Estatísticas da Wikilivros inglês

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist
 
Jan 31, 2019: This is the final release of Wikistats-1 dump-based reports. Part of these data are available in the first release of Wikistats 2. Read more here

 

Metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.
See also metrics definitions


 
Monthly counts & Quarterly rankings: dezembro 2018
 
DataWikiautoresArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
dez 2018+1% +125% 0%   +69%      +1%
nov 20180% +63% 0%   +30%      +1%
out 20180% -55% 0%   -63%      0%
set 2018+1% +85% 0%   +104%      +1%
ago 20180% +28% +1%   +14%      0%
jul 20180% -16% 0%   +13%      0%
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
dez 2018149651572791782 k826,4 11 k      17 k
nov 201814808391241182 k326,4 6,5 k      17 k
out 2018147692276682 k226,3 5,0 k      16 k
set 201814747931682281 k1126,3 14 k      16 k
ago 2018146543391781 k1526,2 6,7 k      16 k
jul 201814621771981 k826,3 5,8 k      16 k
jun 2018146141685980 k926,3 5,2 k      16 k
mai 201814598692011080 k1526,3 9,2 k      16 k
abr 201814529531601180 k626,4 6,8 k      16 k
mar 201814476271091379 k1226,3 7,8 k      16 k
fev 20181444924841279 k1026,4 7,5 k      16 k
jan 2018144251588979 k726,4 9,1 k      16 k
dez 201714410691651279 k726,3 12 k      16 k
nov 20171434160160878 k1326,2 9,3 k      16 k
out 201714281331141678 k1126,2 8,8 k      16 k
set 201714248912012178 k1226,2 12 k      16 k
ago 201714157341041477 k626,2 17 k      16 k
jul 20171412318961077 k426,1 11 k      16 k
jun 20171410533102877 k526 12 k      16 k
mai 201714072521641077 k425,8 10 k      16 k
abr 20171402034108877 k725,8 6,7 k      15 k
mar 201713986134267777 k625,7 8,8 k      15 k
fev 20171385234125876 k625,7 5,4 k      15 k
jan 2017138182391576 k525,7 4,9 k      15 k
dez 201613795106220876 k525,7 9,3 k      15 k
nov 20161368983173876 k725,6 10,0 k      15 k
out 20161360632109776 k725,5 5,7 k      15 k
set 2016135741742691475 k1225,5 17 k      15 k
ago 201613400481371075 k2925,4 7,4 k      15 k
jul 2016133522690874 k4125,6 7,0 k      15 k
jun 2016133262296873 k1426 5,4 k      15 k
mai 201613304401801272 k1126,1 9,2 k      15 k
abr 20161326449150672 k826,1 6,4 k      15 k
mar 2016132151182281572 k1126 9,7 k      14 k
fev 2016130972095972 k626 5,2 k      14 k
jan 20161307725901271 k826 7,1 k      14 k
dez 201513052851871571 k1726 10 k      14 k
nov 20151296753165971 k1026,1 7,4 k      14 k
out 201512914541371170 k926,1 8,4 k      14 k
set 2015128601081951770 k1326,1 10 k      14 k
ago 20151275211821270 k626 5,7 k      14 k
jul 20151274114811369 k826 6,1 k      14 k
jun 201512727291211269 k1026,1 8,1 k      14 k
mai 201512698591731069 k926 9,9 k      14 k
abr 201512639401531069 k1026 7,3 k      14 k
mar 201512599651851468 k82658439,1 k412 Mb44,7 M232 k7,3 k77 k109 k14 k
fev 201512534431321168 k142658307,7 k410 Mb44,5 M231 k7,4 k76 k108 k14 k
jan 20151249120961368 k52658387,4 k408 Mb44,4 M231 k7,4 k75 k108 k14 k
dez 201412471891771067 k82658349,1 k407 Mb44,3 M231 k7,4 k75 k108 k14 k
nov 201412382741761367 k1325,958269,6 k406 Mb44,1 M231 k7,1 k75 k106 k14 k
out 201412308831831267 k825,958139,3 k403 Mb43,8 M231 k7,0 k75 k105 k14 k
set 2014122251162011267 k925,957919,9 k400 Mb43,5 M230 k6,9 k74 k104 k14 k
ago 20141210915881466 k725,957767,1 k397 Mb43,3 M230 k6,9 k74 k103 k13 k
jul 20141209420911366 k925,857738,1 k396 Mb43,2 M230 k6,9 k74 k103 k13 k
jun 201412074331201366 k1125,857666,7 k394 Mb43,0 M230 k6,9 k73 k103 k13 k
mai 201412041481861765 k925,9576310 k392 Mb42,8 M229 k6,8 k73 k103 k13 k
abr 201411993761951165 k1025,857548,4 k391 Mb42,7 M230 k6,9 k72 k102 k13 k
mar 20141191737126865 k725,857497,3 k389 Mb42,5 M230 k6,9 k72 k101 k13 k
fev 20141188033106665 k425,857436,1 k387 Mb42,3 M229 k6,9 k71 k101 k13 k
jan 20141184718961265 k725,757386,7 k386 Mb42,2 M229 k6,8 k71 k101 k13 k
dez 20131182996205564 k625,757299,2 k385 Mb42,1 M228 k6,8 k71 k101 k13 k
nov 20131173387217764 k525,657128,0 k383 Mb41,9 M228 k6,8 k71 k100 k13 k
out 2013116461202272064 k825,6569513 k381 Mb41,7 M228 k6,8 k70 k99 k13 k
set 201311526401331164 k725,556857,5 k379 Mb41,5 M227 k6,7 k69 k98 k12 k
ago 2013114862294664 k525,456874,9 k378 Mb41,4 M227 k6,7 k69 k98 k12 k
jul 20131146424103663 k525,456874,8 k376 Mb41,3 M226 k6,6 k69 k98 k12 k
jun 201311440261211063 k925,456727,0 k375 Mb41,1 M226 k6,6 k68 k97 k12 k
mai 201311414532251063 k1125,4565011 k371 Mb40,9 M222 k6,5 k67 k96 k12 k
abr 20131136147153863 k725,456368,2 k368 Mb40,5 M220 k6,5 k66 k95 k12 k
mar 201311314391451462 k2325,356239,3 k367 Mb40,3 M219 k6,5 k65 k94 k12 k
fev 201311275391341362 k1725,554957,8 k355 Mb39,1 M177 k6,5 k63 k93 k12 k
jan 201311236261141461 k925,554979,7 k342 Mb38,9 M174 k7,0 k62 k93 k12 k
dez 2012112101803952161 k2325,5549318 k338 Mb38,6 M174 k6,9 k61 k91 k12 k
nov 2012110301683881760 k3625,5534717 k326 Mb36,8 M172 k6,9 k60 k89 k12 k
out 2012108621673072059 k3025,7526715 k318 Mb35,6 M171 k6,8 k59 k88 k12 k
set 201210695331421458 k1625,952467,4 k313 Mb35,0 M170 k6,8 k58 k86 k12 k
ago 201210662301291758 k1625,952088,8 k309 Mb34,5 M169 k6,8 k58 k85 k12 k
jul 201210632471411257 k112651749,5 k304 Mb34,1 M169 k6,9 k57 k84 k12 k
jun 201210585331381557 k132651698,6 k301 Mb33,8 M169 k6,9 k56 k83 k11 k
mai 201210552762292056 k1826515214 k297 Mb33,5 M168 k7,3 k56 k82 k11 k
abr 201210476722211256 k1326514311 k294 Mb33,2 M166 k7,2 k55 k80 k11 k
mar 201210404441381856 k1426512810 k291 Mb32,9 M165 k7,3 k54 k80 k11 k
fev 201210360481531155 k1126512810 k289 Mb32,7 M164 k7,4 k52 k79 k11 k
jan 201210312291201655 k122651268,2 k287 Mb32,5 M163 k7,4 k52 k78 k11 k
dez 2011102831333192254 k2126510014 k284 Mb32,2 M159 k6,6 k51 k76 k11 k
nov 2011101501493232154 k3926,1510115 k280 Mb31,8 M158 k6,8 k51 k74 k11 k
out 2011100011002552053 k1026,4516113 k277 Mb31,4 M155 k6,9 k49 k72 k11 k
set 20119901461521552 k926,351428,5 k275 Mb31,1 M156 k7,1 k47 k71 k11 k
ago 20119855611561552 k1426,351387,6 k273 Mb30,9 M155 k7,1 k47 k71 k11 k
jul 20119794291231652 k1026,351269,4 k270 Mb30,6 M155 k7,1 k46 k71 k11 k
jun 20119765381281751 k726,351089,3 k268 Mb30,4 M155 k7,2 k45 k70 k11 k
mai 20119727541501551 k1026,250949,0 k266 Mb30,2 M155 k7,1 k45 k69 k11 k
abr 20119673582351751 k1126,2508412 k264 Mb30,0 M154 k7,4 k45 k68 k11 k
mar 20119615721881650 k1126,2507614 k261 Mb29,8 M153 k7,4 k44 k67 k11 k
fev 20119543551611550 k1526,1503512 k259 Mb29,5 M150 k7,3 k43 k66 k11 k
jan 20119488371461550 k132650309,4 k256 Mb29,3 M151 k7,7 k43 k66 k11 k
dez 201094511333251749 k1326503014 k254 Mb29,2 M151 k7,6 k43 k66 k11 k
nov 201093181693561749 k2226501617 k252 Mb29,0 M151 k7,8 k42 k65 k11 k
out 20109149772231248 k1726496213 k246 Mb28,5 M150 k7,7 k41 k63 k11 k
set 20109072501591248 k1326497410 k244 Mb28,5 M150 k7,8 k40 k63 k10 k
ago 20109022401341647 k82649639,5 k241 Mb28,3 M149 k7,8 k38 k63 k10 k
jul 20108982471571647 k1725,9494913 k239 Mb28,1 M148 k7,8 k37 k63 k10 k
jun 20108935551602047 k1825,9495615 k237 Mb27,9 M147 k7,9 k37 k63 k10 k
mai 20108880591882046 k1525,9495415 k234 Mb27,7 M147 k8,8 k36 k62 k10 k
abr 201088211092642146 k1625,8492316 k231 Mb27,4 M146 k8,7 k36 k61 k10 k
mar 201087121112542245 k1425,8490616 k228 Mb27,0 M145 k8,7 k35 k60 k10,0 k
fev 20108601852272245 k1625,7490714 k224 Mb26,9 M144 k8,6 k34 k60 k9,9 k
jan 20108516571952044 k1625,6489613 k221 Mb26,7 M142 k8,6 k34 k59 k9,9 k
dez 200984591182951144 k1725,6488013 k216 Mb26,5 M141 k8,5 k33 k59 k9,8 k
nov 200983411212961043 k1325,6487913 k214 Mb26,3 M140 k8,5 k32 k58 k9,7 k
out 20098220106280843 k1125,6485311 k211 Mb26,0 M139 k8,5 k31 k58 k9,7 k
set 20098114521761142 k1125,5484213 k208 Mb25,8 M139 k8,1 k31 k57 k9,7 k
ago 20098062492162042 k1425,4483815 k206 Mb25,7 M140 k8,0 k30 k57 k9,6 k
jul 20098013712141642 k2025,3480019 k203 Mb25,5 M139 k8,0 k28 k56 k9,1 k
jun 200979421153202841 k2225,2475924 k201 Mb25,3 M138 k11 k28 k56 k8,3 k
mai 20097827982801840 k2225,1475120 k196 Mb24,2 M137 k11 k27 k54 k7,5 k
abr 20097729983362440 k2025477919 k192 Mb23,1 M137 k11 k27 k52 k6,7 k
mar 200976312556212539 k1024,9478421 k187 Mb22,5 M137 k11 k27 k51 k6,6 k
fev 200973762534563239 k1424,5474222 k183 Mb22,2 M136 k11 k26 k50 k6,3 k
jan 20097123942582138 k1924,2470415 k180 Mb21,8 M134 k10 k26 k49 k6,2 k
dez 200870291013551838 k1824,2472415 k178 Mb21,5 M133 k10 k25 k49 k6,2 k
nov 200869281323782137 k2224,1471717 k175 Mb21,2 M133 k10 k25 k49 k6,1 k
out 200867961624841837 k1524,1470820 k172 Mb20,8 M132 k10 k24 k48 k5,9 k
set 200866341893812236 k2023,9466518 k168 Mb20,4 M129 k10,0 k23 k47 k5,5 k
ago 20086445622182035 k1323,8463913 k165 Mb20,1 M128 k9,9 k23 k46 k5,2 k
jul 20086383872802435 k1523,7464317 k163 Mb19,9 M127 k9,9 k23 k46 k5,0 k
jun 200862961102902535 k1623,5463415 k160 Mb19,6 M125 k9,7 k22 k45 k4,8 k
mai 200861861243002134 k1923,4460917 k157 Mb19,3 M123 k9,6 k22 k44 k4,6 k
abr 200860621553262334 k2523,3458118 k154 Mb18,9 M123 k9,3 k21 k44 k4,5 k
mar 200859071072922033 k2123,3456917 k150 Mb18,6 M120 k9,1 k21 k43 k4,3 k
fev 200858002164432832 k2323,2453724 k146 Mb18,1 M119 k9,1 k20 k42 k4,2 k
jan 200855841062712231 k1922,9447917 k141 Mb17,6 M116 k8,8 k20 k41 k4,0 k
dez 200754781042961831 k1322,8445215 k138 Mb17,2 M113 k8,7 k19 k41 k3,8 k
nov 200753741123622530 k2222,7442317 k135 Mb16,9 M114 k9,0 k19 k39 k3,7 k
out 200752621223651730 k2122,6437221 k131 Mb16,4 M113 k8,8 k18 k38 k3,5 k
set 200751402614562229 k2222,4437424 k128 Mb16,0 M111 k8,6 k18 k38 k3,4 k
ago 20074879982762329 k1822431116 k124 Mb15,8 M108 k8,4 k18 k37 k3,3 k
jul 200747811192811928 k1521,9431116 k122 Mb15,5 M105 k8,1 k17 k36 k3,1 k
jun 200746621343432427 k1921,7426121 k119 Mb15,1 M102 k7,9 k17 k36 k2,9 k
mai 200745281904503727 k2521,4426925 k116 Mb14,7 M101 k7,7 k17 k35 k2,4 k
abr 200743381754263226 k1921,1426024 k112 Mb14,3 M99 k7,8 k16 k34 k2,3 k
mar 200741632034642326 k2820,6416124 k108 Mb13,8 M97 k7,8 k15 k33 k2,3 k
fev 200739602374722225 k2720,4412122 k104 Mb13,4 M95 k8,2 k14 k32 k2,2 k
jan 200737231293552224 k3220,1407220 k101 Mb13,1 M93 k8,3 k14 k32 k2,2 k
dez 200635941483822523 k3320,1407521 k98 Mb12,8 M91 k8,3 k13 k31 k2,1 k
nov 200634461433962422 k2520,1409022 k95 Mb12,4 M89 k8,2 k13 k30 k2,1 k
out 200633031624152621 k2719,7404224 k91 Mb11,9 M86 k8,2 k13 k29 k2,0 k
set 200631412125001820 k2719,4396922 k87 Mb11,3 M83 k8,1 k12 k27 k1,9 k
ago 200629291693852420 k2219,1387123 k82 Mb10,7 M80 k7,8 k11 k25 k1,8 k
jul 200627601553452019 k3318,5379328 k78 Mb10,1 M76 k7,6 k11 k23 k1,8 k
jun 200626051523391618 k2218,1407023 k73 Mb8,5 M72 k7,0 k10 k20 k1,5 k
mai 200624531293261517 k3017,4423620 k70 Mb7,1 M69 k6,7 k9,4 k18 k1,3 k
abr 200623241673271416 k2517,2419319 k65 Mb6,8 M66 k6,5 k9,1 k17 k1,2 k
mar 200621571343312115 k2816,8410920 k62 Mb6,4 M64 k6,2 k8,8 k16 k1,1 k
fev 200620231392882315 k3416,4412118 k59 Mb6,1 M61 k5,8 k8,0 k15 k1,0 k
jan 200618841193112014 k2416,2401117 k54 Mb5,7 M47 k5,6 k7,2 k14 k946
dez 200517651273111613 k2715,8395817 k50 Mb5,3 M45 k5,3 k7,1 k13 k876
nov 200516381162821812 k2815,5384315 k45 Mb4,8 M42 k5,1 k6,7 k12 k821
out 200515221182592111 k2615,3374015 k41 Mb4,4 M39 k4,8 k6,2 k11 k780
set 20051404952291610 k2515352912 k36 Mb3,9 M37 k4,6 k5,8 k10 k717
ago 20051309105236239,7 k3514,9350715 k33 Mb3,5 M35 k4,2 k5,3 k9,4 k681
jul 200512048621898,6 k1615,1355411 k31 Mb3,3 M32 k4,0 k4,9 k8,9 k562
jun 200511189522878,1 k1914,6347611 k29 Mb3,0 M31 k3,8 k4,7 k8,4 k520
mai 200510236816567,5 k1414,334769,2 k27 Mb2,8 M29 k3,6 k4,4 k7,7 k499
abr 2005955103205117,1 k2313,9338612 k25 Mb2,5 M26 k3,4 k4,2 k6,9 k398
mar 20058525616266,4 k1913,532828,0 k23 Mb2,3 M23 k3,0 k3,9 k6,2 k293
