20123,4 k5351911242141240      2551
abr 20123,4 k5301911242111236      1491
mar 20123,3 k5221911242111236      1541
fev 20123,3 k5201811242111236      641
jan 20123,3 k5071811242111236      25571
dez 20113,2 k4991811241891225      761
nov 20113,0 k4961811241881224      711
out 20112,1 k4831811241881222      1221
set 20112,1 k4761811241881222      3731
ago 20111,9 k4641811241881222      631
jul 20111,2 k4531811241881222      631
jun 20111,2 k4421811241841220      341
mai 20111,2 k4351811241841220      451
abr 20111,1 k4301811241841219      181
mar 20111,1 k4211811241831218      661
fev 20111,1 k4191811241831212      781
jan 20111,1 k4101811241831212      501
dez 20101,1 k4041811241831212      251
nov 20101,1 k3971811241831212      541
out 20101,1 k3911811231831212      181
set 20101,1 k3821811231831211      3511
ago 20101,1 k3761811231821210      231
jul 20101,1 k3621811231821210      171
jun 20101,1 k3571811231821209      551
mai 20101,1 k3471711231821208      2991
abr 20101,1 k3451711221821190      401
mar 20101,1 k3341611221821190      281
fev 20101,0 k3241611221821190      131
jan 20101,0 k3191611221821190      661
dez 20091,0 k3091611221821187      371
nov 20091,0 k3051611221821187      231
out 20091,0 k3021611221811187      231
set 20091,0 k2981611221811187      221
ago 20091,0 k2861611221811187      271
jul 20091,0 k2831611221811187      951
jun 20091,0 k2781611221801185      171
mai 20091,0 k2671511221791185      181
abr 20099982631511221791185      71
mar 20099982541511221791185      101
fev 20099952471511221791185      71
jan 20099942381511221791185      491
dez 20089912271211221621185      251
nov 20089882191211221561185      241
out 20089802051211221561185      31
set 20089791901211221561185      871
ago 20089591701211071521184      1861
jul 20089331581211071521178      451
jun 20089091461211071501178      2351
mai 20088191261111071381165      2241
abr 20087451171011071241131      7661
mar 20087291131011071191128      1751
fev 20086901041011071161128      2891
jan 200863499911071091121      3721
dez 20075779191107931111      1001
nov 20075448791107871111      3681
out 2007424859110770199      401
set 2007417819110769199      211
ago 2007413799110769199      711
jul 2007399769110769199      12081
jun 2007166695110745147      2571
mai 200710661518736115      861
abr 20079048518036111      81
mar 20078539515834111      241
fev 2007803351543419      1371
jan 20076929515434 8      251
dez 20066027515324 8      571
nov 20064824515123 8      331
out 20063822515114 7      1351
set 20062               
ago 20061               
jul 20061               
jun 20061               
mai 20061               
abr 20061               
mar 20061               
fev 20061               
jan 20061               
dez 20051               
nov 20051               
out 20051               
set 20051               
ago 20051               
jul 20051               

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

jul 2005: 1 1 Wp/zea

ago 2005: 1 1 Wp/zea

set 2005: 1 1 Wp/zea

out 2005: 1 1 Wp/zea

nov 2005: 1 1 Wp/zea

dez 2005: 1 1 Wp/zea

mar 2006: 1 2 Wp/zea

mai 2006: 1 1 Wp/zea

jun 2006: 1 1 Wp/zea

ago 2006: 1 1 Wp/zea

set 2006: 1 1 Wp/zea

out 2006: 1 3 Bossele (durp) , 2 3 Walchren , 3 3 Reimerswaol (gemeênte) , 4 3 Bossele (gemeênte) , 5 3 Zeêland , 6 2 Lieste mee pleknaemen in Zeêland, Goereê-Overflakkeê en Wesvore , 7 2 Schouwen-Duveland , 8 2 Wp/zea , 9 2 Vlissienge , 10 1 Zuud-'Olland

nov 2006: 1 4 Lieste mee pleknaemen in Zeêland, Goereê-Overflakkeê en Wesvore , 2 2 Vòblad , 3 1 Goereê-Overflakkeê

dez 2006: 1 3 Amsterdam , 2 3 Vòblad , 3 2 Oôst-Soeburg , 4 2 Zuud-'Ollandse eilan'n , 5 2 8 december , 6 2 West-Vlaonderen

jan 2007: 1 2 Gaepienge , 2 2 Oôskappel , 3 1 Ter Gaepienge

fev 2007: 1 3 Aegte , 2 3 Drenthe , 3 3 Goereê-Overflakkeê , 4 3 Lieste van Nederlandse provincies , 5 2 Australië , 6 1 Waere Jezuskerke

