Estatísticas da Wikilivros anglo-saxon

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist
 
Jan 31, 2019: This is the final release of Wikistats-1 dump-based reports. Part of these data are available in the first release of Wikistats 2. Read more here

 

Metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.
See also metrics definitions


 
Monthly counts & Quarterly rankings: dezembro 2018
 
DataWikiautoresArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
dez 20185   177 4,5        52
nov 20185   177 4,5        52
out 20185   177 4,5        52
set 20185   177 4,5        52
ago 20185   177 4,5        52
jul 20185   177 4,5        52
jun 20185   177 4,5        52
mai 20185   177 4,5        52
abr 20185   177 4,5        52
mar 20185   177 4,5        52
fev 20185   177 4,5        52
jan 20185   177 4,5        52
dez 20175   177 4,5        52
nov 20175   177 4,5        52
out 20175   177 4,5        52
set 20175   177 4,5        52
ago 20175   177 4,5        52
jul 20175   177 4,5        52
jun 20175   177 4,5        52
mai 20175   177 4,5        52
abr 20175   177 4,5        52
mar 20175   177 4,5        52
fev 20175   177 4,5        52
jan 20175   177 4,5        52
dez 20165   177 4,5        52
nov 20165   177 4,5        52
out 20165   177 4,5        52
set 20165   177 4,5        52
ago 20165   177 4,5        52
jul 20165   177 4,5        52
jun 20165   177 4,5        52
mai 20165   177 4,5        52
abr 20165   177 4,5        52
mar 20165   177 4,5        52
fev 20165   177 4,5        52
jan 20165   177 4,5        52
dez 20155   177 4,5        52
nov 20155   177 4,5        52
out 20155   177 4,5        52
set 20155   177 4,5        52
ago 20155   177 4,5        52
jul 20155   177 4,5        52
jun 20155   177 4,5        52
mai 20155   177 4,5        52
abr 20155   177 4,5        52
mar 20155   177 4,52645 751 kb74 k3632213165052
fev 20155   177 4,52645 751 kb74 k3632213165052
jan 20155   177 4,52645 751 kb74 k3632213165052
dez 20145   177 4,52645 751 kb74 k3632213165052
nov 20145   177 4,52645 751 kb74 k3632213165052
out 20145   177 4,52645 751 kb74 k3632213165052
set 20145   177 4,52645 751 kb74 k3632213165052
ago 20145   177 4,526451751 kb74 k3632213165052
jul 20145   177 4,52645 751 kb74 k3632213165052
jun 20145   177 4,52645 751 kb74 k3632213165052
mai 20145   177 4,52645 751 kb74 k3632213165052
abr 20145   177 4,52645 751 kb74 k3632213165052
mar 20145   177 4,52645 751 kb74 k3632213165052
fev 20145   177 4,52645 751 kb74 k3632213165052
jan 20145   177 4,526452751 kb74 k3632213165052
dez 20135   177 4,526455751 kb74 k3632213165052
nov 2013511 177 4,5264045750 kb73 k3632173165652
out 20134   177 4,22666 757 kb74 k36421731610651
set 20134   177 4,226661757 kb74 k36421731610651
ago 20134   177 4,22666 757 kb74 k36421731610651
jul 20134   177 4,22666 757 kb74 k36421731610651
jun 20134   177 4,22666 757 kb74 k36421731610651
mai 20134   177 4,22666 757 kb74 k36421731610651
abr 20134   177 4,226661757 kb74 k36421731610651
mar 20134   177 4,22666 757 kb74 k36421731610651
fev 20134   177 4,22666 757 kb74 k36421731610651
jan 20134   177 4,226661757 kb74 k36421731610651
dez 20124   177 4,22665 757 kb74 k36421731610651
nov 20124   177 4,22665 757 kb74 k36421731610651
out 20124   177 4,22665 757 kb74 k36421731610651
set 20124   177 4,22665 757 kb74 k36421731610651
ago 20124   177 4,22665 757 kb74 k36421731610651
jul 20124   177 4,22665 757 kb74 k36421731610651
jun 20124   177 4,22665 757 kb74 k36421731610651
mai 20124   177 4,22665 757 kb74 k36421731610651