fev 20057963812835,8 k1513,532686,4 k21 Mb2,1 M22 k2,8 k3,1 k5,5 k259
jan 200575864146105,4 k1713,432567,8 k20 Mb2,0 M21 k2,7 k2,8 k5,0 k200
dez 20046947716254,9 k1213,332837,0 k18 Mb1,7 M20 k2,6 k2,4 k4,4 k167
nov 20046177415094,5 k1712,933198,0 k17 Mb1,6 M19 k2,5 k2,1 k3,9 k146
out 20045434612454,0 k1012,533905,1 k13 Mb1,4 M18 k2,5 k1,9 k3,2 k128
set 2004497359733,6 k1012,232644,0 k12 Mb1,3 M17 k2,4 k1,8 k2,9 k109
ago 2004462329123,3 k712,133053,4 k11 Mb1,2 M16 k2,2 k1,7 k2,7 k99
jul 2004430459523,1 k711,932173,4 k10 Mb1,1 M15 k2,1 k1,6 k2,5 k91
jun 2004385419922,9 k811,630843,5 k9,3 Mb978 k14 k1,9 k1,6 k2,2 k80
mai 20043444610812,7 k811,429553,7 k8,2 Mb866 k13 k1,7 k1,5 k1,9 k74
abr 2004298378352,4 k101129124,1 k7,7 Mb790 k13 k1,5 k1,3 k1,6 k66
mar 20042614210092,1 k1210,725414,3 k5,8 Mb622 k12 k1,1 k9901,3 k51
fev 2004219287031,7 k910,426362,7 k4,8 Mb580 k11 k60979392729
jan 2004191215031,5 k610,427301,9 k4,3 Mb532 k9,5 k47674665918
dez 2003170286011,3 k510,326541,6 k3,9 Mb474 k8,8 k40968957313
nov 2003142174751,2 k510,226311,9 k3,5 Mb421 k8,3 k36764147711
out 2003125113361,0 k79,925822,4 k2,9 Mb353 k7,6 k3145804366
set 20031141032378369,625501,6 k2,2 Mb280 k6,9 k2684363624
ago 20031041938461669,524581,4 k1,7 Mb211 k6,1 k2253393164
jul 2003859171436310,224586461,1 Mb158 k5,4 k1872812322
jun 2003761017 351 10,92394364906 kb125 k5,0 k1532031751
mai 200366413 336110,32326348841 kb116 k4,6 k1141861491
abr 200362310 31519,82283213773 kb106 k4,1 k801681271
mar 200359714 298 9,72311285738 kb103 k3,7 k711601091
fev 20035218 284 9,22259198682 kb95 k3,2 k65133981
jan 200351614 27618,72248395655 kb92 k3,1 k56127961
dez 20024534 24118,32252185569 kb81 k2,7 k44110891
nov 20024247 225 8,12091159495 kb69 k2,5 k36107791
out 20023838 214 7,82010180450 kb62 k2,3 k32102731
set 200235413 20117,41997241421 kb58 k2,1 k2890681
ago 200231916 18416,81984270381 kb51 k1,8 k1766531
jul 20022258 158 6,22062166331 kb46 k1,6 k1342471
jun 20021737 14615,52014163295 kb41 k1,4 k 36391
mai 20021433 129 5192058253 kb34 k1,0 k 33351
abr 20021133 122 4,8198482250 kb34 k945 33341
mar 2002834 113 4,52142101257 kb33 k866 4331
fev 2002515 9914,11886181181 kb26 k765 423 
jan 20024 1 71 3,1205631141 kb21 k614  16 
dez 2001416 67 2,9207095140 kb21 k587  15 
nov 2001322 55 1,7190134110 kb17 k438  9 
out 20011 1 43 1,417371984 kb12 k285  7 
set 20011   30 1,41590849 kb7,7 k196  2 
ago 20011   26 1,314481639 kb6,1 k153  1 
jul 20011   14 1,467549,4 kb1,4 k44  1 
jun 20011   11 1,439144,9 kb68037    
mai 20011 1 10 1,142754,8 kb67036    
abr 20011   5 1,262913,6 kb49917    
mar 20011   4 1,276743,5 kb48813    
fev 200111  1 18161832 1297    
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
The following table ranks this project in relation to projects in other languages with 1000+ articles
out 20181211141 1      71
jul 20181111121 1      71
abr 20181111111 1      71
jan 20181111121 1      71
out 20171111122 1      71
jul 20171111132 1      71
abr 20171111122 1      71
jan 20171211132 1      71
out 20161111112 1      71
jul 20161111112 1      71
abr 20161111122 1      71
jan 20161111122 1      71
out 20151111122 1      71
jul 20151111112 1      71
abr 20151111121 1      71
jan 201512111315111111171
out 201411111115111111171
jul 201411111115111111171
abr 201411111115111111171
jan 201411111115111111171
out 201311111114111111171
jul 201311111214111111171
abr 201311111214111112171
jan 201311111113111112171
out 201211111113111112171
jul 201211111113111112171
abr 201211111113111112171
jan 201211111113111112170
out 201111111113111112170
jul 201111111113111112170
abr 201111111213111112170
jan 201111111213111112170
out 201011111113111112170
jul 201011111113111112170
abr 201011111213111112170
jan 201011111113111112170
out 200911111113111122170
jul 200911111113111122170
abr 200911111114111122170
jan 200911111113111122170
out 200811111113111122170
jul 200811111113111122170
abr 200811111114111122170
jan 200811111113111122170
out 200711111113111122170
jul 200711111113111122170
abr 200711111113111112170
jan 200711111113111112170
out 200611111113111111170
jul 200611111123111111169
abr 200611111122111111169
jan 200611111122111111169
out 200511111112111111168
jul 200511111112111111168
abr 200511111112111111168
jan 200511111112111111166
out 200411111111111111158
jul 200411111111111111130
abr 200411111111111111114
jan 200411111111111111113
out 200311111111111111112
jul 200311111111111111110
abr 20031111111111111117
jan 20031111111111111116
out 20021111111111111116
jul 20021111111111111115
abr 20021111111111111115
jan 20021211111111111115
out 20011211111111111114
jul 20011111111111111111
abr 20011111111111111111
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100ediçõesbytes
 WikiautoresArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikiautores (usuários registrados)
A = Wikiautores que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikiautores que editaram pelo menos dez vezes desde que chegaram
C = Wikiautores que contribuíram cinco vezes ou mais este mês
D = Wikiautores que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  1000  2500  5  10  100  1000  1  3  5  10  25  100  250  1000  2500  5  10  100  1000  10000  1  3  5  10  25  100  250  1000  2500  5  10  100  1000 
dez 2018475314279213103171  111 1467856239    1    151786740151   32  
nov 20183341611247032115  111 1045237191121       221118814415    42  
out 201828811076452563  11  11649301151        24015813084252   32  
set 2018384210168137862271 111 70291682    1    1255335211542  22  
ago 2018291127916633752 11  5814863         12334251681   22  
jul 201824410071503295      6322105311       88412613911  32  
jun 201826911985542794  11  4813852         7227141162   32  
mai 201843025220113767103  11  71181283    1    113341712511  32  
abr 20183962121608941112  111 14479614113    21   1042914731   32  
mar 20184031551096936135  222 138867061374   11   1795629146    33  
fev 20183111268461311251 111 63231585    1    13043312161   32  
jan 2018311118885428962 11  6218128421  1    9838221510311 22  
dez 20174802201651136012321221 1633516511   1    1193517106211 42  
nov 201739120516010647832 11  8327169431  2    95291774211 33  
out 201735815911478411641 111 722716721   21   973524168422 22  
set 201737623120115189215  111 7124146311  21   129513726942  33  
ago 2017290127104703914831332268282075222 531  13759442210521 53  
jul 20173141349655301032122  6316952    11   102322112521  22  
jun 20173491481026530842111  6314953    11   95352615711  22  
mai 201741221416497461041 111 632415104    11   114372618741  43  
abr 2017354161108703684  11  80271611611  1    107362715931  32  
mar 20175523212671696573  11  1391028673391        12433191081   32  
fev 201743718812570318   11  1461009182361   11   19338231681   22  
jan 201730612891522752  11  6515821    111  13747291791   32  
out 201828811076452563  11  11649301151        24015813084252   32  
jul 201824410071503295      6322105311       88412613911  32  
abr 20183962121608941112  111 14479614113    21   1042914731   32  
jan 2018311118885428962 11  6218128421  1    9838221510311 22  
out 201735815911478411641 111 722716721   21   973524168422 22  
jul 20173141349655301032122  6316952    11   102322112521  22  
abr 2017354161108703684  11  80271611611  1    107362715931  32  
jan 201730612891522752  11  6515821    111  13747291791   32  
out 2016351166109713072  11  60149631        1063223128221 32  
jul 2016281124906241831 11  85211182    1    983422136    22  
abr 2016368202150954262      18511773252    1    12743311971   22  
jan 20163271389066361211 221 92241384         187856039151   43  
out 20153951841378950115  11  97261951         12032191192   32  
jul 2015303124815633134      77211295         12735221592   22  
abr 20154051941539549103      973823134    222221715036201141  3311
jan 2015352137966238135  221 863323124    11   16967442152   22  
out 201445222418311063124  11  71271771    1    14342311881   22  
jul 20142901249159311361 1   672312711        12943261461   11  
abr 201445825419513356112  11  1508774531711       20657321791   11  
jan 2014378148966231122  1   6316732         1262819931   22  
out 2013539298227167108201      802110631        1524330176    22  
jul 2013341136103623061      5621145          11739221171   22  
abr 20134552111539438831 21  912619741        138432717121   22  
jan 201339516311464401481 31  1183017831        174573520121   221 
out 2012665397307219117207  211 1164120941        1745636156    22  
jul 201240119114196411271 321 962516731   1    146452819123   22  
abr 2012516293221136571261 411 1203928171031  11   2035734231242  22  
jan 20125091701207544165  3   1343921761        284684022112   22  
out 201170035325516078207  431 1424626161031  11   273946848237   44  
jul 201147418712379501641 2   10439191310    1    1976037231231  22  
abr 201170933823514974173  31  12040241581   22   227553118102   44  
jan 20116152201468043155  41  133534024611  22   2237043251141  321 
out 2010814332223124531241142  1754932201011  11   2267248261521  332 
jul 20106022201579154169114   1475440201132  11   279835533147311221 
abr 2010937392264185802181 64  15157331671   11   3801095834143111331 
jan 201090130719511151206  54  139402717104   11   41211169361562  431 
out 200910534072801495882  731 18245251271   11   4011096532162   33  
jul 2009891331214147731672187  179795837911  11   362109713618411 321 
abr 20091320544336199982492 102  274703920101   1    44913184412241  541 
jan 2009131941725814974217  103  2841176227123   1    66330822112951104  321 
out 20081465653484309147183  102  181613218541  21   4601397336183   32  
jul 200811374012801709124811842 185674323921  22   5301718642192   441 
abr 20081429523326202100236  169  2268148241241  22   48916194352073  331 
jan 2008141445327115789227  127  2149050321561  11   52815585462032  221 
out 20071597579365198781792 116  25082512513721      474148894817641 431 
jul 2007132546128115781195  74  1916751261242       42214987481852  11  
abr 20071802672426252119327  105  228976138173        4911571016431101      
jan 20071820592355175872210  1471 26610568392072       559198109633382      
out 20062047675415230982610  1061 2339353221042  21   49615292481942  32  
jul 200616395713451927320721951 258996023103        57517295441344      
abr 2006159253932719679147  841 2961046929113        577197108502172      
jan 2006144651331116276201  96  2751206634111        585211121521651  21  
out 2005103438525916276214  74  22710262291111       38511968311641      
jul 20059133282181256391  83  200794624711       37513686401631  1   
abr 200583734020513368111      15962372231        322944924121       
jan 20055832011468834102      1064230143         222674022111       
out 200450118312467315   11  944928102         1585634146        
jul 20044201589551202   11  552719121         16672423112        
abr 200433712883513051      6636241351        1133321135        
jan 2004179775031133       3616962         79191162        
out 20031435733191262  1   27161182         3814942        
jul 200310928176211      15842          267542        
abr 20036518101                      4            
jan 200366241441                     81           
out 2002502181                      61           
jul 2002351782                      21           
abr 200224831        1                          
jan 20021641                                    
out 20011111                                    
jul 20014                                     
abr 20011                                     