mar 2007: 1 1 Stad Amsterdam

abr 2007: 1 2 Zeêland , 2 1 Zeêuws volkslied

mai 2007: 1 2 Dirksland , 2 2 Kleverskerke , 3 2 Ouwdurp , 4 2 Filosofie , 5 1 Utrecht (gemeênte)

jun 2007: 1 3 Echt-Susteren , 2 3 Sint Anna ter Mu , 3 3 Waere Jezuskerke , 4 2 D'n Vliegende 'Ollander , 5 2 U2 , 6 2 Roerdalen , 7 2 Bergen , 8 2 Lieste van Nederlandse gemeênten , 9 2 Domburg , 10 2 'Ulst (plante) , 11 2 'Ulst , 12 2 Terneuzen , 13 2 Rieksweg 59 , 14 2 Sluus , 15 2 Frankriek , 16 2 Utrecht (gemeênte) , 17 2 Bruunvis , 18 1 Zeeûws - Nederlands

jul 2007: 1 3 1425 , 2 3 Aelbrecht van Beieren , 3 3 1374 , 4 3 1242 , 5 2 1218 , 6 2 1215 , 7 2 1202 , 8 2 Burchard van Avesnes , 9 2 1357 , 10 2 1355 , 11 2 939 , 12 2 1365 , 13 2 1358 , 14 2 1353 , 15 2 1404 , 16 2 1336 , 17 2 1389 , 18 2 1354 , 19 2 1339 , 20 2 1324 , 21 2 1345 , 22 2 1307 , 23 2 1310 , 24 2 1305 , 25 2 1337

ago 2007: 1 2 Geschiedenisse van Zeêland , 2 2 Zuud-'Ollandse eilan'n , 3 2 Biezelehe , 4 1 Roermond

set 2007: 1 2 Slowaoks , 2 1 Limburgs

out 2007: 1 3 Pier Gerlofs Donia , 2 2 Ierland (land) , 3 1 Iese

nov 2007: 1 2 Niutao , 2 2 Tuvalu , 3 2 Zoogdieren , 4 2 Purmerend , 5 2 Blaricum , 6 2 Montfort , 7 2 Reptielen , 8 1 Lieste van zeeën

dez 2007: 1 2 Afrikaonse sukerveugels , 2 2 Spanje , 3 2 Aari , 4 1 Pitta's

jan 2008: 1 2 Taelen , 2 2 Gurneys sukerveugel , 3 2 Taele , 4 2 Denemarken , 5 2 'Oenachtigen , 6 2 Frankriek , 7 2 Belhië , 8 2 Kapelle , 9 1 Planten

fev 2008: 1 3 Lieste mee pleknaemen in Zeêland, Goereê-Overflakkeê en Wesvore , 2 2 Vereênigde Staeten , 3 2 Kosovo , 4 2 Klein Maoriekerke , 5 2 Melis , 6 2 Land , 7 1 Oranjenikkekasuaris

mar 2008: 1 2 Geografische utersten , 2 2 Volksrepubliek China , 3 2 Vierkante kilemeter , 4 1 Te pō

abr 2008: 1 3 De âlde Friezen , 2 3 Emoes , 3 3 Psyholohie , 4 3 Schrabbekerke , 5 3 Myasthenia Gravis , 6 3 Sport , 7 3 Parazoën , 8 3 Ulen , 9 3 Gornaet , 10 3 Floris IV van 'Olland , 11 3 Sluus , 12 3 Koukerke , 13 3 Bossele , 14 3 West-Vlaonderen , 15 2 Witbrauwliesterhaoie , 16 2 Fitna (film) , 17 2 Klimbudelbeêsten , 18 2 Roofbudelbeêsten , 19 2 Geografische utersten , 20 2 'Oenderkoeten , 21 2 Abaiang , 22 2 Budelmollen , 23 2 Svalbard Global Seed Vault , 24 2 Itâlië , 25 2 Australische vliehenvangers

mai 2008: 1 2 1336 , 2 2 Bergen , 3 2 Utrecht (gemeênte) , 4 1 Matuku-tangotango

jun 2008: 1 2 Lieste van taelen , 2 2 Utrecht , 3 2 'Ulst , 4 2 Sluus , 5 2 Westkapelle , 6 2 Hessen , 7 1 Boômklevers

jul 2008: 1 2 Końskowola , 2 1 Madahaskar

ago 2008: 1 2 Ternisse , 2 2 Tole (eiland) , 3 2 Elisabeth Willeboordse , 4 2 Końskowola , 5 2 Kurów , 6 2 Volksrepubliek China , 7 2 Lieste van Nederlandse steê mie stadsrechten , 8 2 Georhië , 9 2 Sociolohie , 10 2 Antropolohie , 11 1 Birma

set 2008: 1 2 GeenStijl , 2 2 Royan , 3 2 Greunienge (gemeênte) , 4 2 Bolus , 5 2 Ternisse , 6 2 Ellesdiek , 7 2 Schrabbekerke