abr 20124   177 4,22665 757 kb74 k36421731610651
mar 20124   177 4,22665 757 kb74 k36421731610651
fev 20124   177 4,226652757 kb74 k36421731610651
jan 20124   177 4,22665 757 kb74 k36421731610651
dez 20114   177 4,22665 757 kb74 k36421731610651
nov 20114   177 4,226656757 kb74 k36421731610651
out 20114   177 4,12665 757 kb74 k36421731610651
set 20114   177 4,12665 757 kb74 k36421731610651
ago 20114   177 4,12665 757 kb74 k36421731610651
jul 20114   177 4,12665 757 kb74 k36421731610651
jun 20114   177 4,12665 757 kb74 k36421731610651
mai 20114   177 4,12665 757 kb74 k36421731610651
abr 20114   177 4,12665 757 kb74 k36421731610651
mar 20114   177 4,126651757 kb74 k36421731610651
fev 20114   177 4,126652757 kb74 k36421631610651
jan 20114   177 4,126653757 kb74 k36421031610751
dez 20104 1 176 4,1266112751 kb74 k29119831610651
nov 20104   172 4,226912749 kb73 k29231331611551
out 20104   172 4,126911749 kb73 k29231331611551
set 20104   172 4,12691 749 kb73 k29231331611551
ago 20104   172 4,126911749 kb73 k29231331611551
jul 20104   172 4,126911749 kb73 k29231331611551
jun 20104 1 171 4,1270020748 kb73 k29131331611551
mai 20104 1 169 4,1268912742 kb73 k29131331611549
abr 20104 1 166 4,1270919702 kb72 k28931331610849
mar 20104   165 42719 700 kb71 k28731331610845
fev 20104   165 427191700 kb71 k28731331610845
jan 2010411 165 427198700 kb71 k28731331610845
dez 20093   165 3,92719 698 kb71 k28731331610843
nov 20093   165 3,927193698 kb71 k28731331610843
out 20093   165 3,9271913698 kb71 k28731231610843
set 20093   165 3,82706 695 kb71 k28729631610843
ago 20093   165 3,82706 695 kb71 k28729631610843
jul 20093   165 3,82706 695 kb71 k28729631610843
jun 20093   165 3,827061695 kb71 k28729631610843
mai 20093 1 165 3,827068695 kb71 k28729631710843
abr 20093   163 3,827232694 kb71 k28729631710743
mar 20093   163 3,82723 694 kb71 k28729631710743
fev 20093   163 3,82723 694 kb71 k28729631710743
jan 20093 1 163 3,8272311694 kb71 k28729631710743
dez 2008311 158 3,9279313689 kb71 k28129431510743
nov 20082   157 3,82792 686 kb71 k28129431510741
out 20082   157 3,82792 686 kb71 k28129431510741
set 20082   157 3,82792 686 kb71 k28129431510741
ago 20082   157 3,827922686 kb71 k28129431510741
jul 20082   157 3,82792 686 kb71 k28129431510741
jun 20082   157 3,82792 686 kb71 k28129431510741
mai 20082   157 3,827921686 kb71 k28129431510741
abr 20082 1 157 3,8279211686 kb71 k28129431510741
mar 20082   151 3,926205642 kb63 k25827831110741
fev 20082   150 3,926281640 kb63 k25827831110741
jan 20082   150 3,92629 640 kb63 k25927831110741
dez 20072   150 3,92629 640 kb63 k25927831110741
nov 20072   150 3,92629 640 kb63 k25927831110741
out 20072   150 3,92629 640 kb63 k25927831110741
set 20072   150 3,92629 640 kb63 k25927831110741
ago 20072   150 3,926291640 kb63 k25927831110741
jul 20072   150 3,826292640 kb63 k25927731110741
jun 20072 1 148 3,9266628639 kb63 k25327731010541
mai 20072   141 3,92768 633 kb62 k25528728710141
abr 20072 1 141 3,927687633 kb62 k25528728710141
mar 20072   139 3,92802 630 kb62 k22728725610141
fev 20072   139 3,92802 630 kb62 k22728725610141
jan 20072   139 3,92802 630 kb62 k22728725610141
dez 20062   139 3,92802 630 kb62 k22728725610141
nov 20062   139 3,92802 630 kb62 k22728725610141
out 20062   139 3,928022630 kb62 k22728725610141
set 20062   137 3,92820 621 kb62 k2272872569941
ago 20062   137 3,928201621 kb62 k2272872569941
jul 20062   137 3,92810 619 kb62 k2272872569841
jun 20062   137 3,928106619 kb62 k2272872569841
mai 20062 1 135 3,9281019618 kb62 k2272892559841
abr 20062   131 3,92856 605 kb61 k2272892359840