 

Distribuição de edições de artigos por wikiautores
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikiautoresEdições total
169,094100.0%1,630,386100.0%
326,50938.4%1,566,68996.1%
1014,96421.7%1,499,88292.0%
326,3169.1%1,349,33682.8%
1001,8582.7%1,109,59968.1%
3165050.7%892,26854.7%
10001670.2%715,37943.9%
3162540.1%521,47732.0%
10000160.0%322,02119.8%
3162310.0%56,7403.5%

 

50 wikiautores recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions
agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
QuiteUnusualUC2 028,745267,32911out 02, 20074107405---
Pi zeroUC3 027,8809730,89390dez 05, 200740438201--
Efex3UC4 023,5241983-jul 27, 201416174,463---
Panic2k4UC7 019,426517,0602out 21, 20045183394---
NonenmacUC8 018,51329463-nov 22, 20045151171---
ChazzUC13 012,510431,92317jul 17, 20064549343---
NeojacobUC15 010,28320--out 08, 2010300580---
RickstambaughUC16 010,04610347-ago 05, 200934343471--
Jeff1138UC17 09,5371356-nov 14, 2009333397---
Adam majewskiUC20 08,076363049nov 11, 2007406796---
XaniaUC21 07,519226,64234out 11, 20064463132---
ArmchairUC22 07,4011847651dez 21, 20074027721--
JackPotteUC31+15,585872,73427mai 27, 200935041082--
PlukeUC34+15,24013864811jul 14, 200452822461--
CommonsDelinkerUC35-15,173105191jan 31, 20074351----
AtcoviUC41+14,5722081,77347nov 21, 2013186523---
BelteshazzarUC51+33,2631774123mar 12, 201032153---
LeaderboardUC53+23,2091421,14165ago 28, 2014158525---
Dan PolanskyUC54-23,18712977-jan 11, 20084006150---
JaspalkalerUC61 02,8621430-abr 26, 20083900128---
MathmenschUC64 02,8232303-nov 05, 20131881265---
LiaoUC74 02,337781-dez 27, 2004511666---
Valery StarikovUC79+42,1588593-out 31, 2016790473--
RcragunUC87+11,92021171-out 21, 20064453476--
Tem5psuUC90 01,8271867-set 18, 2013192915---
BORGATO PierandreaUC91 01,81054,82058fev 04, 2008398226---
TyoyafudUC102+31,657175-abr 15, 200550072---
Samuel.dellitUC119+211,4712368745mai 12, 201823217---
Az1568UC144 01,21711,41412ago 03, 20064532----
ManuelGRUC146 01,2073365-nov 07, 2004516610---
CormullionUC149 01,190225-set 11, 2014157116---
LarsnoodenUC152 01,173629311fev 17, 2011287321---
JusjihUC153 01,14813751mai 18, 20045339251---
CnrowleyUC168 0998213-jun 09, 2015130068---
Dirk HünnigerUC180+286445275mar 16, 2011284612---
Dave BraunschweigUC202+12279330729-jan 06, 2014181930689--
MeanmicioUC217+2738302-nov 12, 20112605331--
Jumark27UC219+6720234-out 14, 201511733---
PeterEasthopeUC277+335968520814ago 02, 20168804516--
TropicalkittyUC285+55762225-mai 29, 20151311----
Officer781UC298+653613--set 08, 20122304----
HakanISTUC329 04811869-jan 13, 20161082----
Jellysandwich0UC346+254582637-set 05, 2018116----
WbjimmydUC353+1451310-ago 22, 2009341734---
Math buffUC359+254462817-fev 04, 201769410---
TegelUC408+239321531jul 25, 20112715----
MatiiaUC428 0374192-dez 08, 20141483----
YannUC433+23661188-set 02, 2003559832---
TheknightwhoUC436+136415-fev 06, 2016105833---
HenkvDUC443+31358212191nov 25, 20045148261--

 

20 wikiautores recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
AdrignolaUC156,740abr 18, 20093543out 16, 201875
WhiteknightUC520,648set 08, 20054861abr 30, 20132070
JomegatUC620,162out 08, 20054831jan 14, 2017715
JgukUC918,460out 04, 20054835jan 14, 20074368
PNW RavenUC1014,793jan 10, 20074372mar 05, 2018300
RahulkepapaUC1114,494set 22, 20122290abr 08, 2018266
PokestarFanUC1214,422jan 28, 20161067mar 30, 2018275
PullUpYourSocksUC1411,375jan 21, 20055091jul 23, 2018160
Circuit-fantasistUC188,755mai 06, 20074256out 26, 201865
TdvorakUC198,483jun 04, 20054957set 22, 201899
Mike's bot accountUC236,658set 04, 20074135jan 15, 20103271
Mike.lifeguardUC246,446out 15, 20064459out 19, 20102994
Thenub314UC255,985abr 27, 20083899mai 12, 20141693
SluffsUC265,896jul 19, 20093451dez 24, 2016736
KieranMaherUC275,866dez 13, 20054765out 26, 201865
EfexUC285,861out 22, 20112626abr 21, 20151349
1sfoersterUC295,749ago 18, 20112691ago 19, 2018133
MatsievskyUC305,707ago 13, 20141600jun 05, 2017573
HagindazUC325,504fev 20, 20064696dez 21, 20122200
TibetologistUC335,399fev 12, 20093608nov 15, 201845

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 508.412 edições foram feitas por usuários anônimos, de um total de 2163.017 edições ( 23e %)
  