out 2008: 1 1 Greunienge (gemeênte)

nov 2008: 1 1 Zijpe (Noord-Olland)

dez 2008: 1 1 't Aflat

jan 2009: 1 2 Vught , 2 1 Barack Obama

fev 2009: 1 1 Kârel XVI Gustaaf

mar 2009: 1 2 Grieps , 2 1 Zwitserland

abr 2009: 1 1 John Ray

mai 2009: 1 2 Victoria van Zweden , 2 2 Volksrepubliek China , 3 1 Biezeligge

jun 2009: 1 2 Kunst , 2 2 Vliedberg , 3 1 Durpsnaemen in Zeêland en Goeree-Overflakkee

jul 2009: 1 3 Litouwen , 2 3 Zeêuws-Vlaonderen , 3 2 Meidoornloop , 4 2 Driewéh'n (Bossele) , 5 1 Lordi

ago 2009: 1 2 Piet Brakman , 2 1 Confucius

set 2009: 1 3 Expressionisme , 2 2 Islam in Nieuw-Zeêland , 3 1 Planoise

out 2009: 1 1 Thin Shoes

nov 2009: 1 1 Brezilië

dez 2009: 1 2 Atoomfysica , 2 1 Hemeênte

jan 2010: 1 2 Lieste mee hroste plekken van Zeêland , 2 2 Grammaotica , 3 2 Poôls , 4 2 Luxemburg (land) , 5 2 Zeêuws , 6 1 Hroste plekken van Zeeland

fev 2010: 1 1 Zierikzee

mar 2010: 1 2 Grieps , 2 2 Taelkunde , 3 1 Poppendamme

abr 2010: 1 2 De Gooischiêters

mai 2010: 1 3 Vereênigd Konienkriek , 2 2 Bulharije , 3 2 Greunienge (gemeênte) , 4 2 Melis , 5 2 Hoorn , 6 2 Jan II van 'Olland , 7 2 Greuniengs , 8 1 Fluplands

jun 2010: 1 3 Overiessel , 2 2 Ghâna , 3 2 Oôstflakkee , 4 1 Zwolle

jul 2010: 1 1 Overiessel

ago 2010: 1 3 Al Bayda , 2 1 Oesteriek

set 2010: 1 3 Jan Kees de Jager , 2 3 Beêsten , 3 3 Karla Peijs , 4 3 Nederlands , 5 2 Puut'n , 6 2 Taiwan , 7 2 Nowe Brzesko , 8 2 De Gooischiêters , 9 2 Poppendamme , 10 2 Lieste mee hroste plekken van Zeêland , 11 2 Touter , 12 2 Rekker , 13 2 De Facto , 14 2 The Wounded Tone , 15 2 Piet Brakman , 16 2 Grieps , 17 2 Koniengsfezante , 18 2 Ambras , 19 2 Greunienge (gemeênte) , 20 2 Bosklauwier'n , 21 2 Beschermiengsstatus , 22 2 Struusveugel

out 2010: 1 3 922 , 2 2 Canada , 3 2 Luxemburg (land) , 4 1 Esperanto

nov 2010: 1 3 Jan Kees de Jager , 2 2 Lucht'aeven Tan Son Nhat , 3 2 Lieste van taelen (ni taelfemielje) , 4 1 Mark Rutte

dez 2010: 1 2 Zweden , 2 2 Riek (biologie) , 3 2 Nederlands , 4 1 Şalom

jan 2011: 1 2 Osasco , 2 2 Bennebroek , 3 2 Zeêland

fev 2011: 1 2 Concepción (Chili) , 2 2 Zoetelande

mar 2011: 1 2 Charles Darwin , 2 2 Greunienge (gemeênte) , 3 2 Wasschappel , 4 1 Charles darwin

abr 2011: 1 2 Noemi , 2 2 Stuute , 3 2 Mark Rutte

mai 2011: 1 2 Jus , 2 1 Vogelwaarde

jun 2011: 1 2 Fright Night , 2 2 Polynesië , 3 2 Ierland (land) , 4 1 Europese Unie

jul 2011: 1 4 Schraevenpolder , 2 2 Árstíðir , 3 1 Villeneuve (Ain)

ago 2011: 1 2 Jeajn'ie van d'n Duunkant , 2 2 SLOT , 3 2 T.A.T.u. , 4 2 Aventura , 5 1 Vaux-Andigny

set 2011: 1 3 Uden , 2 2 Urk , 3 2 1986 , 4 2 Goeree-Overflakkeê , 5 2 Fries (taele) , 6 2 Europa , 7 2 Oekraïne , 8 2 Tumenskoe , 9 1 Veluwe