mar 20062   131 3,928561605 kb61 k2272892359840
fev 20062 1 131 3,9287310603 kb61 k2252792349840
jan 20062 1 128 3,9290164601 kb61 k2272892349839
dez 20052   120 3,630463589 kb60 k2272891299439
nov 20052   120 3,630465589 kb60 k2272891299439
out 20052 1 12013,6304653588 kb60 k2272881299439
set 20052 1 100 3,8313450410 kb51 k2262821196838
ago 20052 1 88 3,7341254390 kb49 k211276856336
jul 20052 117423,73026182303 kb36 k165265784935
jun 20052 1 22 4,1340313114 kb8,3 k2025149186
mai 20052   18 4,32982 89 kb6,0 k1512449184
abr 20052   18 4,32982 89 kb6,0 k1512449184
mar 20052 1 18 4,32982789 kb6,0 k1512449184
fev 20052 1 18 3,930153090 kb6,1 k1512449274
jan 2005221 9 4,444064056 kb4,1 k101241193
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
 WikiautoresArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikiautores (usuários registrados)
A = Wikiautores que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikiautores que editaram pelo menos dez vezes desde que chegaram
C = Wikiautores que contribuíram cinco vezes ou mais este mês
D = Wikiautores que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  5  10  1  3  5  5  10  1  3  5  10  25  100  5  10  100 
dez 2018                    
nov 2018                    
out 2018           2        
set 2018                    
ago 2018                    
jul 2018                    
jun 2018                    
mai 2018                    
abr 2018           1        
mar 2018                    
fev 2018           1        
jan 2018                    
dez 2017      1    11       
nov 2017                    
out 2017                    
set 2017                    
ago 2017                    
jul 2017                    
jun 2017                    
mai 2017                    
abr 2017                    
mar 2017                    
fev 2017           2        
jan 2017                    
out 2018           2        
jul 2018                    
abr 2018           1        
jan 2018                    
out 2017                    
jul 2017                    
abr 2017                    
jan 2017                    
out 2016                    
jul 2016                    
abr 2016           1        
jan 2016                    
out 2015                 1  
jul 2015      1    1        
abr 2015         221        
jan 2015      1    11       
out 2014      2    3        
jul 2014                    
abr 2014           4        
jan 20141     1    41       
out 2013      11   42       
jul 2013           3        
abr 20131          2        
jan 20131     1    2        
out 2012      1    32       
jul 2012           4        
abr 2012      11   111      
jan 2012           1        
out 2011      1    4        
jul 2011      2    51       
abr 2011           411      
jan 201111         4        
out 2010      1    6        
jul 20101          2        
abr 20103111   1    31       
jan 2010111    1    311      
out 20091   11     11    1  
jul 2009           2        
abr 20092          311      
jan 20091111   1    3221     
out 2008      1    322      
jul 2008           1        
abr 2008111         21111    
jan 2008      3    41       
out 2007           2        
jul 20071     1    2        
abr 2007211         111      
jan 2007                    
out 20061          1        
jul 2006                    
abr 2006           1        
jan 200611111  1    211111   
out 200511111  1    111      
jul 2005111111       11111 11 
abr 2005                    
jan 200521111  1    111111111