50 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
JackBotUC110,389nov 12, 20102970dez 29, 20181--
QUBotUC22,380fev 05, 20122520ago 21, 20131957--
SmackBotUC31,554mar 04, 20064684jul 10, 201127303-
LcarsbotUC41,217jun 17, 20074214jun 17, 20074214--
Tsca.botUC5911fev 05, 20064711jun 13, 20074218--
タチコマ robotUC6668jan 05, 20084012jul 11, 2017537--
HethrirBotUC7635out 02, 20112646mai 02, 20122433--
Guanabot~enwikibooksUC8574jul 09, 20045287out 19, 20064455--
Herbys botUC9392dez 22, 20064391fev 16, 20074335--
CarsracBotUC10376jul 14, 20083821jun 03, 20103132--
MaintenanceBotUC11326jan 29, 20161066mar 30, 2018275--
VolkovBotUC12274mar 02, 20074321jul 31, 20122343--
JAnDbotUC13266ago 29, 20064506ago 02, 20122341--
SwayBotUC14221jul 02, 20083833jan 05, 200936468-
AnomieBOTUC15211set 09, 20083764mai 19, 2017590--
Luckas-botUC16202jul 06, 20083829abr 30, 201224352-
Idioma-botUC17175fev 08, 20074343out 14, 20112634--
SigmabotUC18172ago 05, 20093434ago 25, 20093414--
BimBotUC19171jan 28, 20064719mar 05, 20083952--
YobotUC20164mar 14, 20103213dez 13, 2016747--
CmdrObotUC21162mar 18, 20064670fev 04, 20122521--
EskimbotUC22145out 05, 20054834ago 14, 20064521--
Rei-botUC23123fev 08, 20074343ago 12, 20083792--
JuethoBotUC24110fev 02, 20151427fev 05, 20151424--
SwiftBotUC25105ago 22, 20064513jan 20, 20103266--
FrescoBotUC26103fev 27, 20103228fev 16, 20141778--
DumZiBoTUC27102fev 03, 20083983mai 23, 20093508--
GrouchoBotUC28101dez 07, 20083675jul 19, 20112721--
MrRobot 321UC2998fev 16, 20161048mar 11, 20161024--
EscarbotUC3097jun 24, 20064572abr 30, 20122435--
Crochet.david.botUC3195dez 12, 20074036out 02, 20122280--
AlexbotUC3293fev 03, 20083983nov 13, 20102969--
XLinkBotUC3392fev 11, 20083975out 28, 20112620--
LaaknorBotUC3491ago 05, 20083799mar 31, 20122465--
RjwilmsiBotUC3582dez 17, 20093300out 13, 201319041-
SamatBotUC3677mai 22, 20083874mai 26, 20083870--
JVbotUC3771nov 14, 20074064nov 19, 20074059--
ZorrobotUC3864jun 07, 20083858jul 26, 20122348--
EmausBotUC3961set 30, 20103013jun 04, 20132035--
MjbmrbotUC4056out 05, 20103008mar 27, 20112835--
MerlLinkBotUC4155mai 20, 20093511fev 22, 20112868--
ArthurBotUC4252dez 14, 20083668set 28, 20112650--
ClothbotUC4344nov 09, 20093338dez 01, 201318558-
Helpful Pixie BotUC4440jul 22, 20112718mai 14, 20122421--
DragonBotUC4537out 20, 20074089ago 15, 20093424--
RubinbotUC4635ago 16, 20083788jul 28, 201127121-
DexbotUC4734jul 09, 20122365fev 26, 20151403--
MystBotUC4828set 10, 20083763jan 17, 201225391-
ObersachsebotUC4926dez 23, 20083659ago 23, 20093416--
AdlerbotUC5026jul 02, 20093468mar 23, 20103204--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110BmpGifJpgOggPdfPngSvgXls
dez 201891 k22 k3,4 k1,7 k78411 k808,6 k 5,2 k  1502,1 k 2114545331,1 k11
nov 201891 k22 k3,4 k1,7 k78311 k808,5 k 5,2 k  1502,1 k 2114545331,1 k11
out 201891 k21 k3,4 k1,7 k78311 k808,5 k 5,2 k  1502,1 k 2114545331,1 k11
set 201891 k21 k3,4 k1,7 k78211 k808,5 k 5,2 k  1502,1 k 2114545331,1 k11
ago 201890 k21 k3,4 k1,7 k78211 k808,4 k 5,2 k  1502,1 k 2114545331,1 k11
jul 201890 k21 k3,4 k1,7 k78211 k808,2 k 5,2 k  1502,1 k 2114543331,1 k11
jun 201889 k21 k3,4 k1,7 k78211 k808,0 k 5,2 k  1502,1 k 2114543331,1 k11
mai 201889 k21 k3,4 k1,7 k78211 k807,9 k 5,2 k  1502,1 k 2114543331,1 k11
abr 201889 k21 k3,4 k1,7 k78210 k807,6 k 5,2 k  1472,1 k 2114543331,1 k11
mar 201888 k21 k3,4 k1,7 k78210 k807,6 k 5,2 k  1462,1 k 2114543331,1 k11
fev 201888 k21 k3,4 k1,7 k78110 k807,6 k 5,2 k  1432,1 k 2114543331,1 k11
jan 201888 k21 k3,4 k1,7 k78110 k807,6 k 5,2 k  1432,1 k 2114543331,1 k11
dez 201788 k21 k3,4 k1,7 k78110 k807,5 k 5,2 k  1432,1 k 2114543331,1 k11
nov 201787 k21 k3,4 k1,7 k78110 k797,5 k 5,2 k  1412,1 k 2114543331,1 k11
out 201787 k21 k3,3 k1,7 k78110 k797,4 k 5,2 k  1412,1 k 2114543331,1 k11
set 201786 k20 k3,3 k1,7 k78110,0 k797,4 k 5,1 k  1412,1 k 2114543331,1 k11
ago 201786 k20 k3,3 k1,7 k7819,8 k797,4 k 5,1 k  1412,1 k 2114543331,1 k11
jul 201786 k20 k3,2 k1,7 k7819,8 k787,3 k 5,1 k  1412,0 k 2114542331,1 k11
jun 201785 k20 k3,2 k1,7 k7819,7 k787,3 k 5,1 k  1412,0 k 2114542331,1 k11
mai 201785 k20 k3,2 k1,7 k7819,7 k787,3 k 5,1 k  1412,0 k 2114542331,1 k11
abr 201785 k20 k3,2 k1,7 k7819,7 k787,2 k 5,1 k  1412,0 k 2114542331,1 k11
mar 201785 k20 k3,2 k1,7 k7819,7 k787,2 k 5,1 k  1412,0 k 2114542331,1 k11
fev 201784 k20 k3,2 k1,7 k7819,7 k787,2 k 5,1 k  1412,0 k 2114542331,1 k11
jan 201784 k20 k3,2 k1,7 k7819,7 k787,2 k 5,1 k  1412,0 k 2114542331,1 k11
dez 201684 k20 k3,2 k1,7 k7819,7 k787,2 k 5,1 k  1412,0 k 2114542331,1 k11
nov 201684 k20 k3,2 k1,7 k7819,6 k786,9 k 5,1 k  1402,0 k 2114542331,1 k11
out 201683 k19 k3,2 k1,7 k7819,6 k786,8 k 5,1 k  1402,0 k 2114542331,1 k11
set 201683 k19 k3,2 k1,7 k7799,5 k786,8 k 5,1 k  1402,0 k 2114542331,1 k11
ago 201683 k19 k3,2 k1,7 k7739,5 k786,7 k 5,1 k  1402,0 k 2114542331,1 k11
jul 201682 k19 k3,1 k1,7 k7739,5 k786,7 k 5,1 k  1402,0 k 2114542331,1 k11
jun 201680 k19 k3,1 k1,7 k7719,5 k786,7 k 5,1 k  1402,0 k 2114542331,1 k11
mai 201680 k19 k3,1 k1,7 k7719,5 k786,7 k 5,1 k  1392,0 k 2114542331,1 k11
abr 201680 k19 k3,1 k1,7 k7719,5 k786,6 k 5,1 k  1392,0 k 2114542331,1 k11
mar 201679 k19 k3,1 k1,7 k7719,5 k786,5 k 5,1 k  1392,0 k 2114542331,1 k11
fev 201679 k19 k3,1 k1,7 k7709,4 k786,5 k 5,1 k  1392,0 k 2114542331,1 k11
jan 201679 k19 k3,1 k1,7 k7709,4 k786,4 k 5,1 k  1382,0 k 2114542331,1 k11
dez 201578 k19 k3,1 k1,7 k7709,4 k786,4 k 5,1 k  1292,0 k 2114542331,1 k11
nov 201578 k18 k3,1 k1,7 k7709,4 k786,3 k 5,1 k  1132,0 k 2114542331,1 k11
out 201577 k18 k3,1 k1,7 k7709,4 k776,2 k 5,1 k  1102,0 k 2114542331,1 k11
set 201577 k18 k3,1 k1,7 k7709,4 k776,1 k 5,1 k  1102,0 k 2114542331,1 k11
ago 201577 k18 k3,1 k1,7 k7709,4 k776,1 k 5,1 k  1102,0 k 2114542331,1 k11
jul 201576 k18 k3,1 k1,7 k7709,4 k776,1 k 5,1 k  1102,0 k 2114542331,1 k11
jun 201576 k18 k3,0 k1,7 k7709,3 k776,0 k 5,1 k  1102,0 k 2114542331,1 k11
mai 201576 k18 k3,0 k1,7 k7699,3 k775,8 k 5,1 k  1092,0 k 2114542331,1 k11
abr 201576 k18 k3,0 k1,7 k7699,3 k775,7 k 5,1 k  1092,0 k 2114541331,1 k11
mar 201575 k18 k3,0 k1,7 k7669,3 k775,7 k 5,1 k  1091,9 k67752114541331,1 k11
fev 201575 k18 k3,0 k1,7 k7669,2 k775,7 k 5,1 k  1091,9 k59902114541331,1 k11
jan 201574 k17 k3,0 k1,7 k7649,2 k775,7 k 5,1 k  1091,9 k51242114532331,0 k11
dez 201474 k17 k3,0 k1,7 k7629,2 k775,6 k 5,1 k  1091,9 k70262114527331,0 k11
nov 201474 k17 k3,0 k1,7 k7629,2 k775,6 k 5,0 k  1091,9 k72692114527331,0 k11
out 201473 k17 k3,0 k1,7 k7629,1 k775,6 k 5,0 k  1091,9 k71582114527331,0 k11
set 201473 k17 k3,0 k1,7 k7619,1 k775,6 k 5,0 k  1091,9 k76312114527331,0 k11
ago 201473 k17 k2,9 k1,7 k7619,1 k775,6 k 5,0 k  1091,9 k60102114527331,0 k11
jul 201473 k17 k2,9 k1,7 k7619,0 k775,6 k 4,8 k  1091,9 k67512114527331,0 k11
jun 201472 k17 k2,9 k1,7 k7609,0 k775,5 k 4,4 k  1091,9 k50832114527331,0 k11
mai 201472 k16 k2,9 k1,7 k7608,9 k775,5 k 4,4 k  1091,9 k80362114527331,0 k11
abr 201472 k16 k2,9 k1,7 k7588,9 k775,5 k 4,4 k  1091,9 k67292114527331,0 k11
mar 201471 k16 k2,9 k1,7 k7588,9 k775,5 k 4,3 k  1091,8 k51062114527331,0 k11
fev 201471 k16 k2,9 k1,7 k7588,8 k775,5 k 4,3 k  1091,8 k42942114527331,0 k11
jan 201471 k16 k2,9 k1,7 k7578,8 k775,5 k 4,3 k  1091,8 k47722114527331,0 k11
dez 201371 k16 k2,9 k1,7 k7578,7 k775,4 k 4,3 k  1091,8 k70132114527331,0 k11
nov 201371 k16 k2,9 k1,7 k7558,7 k775,4 k 4,3 k  1091,8 k58422114527331,0 k11
out 201370 k16 k2,8 k1,7 k7558,7 k775,4 k 4,3 k  1091,8 k97132114527331,0 k11
set 201370 k16 k2,8 k1,7 k7558,7 k775,4 k 4,3 k  1091,8 k55482114527331,0 k11
ago 201370 k16 k2,8 k1,7 k7558,6 k775,4 k 4,3 k  1091,8 k36332114527331,0 k11
jul 201370 k15 k2,8 k1,6 k7558,6 k775,4 k 4,3 k  1091,8 k351821145273394511
jun 201370 k15 k2,8 k1,5 k7548,6 k765,4 k 4,3 k  1091,7 k498721145273386711
mai 201369 k15 k2,8 k1,5 k7548,5 k765,4 k 4,3 k  1091,7 k851621145273386711
abr 201369 k15 k2,8 k1,5 k7518,5 k765,4 k 4,3 k  1081,7 k663521145273386711
mar 201369 k15 k2,8 k1,5 k7508,5 k765,3 k 4,3 k  1081,7 k731021145273286711
fev 201368 k15 k2,8 k1,5 k7458,5 k765,3 k 4,3 k  1081,6 k627821145273286711
jan 201368 k15 k2,8 k1,5 k7458,4 k765,3 k 4,3 k  1081,5 k783921145273286711
dez 201267 k15 k2,8 k1,5 k7458,4 k765,2 k 4,3 k  1081,5 k1538821145273285511
nov 201266 k15 k2,8 k1,5 k7458,4 k765,2 k 4,2 k  1081,5 k1449221145273285511
out 201265 k15 k2,8 k1,5 k7458,3 k765,2 k 4,2 k  1081,5 k1291621145273285511
set 201264 k15 k2,7 k1,5 k7458,3 k765,2 k 4,2 k  1081,5 k574721145273285511
ago 201264 k14 k2,7 k1,5 k7458,3 k765,2 k 4,2 k  1081,5 k716021145273285511
jul 201263 k14 k2,7 k1,5 k7458,3 k765,2 k 4,2 k  1081,5 k777521145273285411
jun 201263 k14 k2,7 k1,5 k7458,2 k765,1 k 4,2 k  1071,5 k680321145273285411
mai 201262 k14 k2,7 k1,5 k7428,2 k765,1 k 4,2 k  1051,5 k12086211452732854 1
abr 201262 k14 k2,7 k1,5 k7337,9 k765,1 k 4,2 k  1051,4 k8769211452732853 1
mar 201261 k14 k2,7 k1,5 k7247,8 k765,1 k 4,2 k  1051,3 k7292211452532853 1
fev 201261 k14 k2,7 k1,5 k7227,7 k755,0 k 4,2 k  1011,3 k7532211452432853 1
jan 201260 k13 k2,7 k1,5 k7157,7 k755,0 k 4,2 k  1011,3 k6088211452432853 1
dez 201160 k13 k2,6 k1,5 k7157,7 k755,0 k 4,2 k  991,3 k11659211452432853 1
nov 201159 k13 k2,6 k1,5 k7157,6 k755,0 k 4,2 k  991,2 k11752211452432852 1
out 201158 k13 k2,6 k1,5 k7157,5 k754,6 k 4,2 k  981,2 k9821211452432852 1
set 201158 k13 k2,6 k1,5 k7147,5 k754,6 k 4,2 k  981,2 k6021211452432852 1
ago 201158 k13 k2,6 k1,5 k7007,5 k754,6 k 4,2 k  981,2 k5928211452432851 1
jul 201157 k13 k2,6 k1,3 k6937,5 k754,5 k 4,2 k  971,2 k7561211452432679 1
jun 201157 k12 k2,6 k1,3 k6917,4 k754,5 k 4,2 k  971,2 k7187211451632662 1
mai 201156 k12 k2,6 k1,3 k6907,4 k754,5 k 4,2 k  961,2 k6487211450832659 1
abr 201156 k12 k2,6 k1,2 k6907,4 k754,5 k 4,2 k  951,2 k8824211447232648 1
mar 201156 k12 k2,6 k1,2 k6907,4 k754,5 k 4,2 k  941,2 k11182211444732647 1
fev 201155 k12 k2,6 k1,2 k6907,4 k754,5 k 4,1 k  941,2 k9063211444732647 1
jan 201155 k12 k2,6 k1,2 k6327,3 k684,4 k 4,1 k  941,2 k6998211444632647 1
dez 201055 k12 k2,5 k1,2 k5977,3 k574,4 k 4,1 k  941,2 k11536211444532647 1
nov 201054 k12 k2,5 k1,2 k4777,2 k464,4 k 4,1 k  941,2 k13241210743732647 1
out 201053 k12 k2,5 k1,2 k4697,2 k444,3 k 4,1 k  941,2 k10403210743432647 1
set 201053 k11 k2,4 k1,2 k4677,1 k444,3 k 4,1 k  941,2 k7501210743232646 1
ago 201052 k11 k2,4 k1,2 k4567,1 k444,2 k 4,1 k  921,2 k7125210743232646 1
jul 201052 k11 k2,4 k1,2 k4306,9 k444,2 k 4,1 k  921,2 k10461210743132646 1
jun 201052 k11 k1,6 k1,2 k4276,7 k444,1 k 4,1 k  921,1 k12064210743131643 1
mai 201051 k11 k1,6 k1,1 k4086,6 k404,0 k 4,1 k  911,1 k11686210743131515 1
abr 201050 k11 k1,6 k1,0 k4056,5 k383,9 k 4,1 k  911,1 k13399210742131494 1
mar 201050 k11 k1,6 k1,0 k3796,4 k383,8 k 4,1 k  911,1 k12708210742131494 1
fev 201049 k11 k1,5 k1,0 k3746,3 k383,8 k 4,1 k  911,1 k10896210742131494 1
jan 201049 k10 k1,5 k1,0 k3736,3 k383,8 k 4,1 k  911,1 k9175210742031494 1
dez 200948 k10 k1,5 k1,0 k3656,2 k383,7 k 4,0 k  911,1 k10032210740731494 1
nov 200948 k10 k1,5 k9693476,2 k383,7 k 4,0 k  911,1 k963928038831494 1
out 200947 k10 k1,2 k9643476,1 k383,6 k 4,0 k  911,1 k739728038331494 1
set 200947 k10 k1,2 k9623466,0 k383,6 k 4,0 k  911,1 k1009828038131494 1
ago 200946 k9,9 k1,2 k9623445,9 k383,5 k 4,0 k  911,1 k1263528038131494 1
jul 200946 k9,8 k1,1 k9563385,9 k383,3 k 3,9 k  911,1 k1687428037731492 1
jun 200944 k9,6 k1,1 k9373275,6 k383,0 k 3,7 k  911,1 k2074327836031492 1
mai 200943 k9,4 k1,1 k9303175,4 k382,5 k 3,5 k  911,0 k1644427835431491 1
abr 200942 k9,3 k1,1 k9183055,3 k372,1 k 3,5 k  909981545927834231491 1
mar 200941 k9,1 k1,1 k9132935,2 k372,0 k 3,5 k  889961752327833831490 1
fev 200941 k9,0 k1,0 k9072755,1 k362,0 k 3,5 k  879961782827833331489 1
jan 200940 k8,8 k1,0 k8922715,1 k362,0 k 3,5 k  879941106027832631481 1
dez 200839 k8,4 k9848862424,9 k361,9 k 3,4 k  879551147527832631475 1
nov 200839 k8,2 k9728792384,8 k361,8 k 3,4 k  868431275627831931475 1
out 200838 k8,1 k9468732324,8 k351,8 k 3,4 k  868401509827831631472 1
set 200837 k7,9 k9348632244,7 k341,8 k 3,4 k  868321406527831331465 1
ago 200836 k7,7 k9278262144,6 k331,8 k 3,3 k  868011026727830531436 1
jul 200836 k7,5 k9238192044,5 k321,8 k 3,2 k  867851353527830531429 1
jun 200835 k7,4 k9148012024,5 k321,7 k 3,2 k  857791134127829731419 1
mai 200835 k7,2 k8907521974,4 k321,7 k 3,2 k  857771269627827531392 1
abr 200834 k7,0 k8717391894,3 k321,7 k 3,2 k  857731326027827431380 1
mar 200833 k6,8 k8547351824,2 k321,6 k 3,1 k  857541212027827431376 1
fev 200832 k6,7 k8117021744,1 k321,6 k 3,1 k  857361871127825231365 1
jan 200832 k6,5 k7966481723,9 k321,6 k 3,1 k  857351225327819931364 1
dez 200731 k6,3 k7616481463,8 k321,6 k 3,1 k  847301069727819931364 1
nov 200730 k6,1 k7436481203,6 k321,6 k 3,1 k  827241270227819931364 1
out 200730 k5,9 k7146481143,3 k321,5 k 3,0 k  796851530527819931364 1
set 200729 k5,8 k6776481072,8 k321,4 k 3,0 k  746701901227819931364 1
ago 200728 k5,6 k6616471002,7 k321,4 k 3,0 k  736471114427819831364 1
jul 200727 k5,5 k647589972,6 k321,4 k 2,9 k  736421063627714131364 1
jun 200727 k5,3 k631586952,6 k321,4 k 2,9 k  726151365727714131361 1
mai 200726 k5,1 k599585952,5 k311,3 k 2,8 k  716001805527714131360 1
abr 200725 k4,9 k593573922,4 k311,3 k 2,8 k  705881577127613231358 1
mar 200724 k4,8 k581573832,3 k311,3 k 2,7 k  695611593627613231358 1
fev 200724 k4,7 k542539812,2 k311,3 k 2,7 k  685501486127610331353 1
jan 200723 k4,6 k515536792,1 k311,2 k 2,6 k  685451365927610331350 1
dez 200622 k4,4 k477522792,0 k311,2 k 2,4 k  68480144722769131348 1
nov 200621 k4,2 k426515781,9 k311,1 k 2,4 k  67434153072768731345 1
out 200620 k4,1 k410454781,9 k311,1 k 2,3 k  66378163772768631285 1
set 200620 k3,9 k393454781,8 k291,1 k 2,3 k  63327145562768631285 1
ago 200619 k3,7 k383452781,7 k291,1 k 2,2 k  60321165272768631283 1
jul 200618 k3,5 k365442781,6 k291,0 k 2,2 k  5929421165276853 275 1
jun 200617 k3,3 k355440771,5 k29734 2,1 k  5726317317276843 274 1
mai 200616 k3,2 k326420731,5 k27551 2,1 k  5624812435276713 267 1
abr 200615 k3,0 k306416731,4 k27532 2,1 k  4221611856276693 265 1
mar 200614 k2,8 k294416731,3 k27480 2,0 k  4217613862276693 265 1
fev 200613 k2,6 k273415721,2 k27437 2,0 k  4116912143276693 264 1
jan 200612 k2,5 k256363721,0 k27433 1,9 k  391659981258403 259 1
dez 200512 k2,3 k2483467284327425 1,9 k  3614811068246393 255 1
nov 200511 k2,2 k2353227076926417 1,9 k  3513410211237253 255  
out 20059,9 k2,0 k2122816968019411 1,8 k  341179517237253 214  
set 20059,1 k1,9 k1922736961219355 1,8 k  311128163237253 206  
ago 20058,3 k1,8 k1702656851819284 1,8 k  3110010092237243 199  
jul 20057,3 k1,7 k1512556846019225 1,6 k  31766788235222 194  
jun 20056,9 k1,5 k1432366739019145 1,5 k  26656283230202 182  
mai 20056,3 k1,4 k1372186636819137 1,5 k  24585112222172 175  
abr 20056,0 k1,3 k1341986633919132 1,3 k  24517306210162 168  
mar 20055,4 k1,2 k1201916629319129 1,1 k  2248487229122 166  
fev 20054,9 k1,1 k1111716622719126 1,0 k  2247378628122 147  
jan 20054,6 k1,1 k1011706617819121 814  2144485828122 146  
dez 20044,1 k974951416615018115 706  2043454828112 118  
nov 20043,8 k88693140621361893 652  1639531628102 118  
out 20043,4 k77789133621181848 596  14132732662 117  
set 20043,1 k72085115611011847 532  14124692 52 106  
ago 20042,8 k642831126186175 502  14120462 32 105  
jul 20042,6 k568791116182163 479  14123192 32 104  
jun 20042,4 k48175826159162 433  1412420  32 77  
mai 20042,2 k40571765855152 401  1412780  22 72  
abr 20042,0 k338696874915  345  141   12 65  
mar 20041,8 k235684173715  274  141   12 38  
fev 20041,5 k17463572115  164  141    2 3  
jan 20041,3 k1406156115  87  141    2 3  
dez 20031,2 k1166155115  36  141    2 3  
nov 20031,1 k915841 15  21  141    2 2  
out 2003906705311 15  16  131      1  
set 2003685565111 15  16  121      1  
ago 2003524484611 15  15  121      1  
jul 200334727111  3  10  121      1  
jun 2003264 2      8  121         
mai 2003252 2      8  111         
abr 2003236 2      8  111         
mar 2003221 2      7  111         
fev 2003207 2      7  111         
jan 2003200 1      7  101         
dez 2002180 1      6  101         
nov 2002167 1      5  101         
out 2002160 1      5  91         
set 2002151 1      5  81         
ago 2002142 1      5  71         
jul 2002120 1      5  71         
jun 2002113 1      5  71         
mai 2002101 1      4  61         
abr 200298 1      4  61         
mar 200289 1      4  51         
fev 200278 1      2  51         
jan 200219 1      1  11         
dez 200117 1         1          
nov 200116 1         1          
out 200113 1                    
set 200111 1                    
ago 20019 1                    
jul 20018 1                    
jun 20017 1                    
mai 20015                      
abr 20011                      
mar 20011                      
fev 2001         