out 2011: 1 3 Kerncentraole , 2 2 De Koewacht , 3 2 Kernenergie , 4 2 Bolsward , 5 2 Libië , 6 2 Kwikstaert'n en piepers , 7 1 Inverness

nov 2011: 1 2 Broeinekel , 2 2 Gors , 3 2 Inverness (Schotland) , 4 1 Mosjtsjena

dez 2011: 1 2 Bevindelijk grifformeerden , 2 2 West-Vlaonderen , 3 1 L'Hospitalet

jan 2012: 1 2 Katwiek , 2 2 Laura , 3 2 Picardie , 4 2 Monceau-sur-Oise , 5 2 Juvigny (Aisne) , 6 2 Jouaignes , 7 2 Jeantes , 8 2 Dravegny , 9 2 Neyron , 10 2 De Kwaejen Hoek , 11 2 Oôst-Timor , 12 2 Rotterdam , 13 2 Mark Rutte , 14 2 Boômkorvisserie , 15 2 Natuurkunde , 16 2 Vereênigd Konienkriek , 17 1 Sint-Truiden

fev 2012: 1 2 Joan Franka , 2 2 Arnhem , 3 2 Sint-Truiden , 4 2 Baltische taelen , 5 2 Gent , 6 2 Afghanistan , 7 2 Utrecht (gemeênte) , 8 1 Lacuna Coil

mar 2012: 1 2 Eemdiek , 2 2 Şehrazat , 3 2 Liechenstein , 4 1 Letland

abr 2012: 1 2 Paerdeplaete , 2 1 1956

mai 2012: 1 3 Slag bie Wasschappel , 2 3 Wasschappel 'Oôg , 3 3 Myanmar , 4 3 Wasschappel , 5 2 D'n Polder , 6 2 Disoek , 7 2 Waeterschap , 8 2 Ter Veere (plek) , 9 2 Rafael Correa , 10 2 IJlst , 11 2 Marokko , 12 2 Waere Jezuskerke , 13 1 Oôstburg

jun 2012: 1 3 Kaerel d'n Vuufden , 2 3 Zweden , 3 2 Wasschappel Laeg , 4 2 Johan Hendrik van Dale , 5 2 1933 , 6 2 D'n Bos , 7 2 Zanddiek , 8 2 Ter Bottienge , 9 2 Slag bie Wasschappel , 10 2 2012 , 11 2 Wikipedia , 12 2 Wasschappel , 13 2 Lieste mee pleknaemen in Zeêland, Goereê-Overflakkeê en Wesvore , 14 2 Nederland , 15 2 Tole (gemeênte) , 16 1 Klederdracht op Zuud-Beveland

jul 2012: 1 2 Reykjavík , 2 2 Jaer , 3 2 Straô , 4 2 Berlijn , 5 2 Wasschappelse Zeêdiek , 6 2 Zuud-Amerika , 7 2 Noôrd-Amerika , 8 2 Kouwe Oôrlog , 9 2 Oôst-Vlaonderen , 10 2 Zuud-Europa , 11 2 Maestricht , 12 2 Oôst-Europa , 13 2 Erreburg , 14 2 Centraol-Europa , 15 2 Noôrd-Europa , 16 2 Zunnemaire , 17 2 Plompetoren , 18 2 V.V. De Noormannen , 19 2 Land van Aksel , 20 2 Jerevan , 21 2 Aksel , 22 2 Antwerpen (plekke) , 23 2 Europa , 24 2 Moskou , 25 2 Vilnius

ago 2012: 1 2 Lieste van verdroenke durpen in Zeêland , 2 2 Strandieng van de Doris , 3 2 Zeeuwsche Beetwortelsuikerfabriek \"Sas van Gent\" , 4 2 Wulleminadurp , 5 2 Lëtzebuergesch , 6 2 Fort Zeelandia , 7 2 Dow Chemical (Terneuzen) , 8 2 Noord-Holland , 9 2 Hertogin Hedwigepolder , 10 2 Tramways à vapeur Flessingue-Middelbourg et extensions , 11 2 Lieste mee Zeêuwse rampen , 12 2 Moustiers-Sainte-Marie , 13 2 Aerde , 14 2 Wolfgang Amadeus Mozart , 15 2 Brezilië , 16 2 Kosovo , 17 2 Liesten , 18 2 Curitiba , 19 2 Geschiedenisse van Zeêland , 20 1 Joël (Biebelboek)

set 2012: 1 3 Sluuskille , 2 3 New York City , 3 2 Hande Yener , 4 2 Waeterschap Scheldestroômen , 5 2 Kanaol van Gent nao Terneuzen , 6 2 Rienkrieën , 7 2 Renisse , 8 2 Nieuwland , 9 2 Disoek , 10 2 Ter Veere (plek) , 11 2 Staevenisse , 12 2 Rijssen , 13 2 Bru , 14 2 Wòstburg , 15 2 Moskou , 16 2 Veugelwjerde , 17 2 Flupland (eiland) , 18 2 Israël , 19 2 Grieps , 20 2 Zweden , 21 2 Ternisse , 22 2 Ellesdiek , 23 2 Melis , 24 2 Geschiedenisse , 25 2 Wikipedia