 

Distribuição de edições de artigos por wikiautores
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikiautoresEdições total
130100.0%732100.0%
3413.3%69695.1%
10413.3%69695.1%
32310.0%66691.0%
10013.3%55475.7%
31613.3%55475.7%

 

20 wikiautores recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
James~angwikibooksUC1554jan 12, 20055100jan 13, 20093638
Gott wisstUC263mai 14, 20093517dez 27, 20102925
EspreonUC349nov 08, 20131878dez 04, 20131852
WōdenhelmUC430mar 04, 20083953jan 30, 20112891
PathoschildUC53abr 19, 20103177abr 19, 20103177
Iosue~angwikibooksUC62out 15, 20064459out 15, 20064459
CommonsDelinkerUC72jun 25, 20093475fev 23, 20103232
CarsracUC82out 03, 20093375out 03, 20093375
WutsjeUC92nov 10, 20093337fev 26, 20112864
Quentinv57UC102nov 27, 20102955nov 27, 20102955
JanwallsUC112nov 02, 20112615nov 02, 20112615
SpacebirdyUC122nov 07, 20112610nov 07, 20112610
Addihockey10 (automated)UC132fev 08, 20122517fev 08, 20122517
?UC141jan 11, 20055101jan 11, 20055101
LviatourUC151jun 28, 20064568jun 28, 20064568
WalterUC161ago 03, 20064532ago 03, 20064532
ThogoUC171abr 24, 20074268abr 24, 20074268
とある白い猫UC181mar 14, 20083943mar 14, 20083943
Þīn brūcendnamaUC191abr 09, 20093552abr 09, 20093552
GT5162UC201abr 09, 20093552abr 09, 20093552

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 50 edições foram feitas por usuários anônimos, de um total de 796 edições ( 6e %)
  