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
Sometimes an article has been renamed repeatedly. For this reason the English Wikipedia article 'October 2003' features as article with most editors for many months.

x y z    ⇐    x = rank, y = contributors in that month, z = article title

fev 2001: 1 1 Undergraduate Mathematics/Random variable

mar 2001: 1 1 Undergraduate Mathematics/Random variable

abr 2001: 1 1 Horticulture/Melissa officinalis

mai 2001: 1 1 Horticulture/Allium schoenophrasum

jun 2001: 1 1 Undergraduate Mathematics/Sample space

jul 2001: 1 1 Undergraduate Mathematics/Random variable

ago 2001: 1 2 Undergraduate Mathematics/Least common multiple , 2 1 Undergraduate Mathematics/Mean value theorem

set 2001: 1 1 Undergraduate Mathematics/Continuous function

out 2001: 1 2 Undergraduate Mathematics/Sequence , 2 1 Undergraduate Mathematics/Sylow theorems

nov 2001: 1 2 Undergraduate Mathematics/Sylow theorems , 2 2 Undergraduate Mathematics/Compact space , 3 2 Messier Index , 4 1 Undergraduate Mathematics/Greatest common divisor

dez 2001: 1 6 Introduction to Software Engineering/Tools/Obfuscation , 2 4 Undergraduate Mathematics/Greatest common divisor , 3 3 Undergraduate Mathematics/Metric space , 4 3 When It Hits the Fan/Specific Calamities/Pandemy , 5 3 World War II/Holocaust , 6 1 Undergraduate Mathematics/Mean value theorem

jan 2002: 1 3 Knots/Introduction , 2 3 Human Body/Lungs , 3 2 Undergraduate Mathematics/Least common multiple , 4 2 Undergraduate Mathematics/Greatest common divisor , 5 1 Undergraduate Mathematics/Continuous function

fev 2002: 1 4 Knots/Introduction , 2 3 Field Guide/Birds/Colinus virginianus , 3 3 Horticulture/Galanthus , 4 3 World War II/Holocaust , 5 2 Undergraduate Mathematics/Quotient group , 6 2 Undergraduate Mathematics/Abelian group , 7 2 Undergraduate Mathematics/Open set , 8 2 LimeWire , 9 2 Sign language , 10 2 Introduction to Software Engineering/Quality/Static Analysis , 11 2 Cryptography/Differential cryptanalysis , 12 2 Knots/Loop knots/Alpine butterfly , 13 2 Horticulture/Melissa officinalis , 14 1 Guide to The Lord of the Rings/Characters/Morgoth

mar 2002: 1 3 Chess/Sample chess game , 2 3 World War II/Holocaust , 3 2 Undergraduate Mathematics/Random variable , 4 2 California Public Policy and Citizen Participation/Chapter Ten , 5 2 Adventist Youth Honors Answer Book/Insect/Strepsiptera

abr 2002: 1 3 Undergraduate Mathematics/Open set , 2 3 Introduction to Software Engineering/Tools/IDE , 3 2 Undergraduate Mathematics/Continuous function , 4 2 Undergraduate Mathematics/Random variable , 5 2 Undergraduate Mathematics/Greatest common divisor , 6 2 Undergraduate Mathematics/Alternating group , 7 2 Undergraduate Mathematics/Compact space , 8 2 Introduction to Software Engineering/Architecture , 9 1 Undergraduate Mathematics/Mean value theorem

mai 2002: 1 3 Undergraduate Mathematics/Cyclic group , 2 2 Undergraduate Mathematics/Fundamental theorem of calculus , 3 2 Undergraduate Mathematics/Metric space , 4 1 Undergraduate Mathematics/Mean value theorem

jun 2002: 1 6 Horticulture/Taraxacum , 2 3 Intellectual Property and the Internet/Intellectual property , 3 3 Introduction to Software Engineering/Tools/Debugger , 4 3 Knots/Introduction , 5 3 Adventist Youth Honors Answer Book/Knot/Miller's , 6 2 Undergraduate Mathematics/Compact space , 7 2 Undergraduate Mathematics/Open set , 8 2 When It Hits the Fan/Specific Calamities/Pandemy , 9 2 Introduction to Software Engineering/Tools/IDE , 10 2 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Mössbauer spectroscopy , 11 1 Undergraduate Mathematics/Mean value theorem

jul 2002: 1 5 Knots/Introduction , 2 5 Field Guide/Birds/Haliaeetus leucocephalus , 3 4 Horticulture/Beetles , 4 3 Guide to The Lord of the Rings/Characters/Morgoth , 5 3 Undergraduate Mathematics/Greatest common divisor , 6 3 Horticulture/Rosmarinus officinalis , 7 3 Horticulture/Nematodes , 8 2 Undergraduate Mathematics/Least common multiple , 9 2 Undergraduate Mathematics/Group homomorphism , 10 2 Sign language , 11 2 Fukushima Aftermath/US Department of Energy

ago 2002: 1 7 Horticulture/Capsicum , 2 5 Undergraduate Mathematics/Proof by contradiction , 3 5 Adventist Youth Honors Answer Book/Nature/Waterfalls , 4 5 Horticulture/Toxicodendron radicans , 5 5 World War II/Holocaust , 6 5 Horticulture/Taraxacum , 7 4 Sign language , 8 4 Horticulture/Achillea millefolium , 9 4 Horticulture/Tradescantia , 10 4 Horticulture/Nematodes , 11 4 Horticulture/Dahlia , 12 3 Horticulture/Senecio jacobaea , 13 3 Horticulture/Pyrus , 14 3 Horticulture/Fragaria , 15 3 Clove , 16 2 Guide to The Lord of the Rings/Characters/Morgoth , 17 2 Teach Cough Hygiene Everywhere/Epidemic , 18 2 Intellectual Property and the Internet/Intellectual property

set 2002: 1 5 Adventist Youth Honors Answer Book/Nature/Waterfalls , 2 4 California Public Policy and Citizen Participation/Chapter Ten , 3 4 Goats/Introduction , 4 4 World War II/Holocaust , 5 3 Undergraduate Mathematics/Mathematical induction , 6 3 When It Hits the Fan/Specific Calamities/Pandemy , 7 3 Horticulture/Capsicum , 8 2 Introduction to Software Engineering/Tools/Software Documentation , 9 2 Introduction to Software Engineering/Tools/IDE , 10 2 Introduction to Software Engineering/Implementation/Documentation , 11 2 The History of the Native Peoples of the Americas/Mesoamerican Cultures/Teotihuacanos , 12 2 The History of the Native Peoples of the Americas/Mesoamerican Cultures/Toltecs , 13 2 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Magnetometer , 14 2 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Inductively coupled plasma mass spectrometry , 15 2 Adventist Youth Honors Answer Book/Recreation/Track & Field , 16 2 Adventist Youth Honors Answer Book/Arts and Crafts/Model Hot Air Balloons , 17 1 Guide to The Lord of the Rings/Characters/Morgoth