out 2012: 1 3 SpongeBob SquarePants , 2 3 Nepal , 3 3 Baesdurp , 4 2 Kezand , 5 2 Stad , 6 2 't Kerkje , 7 2 Hellevoet , 8 2 Burg , 9 2 Groôt-Abeêle , 10 2 Klein Valkenisse , 11 2 Groôt Valkenisse , 12 2 Buiskerke , 13 2 Kraelingen , 14 2 Hoôgelande , 15 2 Lieste mee Zeêuwse meulens , 16 2 Concepción (provincie) , 17 2 Lieste mee Deltawêrken , 18 2 Moskou , 19 2 Liest van ouwe gemeênten in Zeêland , 20 2 Brezilië , 21 2 Arhentinië , 22 2 Volksrepubliek China , 23 1 Blaeuwe Huus

nov 2012: 1 3 Schwòndieke , 2 3 Rutten (Nederland) , 3 3 SpongeBob SquarePants , 4 2 Almere , 5 2 Lelystad , 6 2 Round Maple , 7 2 Arduin , 8 2 Lemmer , 9 2 Life with Boys , 10 2 Usdiek , 11 2 The Voice of Holland , 12 2 Zeêuws trekpaerd , 13 2 Herman Heijermans , 14 2 Ramskapelle (Knokke-Heist) , 15 2 Sinte Pier , 16 2 Paerd , 17 2 Pieremie , 18 2 Provinciaole Stoômboôtdiensten in Zeêland , 19 2 Tramways à vapeur Flessingue-Middelbourg et extensions , 20 1 Nieuwerkerke

dez 2012: 1 3 Drooiplotte , 2 3 Tollebeek , 3 3 Willibrordbiebel , 4 2 The voice of Holland , 5 2 The Voice Kids (seizoen 2) , 6 2 The Voice Kids (seizoen 1) , 7 2 The Voice Kids , 8 2 Ou-Vossemaer , 9 2 Koeischorre , 10 2 Zuuszande , 11 2 Spiekenisse , 12 2 Emmeloord , 13 1 1895

jan 2013: 1 2 D'n Noek , 2 2 Genesis (boek) , 3 2 Dronten , 4 2 Christophorus Buys Ballot , 5 2 Frans Naerebout , 6 2 Sasput , 7 2 The Voice Kids (seizoen 2) , 8 2 The Voice of Holland , 9 2 Jan Steen , 10 2 Zeêlandbrugge , 11 2 1952 , 12 2 De Koewacht , 13 2 3 feberwari , 14 2 31 januari , 15 2 Religie , 16 1 Klederdracht op Zuud-Beveland

fev 2013: 1 2 Brunssum , 2 2 Raeduus Brunssum , 3 2 Tel Aviv , 4 2 Lodewijk van den Berg , 5 2 The Voice Kids (seizoen 2) , 6 2 The Voice Kids , 7 2 Annie M.G. Schmidt , 8 1 Kaapstad

mar 2013: 1 3 Flikken Maestricht , 2 2 Erika Eleniak , 3 2 Vliehende budelmuzen , 4 2 The Next Pop Talent , 5 2 Maria van Champagne , 6 2 Vuurtoren Ouwdurp , 7 2 Israël , 8 1 Ivete Sangalo

abr 2013: 1 2 The Oval , 2 2 Weumelinge , 3 2 Kate Upton , 4 2 Carmen Hart , 5 2 Tel Aviv , 6 2 Jeruzalem , 7 2 Aksel , 8 1 't Veer

mai 2013: 1 1 Zwaekse Weêl

jun 2013: 1 2 Sneêk , 2 2 Kees van der Staaij , 3 2 Grieps , 4 1 De Moesschans

jul 2013: 1 3 Zweêke , 2 2 Marseille , 3 2 Groe , 4 2 Eben-Haëzerkerreke (Ouwdurp) , 5 2 Durpskerreke (Ouwdurp) , 6 1 Jona (Biebelboek)

ago 2013: 1 2 Opsporing Verzocht , 2 2 Hindeloôpen , 3 1 Dick Bruna

set 2013: 1 3 Las Vegas , 2 3 50PLUS , 3 3 Wie is de mol? , 4 3 Luxor , 5 3 Lutz Jacobi , 6 3 Pim Fortuyn , 7 3 Minecraft , 8 3 Nintendo , 9 3 Seat , 10 3 Toyota , 11 3 Volkswaegen , 12 3 Opel , 13 3 BMW , 14 3 PepsiCo , 15 3 Thee , 16 3 Racoon , 17 3 Dildo (plekke) , 18 3 Bob Marley , 19 3 Jamaica , 20 3 Herman den Blijker , 21 3 Disney , 22 3 NOS , 23 2 Haïti , 24 2 Dominica , 25 1 Grenada