3 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
CarsracBotUC112out 03, 20093375nov 28, 20093319--
タチコマ robotUC21abr 16, 20083910abr 16, 20083910--
MjbmrbotUC31mar 26, 20112836mar 26, 20112836--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110GifJpgPngSvg
dez 2018229374820321683517       71117141
nov 2018229374820321683517       71117141
out 2018229374820321683517       71117141
set 2018229373820321683517       71117141
ago 2018229373820321683517       71117141
jul 2018229373820321683517       71117141
jun 2018229373820321683517       71117141
mai 2018229373820321683517       71117141
abr 2018229373820321683517       71117141
mar 2018229373820321683517       71117141
fev 2018229373820321683517       71117141
jan 2018229372820321683517       71117141
dez 2017229372820321683517       71117141
nov 2017229370820321683517       71117141
out 2017229370820321683517       71117141
set 2017229370820321683517       71117141
ago 2017229370820321683517       71117141
jul 2017229370820321683517       71117141
jun 2017229370820321683517       71117141
mai 2017229370820321683517       71117141
abr 2017229370820321683517       71117141
mar 2017229370820321683517       71117141
fev 2017229370820321683517       71117141
jan 2017229368820321683517       71117141
dez 2016229368820321683517       71117141
nov 2016229368820321683517       71117141
out 2016229368820321683517       71117141
set 2016229368820321683517       71117141
ago 2016229368820321683517       71117141
jul 2016229367820321683517       71117141
jun 2016229367820321683517       71117141
mai 2016229367820321683517       71117141
abr 2016229366820321683517       71117141
mar 2016229365820321683517       71117141
fev 2016229365820321683517       71117141
jan 2016229365820321683517       71117141
dez 2015229365820321683517       71117141
nov 2015229362820321683517       71117141
out 2015229362820321683517       71117141
set 2015229362820321676517       71117141
ago 201522936282032167654       71117141
jul 201522936282032167554       71117141
jun 201522936182032167554       71117141
mai 201522936182032167554       71117141
abr 201522936182032167554       71117141
mar 201522936082032167554       71117141
fev 201522936082032167554       71117141
jan 201522935582032167554       71117141
dez 201422935382032167554       71117141
nov 201422935382032167554       71117141
out 201422935182032167554       71117141
set 201422935082032167554       71117141
ago 201422934582032167554      171117141
jul 201422934282032167554       71117141
jun 201422934282032167554       71117141
mai 201422934182032157554       71117141
abr 201422933982032157554       71117141
mar 201422933682032157554       71117141
fev 201422933482032157554       71117141
jan 201422933182032157554      171117141
dez 201322932782032157554      571117141
nov 201322932682032157554      4571117141
out 201322832382032157444       71117141
set 201322832082032157444      171117141
ago 201322830582032147444       71117141
jul 201322830282032147444       71117141
jun 201322829882032147444       71117141
mai 201322829782032147444       71117141
abr 201322829682032147444      171117141
mar 201322829282032147444       71117141
fev 201322828582032147444       71117141
jan 201322827982032147444      171117141
dez 201222827682032137444       71117141
nov 201222826982032137444       71117141
out 201222826882032137444       71117141
set 201222826482032137444       71117141
ago 201222826172032137444       71117141
jul 201222825872032137444       71117141
jun 201222825672032137444       71117141
mai 201222824772032137444       71117141
abr 201222824372032137444       71117141
mar 201222823872032137444       71117141
fev 201222823772032137444       71117141
jan 201222823072032137444       71117141
dez 201122822872032137444       71117141
nov 201122822572032137444      471117141
out 201122821272032137344       71117141
set 201122820772032137344       71117141
ago 201122820272032137344       71117141
jul 201122819872032137344       71117141
jun 201122818772032137344       71117141
mai 201122818272032137344       71117141
abr 201122817872032137344       71117141
mar 201122817072032137244       71117141
fev 201122816872032137244      271117141
jan 201122816472032137244      371117141
dez 201022716172032137244      1271117141
nov 201022316072032137244      271117141
out 201022315872032127244       71117141
set 201022315172032127244       71117141
ago 201022314572032127244      171117141
jul 201022313172032127244      171117141
jun 201022213072032127244      2071117141
mai 201021812272032127244      1271117141
abr 201021512272032126944      1871117141
mar 201021011872032126944       71117141
fev 201021011672032126944      171117141
jan 201021011472032126944      871117141
dez 200920810472032126944       71117141
nov 200920810272032126944      271117141
out 20092089872032126944      271117141
set 20092089672032126944       71117141
ago 20092089172032126944       71117141
jul 20092089172032126944       71117141
jun 20092088972032126944      171117141
mai 20092088772032126844      871117141
abr 20092068572032126844      271117141
mar 20092067672032126844       71117141
fev 20092067272032126844       71117141
jan 20092066872032126844      1071117141
dez 20082016872002126344      137011614 
nov 20081986672002126344       7011614 
out 20081985362002126144       7011614 
set 20081984362002126144       7011614 
ago 20081984362002126144       7011614 
jul 20081984062002126144       7011614 
jun 20081984062002126144       7011614 
mai 20081983462002126144       7011614 
abr 20081983362002126144      97011614 
mar 20081923262002114744      57011614 
fev 20081912442002114744       7011614 
jan 20081912342002114744       7011614 
dez 20071912042002114744       7011614 
nov 20071911742002114744       7011614 
out 20071911742002114744       7011614 
set 20071911542002114744       7011614 
ago 20071911432002114744      17011614 
jul 20071911132002004743      27011614 
jun 20071891031992004743      217011613 
mai 2007182831992004143       7011613 
abr 2007182831992004143      67011613 
mar 2007180831972003943       6911513 
fev 2007180531972003843       6911513 
jan 2007180531972003843       6911513 
dez 2006180531972003843       6911513 
nov 2006180531972003843       6911513 
out 2006180531972003843      26911513 
set 2006178531972003843       6911513 
ago 2006178531972003843      16911513 
jul 2006178431972003843       6911513 
jun 2006178431972003843      56911513 
mai 2006176421971993843      176911513 
abr 2006171421871983743       691099 
mar 2006171421871983743       691099 
fev 2006171421871973743      9691099 
jan 2006167421841963743      51681079 
dez 200515932641963643      24528 
nov 200515912631943643       4527 
out 200515912631933643      524527 
set 200513812581933443      504477 
ago 200512412261923443      522177 
jul 200510912171913341      181 134 
jun 200528124180234         13 
mai 200522123179221         12 
abr 200522123179221         12 
mar 200522123179221         12 
fev 200522123179191         12 
jan 20051211 17910             