out 2002: 1 12 World War II/Holocaust , 2 3 Undergraduate Mathematics/Dihedral group , 3 3 Horticulture/Rosa , 4 3 Horticulture/Bamboo , 5 2 Undergraduate Mathematics/Coset , 6 2 Undergraduate Mathematics/Metric space , 7 2 Linguistics/Sociolinguistics , 8 2 Fukushima Aftermath/Yucca Mountain , 9 2 Computer Science Design Patterns/Flyweight , 10 2 Cryptography/Differential cryptanalysis , 11 2 Adventist Youth Honors Answer Book/Arts and Crafts/Aboriginal Lore , 12 2 Knots/Loop knots/Bowline , 13 2 Knots/Introduction

nov 2002: 1 10 World War II/Holocaust , 2 4 Undergraduate Mathematics/Sylow theorems , 3 4 Adventist Youth Honors Answer Book/Nature/Cats - Advanced , 4 4 Locksmithing , 5 3 First Aid/Triage , 6 3 Outdoor Survival/First Aid , 7 2 Undergraduate Mathematics/Quotient group , 8 2 Undergraduate Mathematics/Abelian group , 9 2 Undergraduate Mathematics/Open set , 10 2 Adventist Youth Honors Answer Book/Nature/Waterfalls

dez 2002: 1 6 World War II/Holocaust , 2 4 Sign language , 3 4 Introduction to Software Engineering/Process/Extreme Programming , 4 3 The Q Document/The Synoptic Gospels , 5 2 Guide to The Lord of the Rings/Characters/Morgoth , 6 2 Intellectual Property and the Internet/Intellectual property , 7 2 Georgian/Introduction , 8 2 California Public Policy and Citizen Participation/Chapter Ten , 9 2 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/X-ray scattering techniques , 10 2 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Nuclear magnetic resonance

jan 2003: 1 7 Intellectual Property and the Internet/Intellectual property , 2 5 World War II/Holocaust , 3 4 Undergraduate Mathematics/Random variable , 4 4 Undergraduate Mathematics/Compact space , 5 3 Undergraduate Mathematics/Continuous function , 6 3 Undergraduate Mathematics/Alternating group , 7 3 Undergraduate Mathematics/Stokes' theorem , 8 3 Stokes' theorem , 9 3 Undergraduate Mathematics/Proof by contradiction , 10 3 Introduction to Software Engineering/Process/Extreme Programming , 11 3 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Named Reactions/Diels-Alder Reaction , 12 3 The Q Document/The Synoptic Gospels , 13 3 First Aid/Triage , 14 3 Swing Dancing/Groucho , 15 2 Undergraduate Mathematics/Sample space , 16 2 Undergraduate Mathematics/Fundamental theorem of calculus , 17 2 Computer Science Design Patterns/Abstract Factory , 18 2 Computer Science Design Patterns/Builder , 19 2 Computer Science Design Patterns/Prototype , 20 2 Principles of Finance/Section 1/Chapter/Financial Markets and Institutions/Interest

fev 2003: 1 4 Algorithm Implementation/Sorting/Bogosort , 2 4 Blackcurrant , 3 3 Undergraduate Mathematics/Sequence , 4 3 Horticulture/Biological Pest Control , 5 2 Undergraduate Mathematics/Cyclic group , 6 2 Undergraduate Mathematics/Metric space , 7 2 Undergraduate Mathematics/Proof by contradiction , 8 2 Strategy for Information Markets/e-Commerce , 9 2 Sign language , 10 2 California Public Policy and Citizen Participation/Chapter Ten , 11 2 Messier Index , 12 2 Horticulture/Trifolium , 13 2 Pressure Cooking , 14 1 Guide to The Lord of the Rings/Characters/Morgoth

mar 2003: 1 7 Field Guide/Birds/Pandion haliaetus , 2 6 World War II/Holocaust , 3 3 Undergraduate Mathematics/Mean value theorem , 4 3 Undergraduate Mathematics/Rolle's theorem , 5 3 Intellectual Property and the Internet/Intellectual property , 6 3 Origami/Techniques/Yoshizawa-Randlett system , 7 3 Field Guide/Birds/Streptopelia turtur , 8 2 Undergraduate Mathematics/Greatest common divisor , 9 2 Undergraduate Mathematics/Cyclic group , 10 2 Undergraduate Mathematics/Metric space , 11 2 Principles of Finance/Section 1/Chapter/Financial Markets and Institutions/Commercial Banks , 12 2 Fukushima Aftermath/US Department of Energy , 13 2 Radioactive Waste Management/Radiation Interaction Fundamentals , 14 2 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Kurt Wüthrich , 15 2 Knots/Introduction , 16 2 First Aid/Triage , 17 2 Atlas Shrugged/Things , 18 1 Guide to The Lord of the Rings/Characters/Morgoth

abr 2003: 1 8 World War II/Holocaust , 2 4 Field Guide/Birds/Corvus brachyrhynchos , 3 3 When It Hits the Fan/Specific Calamities/Pandemy , 4 3 Intellectual Property and the Internet/Intellectual property , 5 3 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Rydberg constant , 6 3 Messier Index/M87 , 7 3 Field Guide/Birds/Columba livia , 8 3 Horticulture/Wasps , 9 3 Horticulture/Mites , 10 3 X Window Programming/Qt , 11 2 Undergraduate Mathematics/Partial derivative , 12 2 Fukushima Aftermath/US Department of Energy , 13 2 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Spectral line , 14 1 Undergraduate Mathematics/Abelian group

mai 2003: 1 9 World War II/Holocaust , 2 6 Horticulture/Beetles , 3 4 Field Guide/Birds/Columba livia , 4 4 Horticulture/Forsythia , 5 3 Intellectual Property and the Internet/Online Copyright Infringement Liability Limitation Act , 6 3 Intellectual Property and the Internet/Intellectual property , 7 3 Introduction to Software Engineering/Tools/IDE , 8 3 Introduction to Software Engineering/Testing/Refactoring , 9 3 Field Guide/Birds/Haliaeetus leucocephalus , 10 3 Horticulture/Wasps , 11 3 Horticulture/Taxus , 12 3 Horticulture/Taraxacum , 13 2 Undergraduate Mathematics/Sequence , 14 2 Undergraduate Mathematics/Mathematical induction , 15 2 Computer Science Design Patterns/Abstract Factory , 16 2 Fukushima Aftermath/Yucca Mountain , 17 2 Introduction to Software Engineering/Quality/Metrics , 18 2 Introduction to Software Engineering/Testing/Unit Tests , 19 2 Introduction to Software Engineering/Tools/Obfuscation , 20 2 Introduction to Software Engineering/Process/Extreme Programming , 21 2 Knots/Binding knots/Trucker's hitch , 22 1 Undergraduate Mathematics/Coset

jun 2003: 1 6 Intellectual Property and the Internet/Intellectual property , 2 5 Undergraduate Mathematics/Burnside's lemma , 3 5 Ancient History/Human Evolution/Recent African Origin , 4 5 Horticulture/Slugs , 5 5 Horticulture/Herbicides , 6 4 Goats/Introduction , 7 4 Horticulture/Caterpillars , 8 3 Undergraduate Mathematics/Continuous function , 9 3 Linguistics/Semantics , 10 3 Introduction to Software Engineering/Testing/Unit Tests , 11 3 Horticulture/Lavandula , 12 3 Field Guide/Birds/Columba livia , 13 3 X Window Programming/Qt , 14 2 Undergraduate Mathematics/Homotopy , 15 2 Undergraduate Mathematics/Fundamental theorem of calculus , 16 2 Undergraduate Mathematics/Homeomorphism , 17 2 Undergraduate Mathematics/Metric space , 18 2 Principles of Finance/Section 1/Chapter/Financial Markets and Institutions/Money Markets , 19 2 Remembering the Templars/Age , 20 2 Adventist Youth Honors Answer Book/Nature/Waterfalls , 21 2 California Public Policy and Citizen Participation/Chapter Ten , 22 2 Introduction to Software Engineering/Tools/Obfuscation , 23 2 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Named Reactions/Beckmann Rearrangement , 24 2 Knots/Rope , 25 1 SQLite

jul 2003: 1 10 Main Page , 2 6 World War II/Holocaust , 3 5 Undergraduate Mathematics/Mean value theorem , 4 5 Computer Programming , 5 4 California Public Policy and Citizen Participation/Chapter Ten , 6 4 Horticulture/Allium schoenophrasum , 7 4 Horticulture/Taraxacum , 8 4 Horticulture/Slugs , 9 4 Programming:c , 10 3 Undergraduate Mathematics/Rolle's theorem , 11 3 Intellectual Property and the Internet/Intellectual property , 12 3 X Window Programming/OpenGL , 13 3 Horticulture/Herbicides , 14 3 Calculus/Definite integral , 15 3 Calculus/Functions , 16 2 Principles of Finance/Section 1/Chapter 7/Efficient-Market Hypothesis , 17 2 Ancient History/Human Evolution/Recent African Origin , 18 2 Ethnography of Fiddle/Ethnomusicology , 19 2 Introduction to Software Engineering/Tools/IDE , 20 2 Scone , 21 2 Horticulture/Aconitum , 22 2 Field Guide/Birds/Calidris pusilla , 23 2 Field Guide/Birds/Larus argentatus , 24 2 Field Guide/Birds/Aquila chrysaetos , 25 2 Field Guide/Birds/Colinus virginianus

ago 2003: 1 14 World War II/Holocaust , 2 13 Main Page , 3 5 Spanish/Lesson 3 , 4 5 Spanish/Lesson 1 , 5 4 Undergraduate Mathematics/Continuous function , 6 4 Intellectual Property and the Internet/Intellectual property , 7 4 Strategy for Information Markets/Compatibility and Standards/Forking , 8 4 California Public Policy and Citizen Participation/Chapter Ten , 9 4 Growing Edible Sprouts , 10 4 Spanish/Lesson 2 , 11 3 Undergraduate Mathematics/Quotient group , 12 3 Strategy for Information Markets/e-Commerce , 13 3 Colonizing Outer Space/Colonization , 14 3 Making Neon Signs , 15 3 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Emission spectrum , 16 3 Knots/Introduction , 17 3 Horticulture/Allium schoenophrasum , 18 3 First Aid/Triage , 19 3 Horticulture/Buddleia , 20 3 Adventist Youth Honors Answer Book/Nature/Life cycle of a frog , 21 3 Horticulture/Acer , 22 3 Horticulture/Hamamelis , 23 3 C Programming , 24 3 Spanish/Web Resources , 25 3 Japanese/Kanji

set 2003: 1 10 Main Page , 2 5 Intellectual Property and the Internet/Intellectual property , 3 4 Sign language , 4 4 Horticulture/Acer , 5 4 GCSE Science , 6 4 Algebra/Complex Numbers , 7 4 Latin/Lesson 1-Nominative , 8 3 Undergraduate Mathematics/Mean value theorem , 9 3 Principles of Finance/Section 1/Chapter 7/Efficient-Market Hypothesis , 10 3 The History of the Native Peoples of the Americas/Mesoamerican Cultures/Teotihuacanos , 11 3 Chinese Stories/Pangu , 12 3 Chinese Stories/Nüwa , 13 3 Messier Index/M83 , 14 3 Adventist Youth Honors Answer Book/Vocational/Journalism , 15 3 New Zealand History/European Colonisation of New Zealand , 16 3 Botany , 17 3 High School Mathematics Extensions , 18 3 Latin/Lesson 5-Accusative , 19 3 Latin/Lesson 2 , 20 3 GCSE Science/Electrolysis , 21 3 Spanish/Exercises/Verbs ser And estar , 22 3 Computer Programming , 23 3 Discrete Mathematics , 24 3 Calculus/Limits/An Introduction to Limits , 25 2 GCSE Science/Electricity multiple choice practice question 1 answer 1

out 2003: 1 16 Main Page , 2 6 Adventist Youth Honors Answer Book/Nature/Life cycle of a frog , 3 5 Intellectual Property and the Internet/Intellectual property , 4 5 Horticulture/Wasps , 5 5 World War II/Holocaust , 6 4 California Public Policy and Citizen Participation/Chapter Ten , 7 4 Knots/Rope , 8 4 High School Mathematics Extensions/Primes , 9 4 Puzzles/Geometric Puzzles/Connecting Utilities/Solution , 10 4 German/Lesson 1 , 11 4 Puzzles/Number sequences , 12 4 French/Lessons/Transportation , 13 4 Puzzles , 14 4 Algebra/Complex Numbers , 15 3 Undergraduate Mathematics/Squeeze theorem , 16 3 Undergraduate Mathematics/Metric space , 17 3 Colonizing Outer Space/Colonization , 18 3 Ethnography of Fiddle/Ethnomusicology , 19 3 The History of the Native Peoples of the Americas/Mesoamerican Cultures/Teotihuacanos , 20 3 Internet Technologies/HTML , 21 3 Horticulture/Bamboo , 22 3 US History , 23 3 German/Lesson 3 , 24 3 Puzzles/Decision puzzles/Monty Hall , 25 3 Puzzles/Geometric Puzzles