out 2013: 1 4 Zeêuwstaelihe Wikipedia , 2 3 Saturnus (planete) , 3 3 Galileo Galilei , 4 3 Nicolaus Copernicus , 5 3 Phobos (maen) , 6 3 Mars (planete) , 7 3 Spaons , 8 3 Roôms-katholicisme , 9 3 Dildo (voorwerp) , 10 3 Naval Criminal Investigative Service , 11 3 Florida , 12 3 Texas , 13 3 Adolf Hitler , 14 3 Nederland , 15 2 Terschelling , 16 2 Oesterdam , 17 2 E312 , 18 2 N62 , 19 2 Willem-Alexander der Nederlanden , 20 2 Flupsdam , 21 2 Vasco da Gama , 22 2 Francis Drake , 23 2 Thomas Edison , 24 2 Plato , 25 2 Alexander de Groôte

nov 2013: 1 3 Anggun , 2 3 De Moffenschans , 3 3 Witte 'uus , 4 3 Washington D.C. , 5 3 Abraham Lincoln , 6 3 Tiengemeêten , 7 2 Californië , 8 2 Alaska , 9 2 Geconfedereêrde Staeten van Amerika , 10 2 Oncypedie , 11 2 'Ulst (plekke) , 12 2 Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch , 13 2 Geronimo , 14 2 Fort Galle , 15 2 Reimerswaol (stad) , 16 2 Zeca Pagodinho , 17 2 Martin Luther King , 18 2 Francis Beaufort , 19 2 Schaele van Beaufort , 20 2 Bamako , 21 2 Mali , 22 2 Lady Gaga , 23 2 Justin Bieber , 24 2 Shakira , 25 2 Sabic

dez 2013: 1 5 Nelson Mandela , 2 4 Lieste mee 'oôgste gebouwen op Noôrd-Beveland , 3 4 5 december , 4 4 Sturm van 5 december 2013 , 5 3 Drachten , 6 3 Ee (Dongeradeel) , 7 3 24 juni , 8 3 Thames Barrier , 9 3 1861 , 10 3 Vòblad , 11 2 Prediker (Biebelboek) , 12 2 Warga , 13 2 Anjum , 14 2 Jouswier , 15 2 Lieste mee hoôgste gebouwen op Zuud-Beveland , 16 2 Lieste mee 'oôgste gebouwen op Schouwen , 17 2 Turfkaai 11 (Goes) , 18 2 Rieksmonument , 19 2 Vrouwestraet 7 , 20 2 Nieuwe Bogerdstraet 1 , 21 2 Sint Lievensmonstertoren , 22 2 28 oktober , 23 2 26 oktober , 24 2 Zimbabwe , 25 2 2000

jan 2014: 1 3 Djibouti (stad) , 2 3 Djibouti (land) , 3 3 Centraol Afrikaonse Republiek , 4 3 Dante Alighieri , 5 3 Jacobus Clemens non Papa , 6 3 1914 , 7 3 Stad an 't Haeriengvliet , 8 3 Letland , 9 3 Estland , 10 2 Wierum , 11 2 Dongeradeel , 12 2 Malawi , 13 2 Klaeswael , 14 2 Riga , 15 2 Graf mie de 'andjes , 16 2 Burundi , 17 2 Lieste mee 'oôgste gebouwen in Zeêland , 18 2 Lieste mee 'oôgste gebouwen in Zeêuws-Vlaonderen , 19 1 Moddergat

fev 2014: 1 4 Flappy Bird , 2 4 Seychell'n , 3 4 Sealand , 4 4 Michael Jackson , 5 4 Nelson Mandela , 6 4 Zeêland , 7 3 Partij vò Naastenliefde, Vrij'eid en Diversiteit , 8 3 Tokio , 9 3 Elvis Presley , 10 3 Waylon Jennings , 11 3 Evo Morales , 12 3 Hank Williams Jr. , 13 3 Hank Williams , 14 3 Westelijke Sahara , 15 3 Rekenen , 16 3 Wiskunde , 17 3 Lauwersmeer , 18 3 Jacobus Clemens non Papa , 19 3 Abraham Lincoln , 20 3 Dick Bruna , 21 3 Strandieng van de Doris , 22 3 2014 , 23 3 Guignicourt , 24 3 Faramans (Ain) , 25 3 Economie van Zeêland