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

jan 2005: 1 1 English:Bínaman

fev 2005: 1 1 US Stǽr:Europisc Stǽr

mar 2005: 1 1 US Stǽr: Innung

jun 2005: 1 1 Wikibooks portal

jul 2005: 1 1 Wicigeonga Cildrum Englisc: Innung

ago 2005: 1 1 Þæt Luces Godspell (on Rúnum):Capitol 1

set 2005: 1 1 Windows XP for Onginnendum/Inlǣdung

out 2005: 1 1 Hīwwordbōc:Capitol 4/Oferblica þæs Bodiges

dez 2005: 1 1 Þæt Luces Godspell:Capitol 24

jan 2006: 1 1 Wicigeonga Wordbōc mid Mētungum:Capitol 6

fev 2006: 1 1 Wicigeonga Cildrum Englisc:Rīmcræft

mai 2006: 1 1 Wicigeonga Cildrum Englisc:Word

jun 2006: 1 1 Wicigeonga Cildrum Englisc:Foresetnessa

ago 2006: 1 1 Samweorc:Gemǽnscipe Ingang

out 2006: 1 1 Tumbestre of Izu:Capitol 1

abr 2007: 1 1 Wicigeonga Cildrum Sprǣca:Innung

jun 2007: 1 1 Wicigeonga Cildrageard:Capitol 2

jul 2007: 1 1 Windows Vista/Inlǣdung

ago 2007: 1 1 Windows Vista

mar 2008: 1 2 Samweorc:Gemǽnscipe Ingang , 2 1 Ōhthere and Ƿulfstān

abr 2008: 1 1 ᚦᚫᛏ ᚹᚩᛈᛚᛇᚦ ᚻᚪᛗᛚᛖᛏᛖᛋ:ᛁᚾᚾᚢᛝᚷ

dez 2008: 1 1 Neologisms

jan 2009: 1 1 Englisce Lēoþsangas/Innung/Dēor

abr 2009: 1 2 Englisc

mai 2009: 1 1 Níwe Englisc:Forme Héafodweard - Hú mann sægþ Níwenglisc word

jun 2009: 1 1 Wicigeonga Sunnlicu Endebyrdnes/Mōna

out 2009: 1 1 Wicigeonga Sunnlicu Endebyrdnes/Mōna

nov 2009: 1 2 Hēafodsīde

jan 2010: 1 1 Nīw Englisc

fev 2010: 1 1 Windows bócscielfe

abr 2010: 1 1 Efenealde belimpas

mai 2010: 1 1 Wordgetæl

jun 2010: 1 1 Níwe Englisc:Féowerðe Héafodweard - Níwu word, stæfcræft, and weorcword

jul 2010: 1 1 Gotisc spræc

ago 2010: 1 1 Hēafodsīde

nov 2010: 1 1 Nīw Englisc

dez 2010: 1 1 Spēonisc Ƿeorcƿord

jan 2011: 1 1 Ƿīdsīþ

fev 2011: 1 1 Windows Vista/Inlǣdung

nov 2011: 1 2 Þæt Wōplēoþ Hamletes:Innung/Lǣst 1

jan 2013: 1 1 Samweorc:Gemǽnscipe Ingang

abr 2013: 1 1 Wicigeonga Cildrum Englisc þurh Onlícnessa:Rihtwrítung

set 2013: 1 1 Samweorc:Gemǽnscipe Ingang

nov 2013: 1 1 Ƿordȝetæl

dez 2013: 1 1 Wicigeonga Cildrageard:Innung

jan 2014: 1 1 Samweorc:Gemǽnscipe Ingang

ago 2014: 1 1 Wicigeonga Sunnlicu Endebyrdnes/Mōna

Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Quinta-feira, 31 de janeiro 2019 21:14 (final run)

Dump file angwikibooks-20190101-stub-meta-history.xml.gz (edits only), size 158 kb as gz -> 1.2 Mb
Dump processed till Dec 31, 2018, on server stat1007, ready at Sat-05/01/2019-16:13 after 3 sec.

Autor:Erik Zachte (2002-Jan 2019) (Sítio web)
Endereço:erikzachte@### (no spam: ### = infodisiac.com)
Documentation / Scripts / CSV files: About WikiStats

You can download the English version of these reports here (also download common_files.zip)
You can download aggregated data here

All data and images on this page are in the public domain.