nov 2003: 1 20 Main Page , 2 6 Intellectual Property and the Internet/Intellectual property , 3 6 German/Lesson 4 , 4 6 German/Lesson 3 , 5 6 Computer Programming , 6 5 Adventist Youth Honors Answer Book/Nature/Life cycle of a frog , 7 5 World War II/Holocaust , 8 5 German/Lesson 2 , 9 5 German/Level III , 10 5 High School Mathematics Extensions/Primes , 11 4 Undergraduate Mathematics/Metric space , 12 4 Intellectual Property and the Internet/Online Copyright Infringement Liability Limitation Act , 13 4 Human Body/Lungs , 14 4 Horticulture/Rosa , 15 4 Locksmithing , 16 4 Authoring Webpages/Preventing link rot , 17 4 German/Appendices/Grammar II , 18 4 German/Lesson 1 , 19 4 French/Lessons/Recreation , 20 3 Undergraduate Mathematics/Compact space , 21 3 Undergraduate Mathematics/Proof by exhaustion , 22 3 Georgian/Introduction , 23 3 Colonizing Outer Space/Colonization , 24 3 Introduction to Software Engineering/Tools/IDE , 25 3 Trigonometry/For Enthusiasts/Delaunay triangulation

dez 2003: 1 17 Main Page , 2 12 World War II/Holocaust , 3 5 Adventist Youth Honors Answer Book/Nature/Life cycle of a frog , 4 4 Georgian/Introduction , 5 4 Algebra/Functions , 6 4 C Programming/Standard libraries , 7 4 Adventist Youth Honors Answer Book/Nature/Weather , 8 4 Horticulture/Beetles , 9 4 Horticulture/Taraxacum , 10 4 C++ Programming/Examples/Hello world , 11 4 C Programming/Variables , 12 4 Computer Programming , 13 4 HyperText Markup Language , 14 3 Undergraduate Mathematics/Abelian group , 15 3 Fukushima Aftermath/Yucca Mountain , 16 3 Trigonometry/For Enthusiasts/Delaunay triangulation , 17 3 Radioactive Waste Management/Radiation Interaction Fundamentals , 18 3 The History of the Native Peoples of the Americas/Mesoamerican Cultures/Toltecs , 19 3 Adventist Youth Honors Answer Book/Nature/Ecology - Advanced , 20 3 Suicide/Drowning , 21 3 Horticulture/Lymantria dispar , 22 3 Horticulture/Hemiptera , 23 3 C Programming , 24 3 Cell Biology/Cell division/Cell cycle , 25 3 C Programming/Beginning exercises

jan 2004: 1 12 Main Page , 2 11 Wikibooks portal , 3 7 World War II/Holocaust , 4 6 X Window Programming/Qt , 5 5 Horticulture/Robinia pseudoacacia , 6 5 Horticulture/Alnus , 7 4 Intellectual Property and the Internet/Intellectual property , 8 4 Georgian/Introduction , 9 4 Wikimedia/Wikibooks , 10 4 The History of the Native Peoples of the Americas/Mesoamerican Cultures/Toltecs , 11 4 Horticulture/Wasps , 12 4 Bicycles/Maintenance and Repair , 13 4 High School Mathematics Extensions/Set Theory and Infinite Processes , 14 3 Colonizing Outer Space/Colonization , 15 3 Bards Irish Fiddle Tunebook Supplement/Whiskey in the Jar , 16 3 Trigonometry/For Enthusiasts/Chebyshev Polynomials , 17 3 Adventist Youth Honors Answer Book/Health and Science/Home Nursing , 18 3 Knots/Introduction , 19 3 Inorganic Chemistry/Chemical Bonding/Lewis Dot Structures , 20 3 Scone , 21 3 Horticulture/Vaccinium , 22 3 Horticulture/Salvia , 23 3 Human Body/Lungs , 24 3 Horticulture/Chamaecyparis , 25 3 Adventist Youth Honors Answer Book/Nature/Life cycle of a frog

fev 2004: 1 20 World War II/Holocaust , 2 14 Main Page , 3 10 Wikibooks portal , 4 5 California Public Policy and Citizen Participation/Chapter Ten , 5 5 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Nuclear magnetic resonance , 6 5 Human Body/Lungs , 7 5 Horticulture/Alnus , 8 5 Horticulture/Rosa , 9 5 Horticulture/Taraxacum , 10 4 Undergraduate Mathematics/Metric space , 11 4 Undergraduate Mathematics/Partial derivative , 12 4 Strategy for Information Markets/e-Commerce , 13 4 Sign language , 14 4 Horticulture/Fritillaria meleagris , 15 4 Adventist Youth Honors Answer Book/Nature/Birds/Wood Pigeon , 16 4 Horticulture/Solanum , 17 4 Chess , 18 4 General Chemistry/Introduction , 19 4 Recipes , 20 3 Guide to The Lord of the Rings/Characters/Morgoth , 21 3 Undergraduate Mathematics/Cyclic group , 22 3 Georgian/Introduction , 23 3 Algorithm Implementation/Sorting/Bogosort , 24 3 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Fluorescence , 25 3 Messier Index/M64

mar 2004: 1 24 Main Page , 2 17 World War II/Holocaust , 3 10 Table of Contents , 4 8 Georgian/Introduction , 5 8 Electronics , 6 7 Intellectual Property and the Internet/Intellectual property , 7 7 Wikibooks portal , 8 6 California Public Policy and Citizen Participation/Chapter Ten , 9 6 Algorithm Implementation/Mathematics/Fibonacci Number Program , 10 6 Recipes , 11 5 Strategy for Information Markets/Compatibility and Standards/Forking , 12 5 Introduction to Software Engineering/Tools/IDE , 13 5 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Fluorescence , 14 5 Horticulture/Wasps , 15 5 Horticulture/Bamboo , 16 5 Linux Guide/Installing (advanced) , 17 4 Adventist Youth Honors Answer Book/Recreation/Skiing - Cross Country , 18 4 Horticulture/Rosaceae , 19 4 Field Guide/Birds/Falco peregrinus , 20 4 Horticulture/Beetles , 21 4 XML - Managing Data Exchange , 22 4 Electronics/Simplifying Capacitor/Inductor Networks , 23 4 Q3Map2 , 24 4 German/Level I/Wie heißt du? , 25 4 Sandbox

abr 2004: 1 16 World War II/Holocaust , 2 16 Main Page , 3 6 Undergraduate Mathematics/Continuous function , 4 6 Lucid Dreaming/Induction Techniques , 5 6 Wikibooks portal , 6 5 Intellectual Property and the Internet/Intellectual property , 7 5 Colonizing Outer Space/Colonization , 8 5 Table of Contents , 9 5 Adventist Youth Honors Answer Book/Nature/Life cycle of a frog , 10 5 Intelligence Intensification/Memory Techniques , 11 5 Lucid Dreaming , 12 4 Undergraduate Mathematics/Partial derivative , 13 4 Strategy for Information Markets/e-Commerce , 14 4 Georgian/Introduction , 15 4 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Fluorescence , 16 4 Scone , 17 4 Field Guide/Birds/Haliaeetus leucocephalus , 18 4 Horticulture/Viola , 19 4 Horticulture/Pineapple , 20 4 Horticulture/Pansy , 21 4 Horticulture/Sowing , 22 4 Intelligence Intensification , 23 4 Cuisine of India , 24 4 Electronics/Resistors , 25 4 Electronics

mai 2004: 1 26 World War II/Holocaust , 2 15 Main Page , 3 8 Bards Irish Fiddle Tunebook Supplement/Star of the County Down , 4 7 Horticulture/Wasps , 5 6 Introduction to Software Engineering/Tools/IDE , 6 6 Trigonometry/For Enthusiasts/Chebyshev Polynomials , 7 6 Wikiversity , 8 6 Horticulture/Pieris rapae , 9 5 Adventist Youth Honors Answer Book/Nature/Cats - Advanced , 10 5 Suicide/Drowning , 11 5 Horticulture/Salvia , 12 5 Human Body/Lungs , 13 5 Horticulture/Caterpillars , 14 5 Electronics/Resistors , 15 5 Recipes , 16 5 Wikibooks portal , 17 4 Guide to The Lord of the Rings/Characters/Morgoth , 18 4 Undergraduate Mathematics/Greatest common divisor , 19 4 Georgian/Introduction , 20 4 Radioactive Waste Management/Low Level waste , 21 4 Algorithm Implementation/Sorting/Bogosort , 22 4 Knots/Loop knots/Alpine butterfly , 23 4 Knots/Rope , 24 4 Knots/Introduction , 25 4 Horticulture/Trifolium

jun 2004: 1 16 Main Page , 2 13 Intellectual Property and the Internet/Intellectual property , 3 9 World War II/Holocaust , 4 7 Georgian/Introduction , 5 7 Goats/Introduction , 6 6 Table of Contents , 7 5 Strategy for Information Markets/e-Commerce , 8 5 Diablo Canyon Nuclear Power Plant: The WikiBook/The company , 9 5 Ricotta , 10 5 Adventist Youth Honors Answer Book/Nature/Cats - Advanced , 11 5 Vehicle Identification Numbers (VIN codes)/Overview , 12 5 Vehicle Identification Numbers (VIN codes)/World Manufacturer Identifier (WMI) , 13 5 Horticulture/Digitalis , 14 5 Horticulture/Beetles , 15 5 Outdoor Survival/First Aid , 16 5 Horticulture/Lettuce , 17 5 Lucid Dreaming/FAQ , 18 5 Wikibooks portal , 19 4 Guide to The Lord of the Rings/Characters/Morgoth , 20 4 Writing Adolescent Fiction/Character names/Ancient Egyptian , 21 4 Undergraduate Mathematics/Mathematical induction , 22 4 Sign language , 23 4 Waterzooi , 24 4 Horticulture/Toxicodendron radicans , 25 4 Horticulture/Leucanthemum vulgare

jul 2004: 1 14 Main Page , 2 12 World War II/Holocaust , 3 11 Adventist Youth Honors Answer Book/Nature/Cats - Advanced , 4 8 Wikibooks portal , 5 6 Knots/Introduction , 6 6 Horticulture/Beetles , 7 5 Undergraduate Mathematics/Metric space , 8 5 Intellectual Property and the Internet/Intellectual property , 9 5 Wikimedia/Wikibooks , 10 5 California Public Policy and Citizen Participation/Chapter Ten , 11 5 Field Guide/Birds/Falco peregrinus , 12 5 Horticulture/Aster , 13 5 Horticulture/Salix , 14 5 C++ Programming , 15 4 Undergraduate Mathematics/Continuous function , 16 4 Strategy for Information Markets/e-Commerce , 17 4 Trigonometry/For Enthusiasts/Lissajous Figures , 18 4 Blackcurrant , 19 4 Designing a Training Manual , 20 4 Horticulture/Melissa officinalis , 21 4 Horticulture/Fragaria , 22 4 Field Guide/Birds/Branta canadensis , 23 4 Field Guide/Birds/Haliaeetus leucocephalus , 24 4 Adventist Youth Honors Answer Book/Nature/Life cycle of a frog , 25 4 Horticulture/Bamboo

ago 2004: 1 17 Adventist Youth Honors Answer Book/Nature/Cats - Advanced , 2 17 World War II/Holocaust , 3 7 Cashew , 4 7 Horticulture/Rosa , 5 6 Guide to The Lord of the Rings/Characters/Morgoth , 6 6 Intellectual Property and the Internet/Intellectual property , 7 6 Field Guide/Birds/Falco peregrinus , 8 6 Field Guide/Birds/Haliaeetus leucocephalus , 9 6 Horticulture/Nematodes , 10 6 Horticulture/Lepidopteran Pests , 11 5 Georgian/Introduction , 12 5 Introduction to Software Engineering/Tools/IDE , 13 5 Messier Index/M13 , 14 5 Knots/Introduction , 15 5 Horticulture/Allium schoenophrasum , 16 5 Horticulture/Erigeron , 17 5 Horticulture/Galanthus , 18 4 SQLite , 19 4 Principles of Finance/Section 1/Chapter 7/Modern Portfolio Theory , 20 4 Colonizing Outer Space/Colonization , 21 4 Castles of England/Chesire , 22 4 Introduction to Software Engineering/Architecture/Anti-Patterns , 23 4 The History of the Native Peoples of the Americas/Mesoamerican Cultures/Teotihuacanos , 24 4 Adventist Youth Honors Answer Book/Recreation/Track & Field , 25 4 Messier Index/M104

set 2004: 1 15 World War II/Holocaust , 2 8 Adventist Youth Honors Answer Book/Nature/Cats - Advanced , 3 8 Main Page , 4 7 Horticulture/Bamboo , 5 7 Using Firefox , 6 7 Computer Programming , 7 6 Guide to The Lord of the Rings/Characters/Morgoth , 8 6 Trigonometry/For Enthusiasts/Chebyshev Polynomials , 9 6 Recipes , 10 6 PHP Programming , 11 5 Knots/Rope , 12 5 Horticulture/Taraxacum , 13 5 Conlang/Intermediate/Sounds , 14 4 Undergraduate Mathematics/Mean value theorem , 15 4 Undergraduate Mathematics/Line integral , 16 4 Undergraduate Mathematics/Metric space , 17 4 Principles of Finance/Section 1/Chapter 7/Modern Portfolio Theory , 18 4 Strategy for Information Markets/e-Commerce , 19 4 Sign language , 20 4 Intellectual Property and the Internet/Intellectual property , 21 4 Introduction to Software Engineering/Testing/Refactoring , 22 4 Messier Index/M32 , 23 4 Messier Index/M24 , 24 4 Messier Index/M3 , 25 4 Adventist Youth Honors Answer Book/Arts and Crafts/Whistles