mar 2014: 1 5 Waepens van Zeêland , 2 3 Geldermalsen , 3 2 Ridderkerke , 4 2 Syrische Burheroôrlog , 5 2 Comoôr’n , 6 2 Jim Morrison , 7 2 1846 , 8 2 Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch , 9 2 Veerse Meer , 10 2 2014 , 11 2 19 maerte , 12 2 1960 , 13 1 Veêrdienste van Zurrikzeê nae Kats

abr 2014: 1 4 Lieste mee schilderiejen van Leonardo da Vinci , 2 3 Job (Biebelboek) , 3 3 The Passion , 4 3 Mensenrassen , 5 3 Tennessee , 6 3 Ronald Reagan , 7 3 The Doors , 8 3 Sung Jae-gi , 9 3 Tillevisie , 10 3 1943 , 11 2 Marknesse , 12 2 Groôte Kerke (Graaff Reinet) , 13 2 Veêrdienste van Zurrikzeê nae Kats , 14 2 Paus Franciscus , 15 2 Paus , 16 2 NCIS: Los Angeles , 17 2 NCIS (tillevisieserie) , 18 2 Zuud-Korea , 19 2 Kats

mai 2014: 1 3 Kampen , 2 2 Friedrich Nietzsche , 3 2 Immanuel Kant , 4 2 Trojany , 5 2 Goudswaerd , 6 2 Syrische Burheroôrlog , 7 2 Fright Night

jun 2014: 1 3 Partij vò Naastenliefde, Vrij'eid en Diversiteit , 2 2 Islamitische Staete , 3 2 Friedrich Nietzsche , 4 2 Paloma Bernardi , 5 1 Oncyclopedia

jul 2014: 1 3 Malaysia Airlines-vlucht 17

ago 2014: 1 2 Malaysia Airlines-vlucht 17 , 2 1 Ar-Raqqah

set 2014: 1 2 Bochotnica , 2 2 Desouk , 3 2 Tiengemeêten , 4 1 Tsjechië

out 2014: 1 3 Lieste mee pleknaemen in Zeêland, Goereê-Overflakkeê en Wesvore , 2 2 Mega Top 50 , 3 2 Ebola-uutbraek in West-Afrika in 2014 , 4 2 Partij vò de Vrij'eid , 5 1 Maertenskerke

nov 2014: 1 2 Tigranes de Groôte , 2 2 Barneveld , 3 1 Tigranes de Groöte

dez 2014: 1 2 Slag om de Sloedam , 2 1 Roôzendael

jan 2015: 1 3 Anslag op Charlie Hebdo , 2 1 Mohammed

fev 2015: 1 1 Pedoseksualiteit

mar 2015: 1 3 Vliegtuug , 2 2 Jouswier , 3 2 1903 , 4 2 Waeterschap , 5 2 Dokkum , 6 1 Vliegtuig

abr 2015: 1 1 Chapeau (Allier)

mai 2015: 1 1 Warschau

jun 2015: 1 1 Groese paptaort

jul 2015: 1 3 Pluto (dwergplanete) , 2 2 Oôsterscheldekering , 3 1 Ayman al-Zawahiri

ago 2015: 1 1 Kuala Lumpur

set 2015: 1 2 Giya Kancheli , 2 1 Tbilisi

out 2015: 1 1 Petra

nov 2015: 1 2 Herman den Blijker , 2 2 Paerd , 3 2 Istanbul , 4 1 Nes (Dongeradeel)

dez 2015: 1 2 Islamitische Staete , 2 1 Smallingerland

jan 2016: 1 2 Anslaegen in Parijs van november 2015 , 2 2 Beêldouwkunst , 3 1 Bovenkamp

fev 2016: 1 1 Nicolaas Hendrik Beversluis

mar 2016: 1 3 Anslaegen in Brussel van maert 2016 , 2 1 Libanon

abr 2016: 1 2 Victoriawoestijn , 2 2 Hroôte Victoriawoestijn , 3 2 Pedofilie , 4 1 Zeêuwse Wikipedia

mai 2016: 1 1 Kaepstad

jun 2016: 1 2 Nieuw-Zeêland , 2 1 Polen

jul 2016: 1 3 2016 , 2 2 Markiezaotskaai , 3 2 Nice , 4 2 Stad , 5 2 Ter Veere (plek) , 6 1 Robaais

ago 2016: 1 2 Justin Bieber , 2 1 Robaais

set 2016: 1 1 Anslaegen in Brussel van maert 2016

out 2016: 1 1 Hollans

nov 2016: 1 3 Limburg (Nederland) , 2 3 Nederland , 3 2 Peter Slager , 4 2 Akrotiri en Dhekelia , 5 2 Adjara , 6 2 Abchazië , 7 2 Madeira , 8 2 Hibraltar , 9 2 Azoôr'n , 10 2 Afankelijk hebied , 11 2 Anslaegen in Parijs van november 2015 , 12 2 Aisha , 13 2 Korte Delft 4 , 14 2 Nelson Mandela , 15 2 Abraham Lincoln , 16 2 Lieste mee schilderiejen van Jan Steên , 17 2 Yasser Arafat , 18 2 Tankenberg , 19 2 Noôrd-Amerika

dez 2016: 1 2 Partij van de Arbeid , 2 2 Diederik Samsom , 3 2 Lëtzebuergesch , 4 2 Lucas , 5 2 Nederlands Nieuw-Guinea , 6 2 Staetkundig Grifformeerde Partij , 7 2 Israël , 8 1 Volkerak

jan 2017: 1 3 Dinteloôrd , 2 2 Ossendrecht , 3 2 Huijbergen

fev 2017: 1 2 Meierijstad , 2 2 2017 , 3 1 Santiago

mar 2017: 1 3 Šiprage , 2 3 Donald Trump , 3 2 Marianne Thieme , 4 2 Bosnië-Hercegovina , 5 1 'Ulst (gemeênte)

abr 2017: 1 2 Luikse waefel , 2 1 Luikse wafel

mai 2017: 1 2 Šiprage , 2 2 Alexander de Groôte , 3 1 Alexander de Grote

jun 2017: 1 3 Šiprage , 2 1 Anna Netrebko

jul 2017: 1 1 Alexander de Hroôte

ago 2017: 1 1 Californië

set 2017: 1 1 Treinongelok bie Vlissienge

out 2017: 1 2 Asjdod , 2 2 Veerse Gatdam , 3 2 Lieste van Nederlandse provincies , 4 1 Kabinet-Rutte III

nov 2017: 1 2 Zimbabwe , 2 1 Anatoli Solovjanenko

dez 2017: 1 1 HHK

jan 2018: 1 2 Oranjezon , 2 2 Rio de Janeiro , 3 2 Tram , 4 2 Zeêland

fev 2018: 1 2 Billy Graham , 2 2 Ruud Lubbers , 3 2 Chrissenvervolgingen , 4 2 't Ouwedurp , 5 2 Werendieke , 6 2 'Eintjeszand , 7 2 Baerland , 8 1 Jewannes

mar 2018: 1 2 Lieste van Zeêuwstaelige schrievers , 2 2 Hantum , 3 2 1948 , 4 1 Vrouwepolder

abr 2018: 1 2 Kinderdiek , 2 2 Meulewaerd , 3 2 Avicii , 4 2 Nieuw-Vossemaer , 5 2 Lieste van Nederlandse gemeênten , 6 1 Kinderdijk

mai 2018: 1 2 Kees Ruusse , 2 2 Marie-Cécile Moerdijk

jun 2018: 1 3 Hans Christian Andersen , 2 1 Duunkerke

jul 2018: 1 2 Trier , 2 2 Henk Angenent , 3 1 Femke Halsema

ago 2018: 1 2 Stalland , 2 1 Brazilië

set 2018: 1 2 Oss , 2 1 Steênwiekerland

out 2018: 1 2 Politiek in Nederland , 2 1 D'66

nov 2018: 1 2 Duunkerke , 2 2 Politiek in Nederland , 3 2 Robaais , 4 2 Rijsel , 5 2 Tony Joe White , 6 2 Leie , 7 2 Amina bint Abdul Halim bin Salem Nasser , 8 1 Benjamin Netanyahu

dez 2018: 1 2 Straetsburg , 2 2 Limburg (België) , 3 2 Zwartewaeterland , 4 2 Stephen Hillenburg , 5 2 1544 , 6 2 Spanje , 7 1 1789

Wikipedias are initially ordered by number of speakers of the language

Speakers: Number of speakers of a language is the estimated total of primary and secondary speakers, is in many cases a very rough estimation (based on the page on the English Wikipedia about that language)
Regions are parts of the world where the language is spoken in substantial amounts (compared to total number of speakers). Regions where a language gained presence only by a recent diaspora are generally not included.
Region codes: AF:Africa, AS:Asia, EU:Europe, NA:North America, OC:Oceania, SA:South America, W:World Wide, CL:Constructed Language

Estatísticas geradas em Sexta-feira, 1 de fevereiro 2019 08:47 (final run)

Dump file zeawiki-20190101-stub-meta-history.xml.gz (edits only), size 6.7 Mb as gz -> 47 Mb
Dump processed till Dec 31, 2018, on server stat1007, ready at Sat-05/01/2019-16:33 after 24 sec.

Autor:Erik Zachte (2002-Jan 2019) (Sítio web)
Endereço:erikzachte@### (no spam: ### = infodisiac.com)
Documentation / Scripts / CSV files: About WikiStats

You can download the English version of these reports here (also download common_files.zip)
You can download aggregated data here

All data and images on this page are in the public domain.