out 2004: 1 26 World War II/Holocaust , 2 13 California Public Policy and Citizen Participation/Chapter Ten , 3 12 Intellectual Property and the Internet/Intellectual property , 4 7 Principles of Finance/Section 1/Chapter 7/Capital Asset Pricing Model , 5 6 Strategy for Information Markets/e-Commerce , 6 6 Goats/Introduction , 7 6 Adventist Youth Honors Answer Book/Nature/Life cycle of a frog , 8 6 The Holocaust/Holocaust denial , 9 6 Recipes , 10 5 Bards Irish Fiddle Tunebook Supplement/Whiskey in the Jar , 11 5 Introduction to Software Engineering/Tools/IDE , 12 5 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Gas chromatography-mass spectrometry , 13 5 Wikiversity , 14 5 Horticulture/Vitis , 15 5 Horticulture/Rosa , 16 5 Horticulture/Juniperus , 17 4 Principles of Finance/Section 1/Chapter 7/Modern Portfolio Theory , 18 4 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Förster resonance energy transfer , 19 4 Chestnut , 20 4 First Aid/Triage , 21 4 Human Body/Lungs , 22 4 Field Guide/Birds/Branta canadensis , 23 4 Horticulture/Popillia japonica , 24 4 Horticulture/Bamboo , 25 4 Horticulture/Acer

nov 2004: 1 23 World War II/Holocaust , 2 11 Main Page , 3 10 South America/Brazil , 4 10 C++ Programming , 5 9 When It Hits the Fan/Specific Calamities/Pandemy , 6 9 Wikiversity , 7 9 Animal Behavior , 8 8 Goats/Introduction , 9 8 Adventist Youth Honors Answer Book/Nature/Life cycle of a frog , 10 8 Wikibooks portal , 11 7 Undergraduate Mathematics/Mathematical induction , 12 7 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Nuclear magnetic resonance , 13 7 Solar System , 14 7 Japanese/Contents , 15 7 Computer Programming , 16 6 Introduction to Software Engineering/Tools/IDE , 17 6 Adventist Youth Honors Answer Book/Nature/Cats - Advanced , 18 6 Big Cats , 19 6 Using Firefox , 20 5 Intellectual Property and the Internet/Chilling effect , 21 5 Intellectual Property and the Internet/Intellectual property , 22 5 Adventist Youth Honors Answer Book/Outreach/Puppetry , 23 5 Adventist Youth Honors Answer Book/Arts and Crafts/Model Hot Air Balloons , 24 5 Java Programming , 25 5 Horticulture/Lilium

dez 2004: 1 26 World War II/Holocaust , 2 19 Main Page , 3 15 Animal Behavior , 4 9 Colonizing Outer Space/Colonization , 5 8 Adventist Youth Honors Answer Book/Nature/Waterfalls , 6 7 California Public Policy and Citizen Participation/Chapter Nine , 7 7 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Nuclear magnetic resonance , 8 7 Field Guide/Birds/Branta canadensis , 9 7 Adventist Youth Honors Answer Book/Nature/Life cycle of a frog , 10 7 Horticulture/Euphorbia pulcherrima , 11 6 Intellectual Property and the Internet/Intellectual property , 12 6 Horticulture/Magnolia , 13 6 Using Firefox , 14 6 Wikibooks portal , 15 6 PHP Programming , 16 5 Undergraduate Mathematics/Sequence , 17 5 Undergraduate Mathematics/Metric space , 18 5 Strategy for Information Markets/e-Commerce , 19 5 Introduction to Software Engineering/Architecture/Anti-Patterns , 20 5 Adventist Youth Honors Answer Book/Recreation/Track & Field , 21 5 Adventist Youth Honors Answer Book/Recreation/Drumming & Percussion , 22 5 Adventist Youth Honors Answer Book/Outreach/Puppetry , 23 5 Table of Contents , 24 5 Goats/Introduction , 25 5 Adventist Youth Honors Answer Book/Outdoor Industries/Dairying

jan 2005: 1 13 Main Page , 2 12 World War II/Holocaust , 3 7 Adventist Youth Honors Answer Book/Nature/Shells - Advanced , 4 7 Horticulture/Rosa , 5 7 Horticulture/Capsicum , 6 7 How To Assemble A Desktop PC , 7 6 Georgian/Introduction , 8 6 California Public Policy and Citizen Participation/Chapter Ten , 9 6 Adventist Youth Honors Answer Book/Outreach/Puppetry , 10 6 The Holocaust/Victims/Homosexuals , 11 6 Movie making manual , 12 5 Linguistics/Semantics , 13 5 Black-eyed Pea , 14 5 Adventist Youth Honors Answer Book/Arts and Crafts/Africa Lore , 15 5 Adventist Youth Honors Answer Book/Nature/Parrots and Cockatoos , 16 5 Wikiversity , 17 5 Table of Contents , 18 5 Horticulture/Fragaria , 19 5 Horticulture/Verbascum thapsus , 20 5 Horticulture/Chard , 21 5 Solar System/Moon , 22 5 Spanish/The Wrong Way To Learn Spanish , 23 5 Recipes , 24 4 Sign language , 25 4 Intellectual Property and the Internet/Intellectual property

fev 2005: 1 7 Inkscape/About , 2 7 Horticulture/Taraxacum , 3 6 Horticulture/Rosa , 4 6 How To Assemble A Desktop PC , 5 6 Main Page , 6 5 Diablo Canyon Nuclear Power Plant: The WikiBook/Union of Concerned Scientists , 7 5 California Public Policy and Citizen Participation/Chapter Ten , 8 5 Radioactive Waste Management/Radiation Interaction Fundamentals , 9 5 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Balmer series , 10 5 Adventist Youth Honors Answer Book/Recreation/Drumming & Percussion , 11 5 Adventist Youth Honors Answer Book/Arts and Crafts/Africa Lore , 12 5 Adventist Youth Honors Answer Book/Recreation/Skiing - Cross Country , 13 5 Table of Contents , 14 5 Horticulture/Alnus , 15 5 Horticulture/Bamboo , 16 5 Chili con carne , 17 5 Horticulture/Verbascum thapsus , 18 5 X Window Programming/Qt , 19 5 Computers for Beginners/Multimedia , 20 5 Computers for Beginners/Buying A Computer , 21 5 Recipes , 22 4 Undergraduate Mathematics/Metric space , 23 4 Principles of Finance/Section 1/Chapter 7/Modern Portfolio Theory , 24 4 Strategy for Information Markets/e-Commerce , 25 4 Introduction to Software Engineering/Quality/Metrics

mar 2005: 1 10 Sign language , 2 10 Horticulture/Sonchus , 3 8 Intellectual Property and the Internet/Intellectual property , 4 8 Blender 3D: Noob to Pro , 5 7 Undergraduate Mathematics/Metric space , 6 7 California Public Policy and Citizen Participation/Chapter Ten , 7 7 Horticulture/Pineapple , 8 7 Main Page , 9 6 California Public Policy and Citizen Participation/Chapter Nine , 10 6 Trigonometry/For Enthusiasts/Chebyshev Polynomials , 11 6 Inkscape/About , 12 6 Adventist Youth Honors Answer Book/Nature/Life cycle of a frog , 13 6 Blender 3D: Noob to Pro/Creating a Simple Hat , 14 5 Strategy for Information Markets/e-Commerce , 15 5 Adventist Youth Honors Answer Book/Outreach/Maori Lore , 16 5 Knots/Introduction , 17 5 Adventist Youth Honors Answer Book/Nature/Cats - Advanced , 18 5 Field Guide/Birds/Haliaeetus leucocephalus , 19 5 Horticulture/Rosa , 20 5 Horticulture/Beetles , 21 5 A Neutral Look at Operating Systems , 22 5 How To Assemble A Desktop PC/Choosing the parts , 23 5 How To Assemble A Desktop PC , 24 5 Movie making manual , 25 5 Recipes

abr 2005: 1 18 Main Page , 2 12 Wikiversity , 3 11 Adventist Youth Honors Answer Book/Nature/Life cycle of a frog , 4 10 Sign language , 5 10 Instructional Technology/Learning Management Systems/Learning Objects , 6 10 Autonomous Technology-Assisted Language Learning/Assessment , 7 9 Undergraduate Mathematics/Sequence , 8 9 California Public Policy and Citizen Participation/Chapter Ten , 9 9 Instructional Technology/Learning Management Systems , 10 9 How To Assemble A Desktop PC/Software , 11 9 Recipes , 12 8 Georgian/Introduction , 13 8 The Holocaust/Anti-Semitism/Untermensch , 14 8 How To Assemble A Desktop PC/Choosing the parts , 15 8 Blender 3D: Noob to Pro , 16 7 Table of Contents , 17 7 Horticulture/Rosa , 18 7 Instructional Technology , 19 7 Autonomous Technology-Assisted Language Learning/Input , 20 7 Computer Programming , 21 6 LimeWire , 22 6 Intellectual Property and the Internet/Intellectual property , 23 6 Adventist Youth Honors Answer Book/Arts and Crafts/Africa Lore , 24 6 Adventist Youth Honors Answer Book/Nature/Cats - Advanced , 25 6 Field Guide/Birds/Dryocopus pileatus

mai 2005: 1 17 How To Assemble A Desktop PC/Choosing the parts , 2 12 Adventist Youth Honors Answer Book/Nature/Life cycle of a frog , 3 12 Main Page , 4 9 Adventist Youth Honors Answer Book/Outreach/Puppetry , 5 9 Blender 3D: Noob to Pro , 6 8 California Public Policy and Citizen Participation/Chapter Ten , 7 8 Horticulture/Rosa , 8 7 How To Assemble A Desktop PC/Software , 9 6 Intellectual Property and the Internet/Intellectual property , 10 6 Georgian/Introduction , 11 6 Diablo Canyon Nuclear Power Plant: The WikiBook/Union of Concerned Scientists , 12 6 Wikimedia/Wikibooks , 13 6 Wikiversity , 14 6 Horticulture/Taraxacum , 15 6 How To Assemble A Desktop PC , 16 6 Wikibooks portal , 17 6 Dessert , 18 5 Fukushima Aftermath/Yucca Mountain , 19 5 California Public Policy and Citizen Participation/Chapter Nine , 20 5 Introduction to Software Engineering/Process/Extreme Programming , 21 5 Algorithm Implementation/Sorting/Bogosort , 22 5 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Gas chromatography-mass spectrometry , 23 5 JavaServer Pages , 24 5 Adventist Youth Honors Answer Book/Nature/Marsupials , 25 5 Table of Contents

jun 2005: 1 39 Remembering the Templars , 2 9 Human Body/Lungs , 3 8 Adventist Youth Honors Answer Book/Nature/Cats - Advanced , 4 8 Wikiversity , 5 8 Horticulture/Rosa , 6 7 LimeWire , 7 7 Adventist Youth Honors Answer Book/Recreation/Track & Field , 8 7 Java Programming , 9 7 Goats/Introduction , 10 7 X Window Programming/OpenGL , 11 7 Blender 3D: Noob to Pro , 12 7 Recipes , 13 6 Strategy for Information Markets/e-Commerce , 14 6 Intellectual Property and the Internet/Intellectual property , 15 6 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Nuclear magnetic resonance , 16 6 Inkscape/About , 17 6 Horticulture/Salvia , 18 6 Field Guide/Birds/Falco peregrinus , 19 6 Adventist Youth Honors Answer Book/Nature/Life cycle of a frog , 20 6 X Window Programming/Qt , 21 6 C Programming , 22 6 Body Hair Removal , 23 6 PHP Programming , 24 5 When It Hits the Fan/Specific Calamities/Pandemy , 25 5 Georgian/Alphabet

jul 2005: 1 13 LimeWire , 2 11 Blender 3D: Noob to Pro , 3 10 Strategy for Information Markets/e-Commerce , 4 10 Intellectual Property and the Internet/Intellectual property , 5 10 Horticulture/Vitis , 6 10 Micronations/Starting your own micronation/Making an Island , 7 9 Remembering the Templars , 8 9 Adventist Youth Honors Answer Book/Nature/Life cycle of a frog , 9 8 Adventist Youth Honors Answer Book/Arts and Crafts/Aboriginal Lore , 10 8 Adventist Youth Honors Answer Book/Nature/Cats - Advanced , 11 8 Starting and Running a Wiki Website , 12 7 Wikiversity , 13 7 Accelerando Technical Companion , 14 6 California Public Policy and Citizen Participation/Chapter Ten , 15 6 Adventist Youth Honors Answer Book/Arts and Crafts/Africa Lore , 16 6 Horticulture/Alnus , 17 6 Wikibooks portal , 18 6 Vegan Cuisine , 19 5 Principles of Finance/Section 1/Chapter 7/Capital Asset Pricing Model , 20 5 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Magic angle spinning , 21 5 Hinduism/The Puranas , 22 5 Adventist Youth Honors Answer Book/Recreation/Gold Prospecting , 23 5 Knots/Rope , 24 5 Horticulture/Earwigs , 25 5 Goats/Introduction

ago 2005: 1 17 Adventist Youth Honors Answer Book/Arts and Crafts/Africa Lore , 2 13 LimeWire , 3 13 Horticulture/Urushiol-induced contact dermatitis , 4 12 Adventist Youth Honors Answer Book/Nature/Small Mammal Pets , 5 11 Adventist Youth Honors Answer Book/Nature/Life cycle of a frog , 6 11 X Window Programming/Qt , 7 9 California Public Policy and Citizen Participation/Chapter Ten , 8 9 Horticulture/Beetles , 9 9 How To Assemble A Desktop PC/Choosing the parts , 10 8 Adventist Youth Honors Answer Book/Nature/Cats - Advanced , 11 8 X Window Programming/GTK+ , 12 7 Intellectual Property and the Internet/Intellectual property , 13 7 Colonizing Outer Space/Colonization , 14 7 Introduction to Software Engineering/Process/Extreme Programming , 15 7 Adventist Youth Honors Answer Book/Arts and Crafts/Aboriginal Lore , 16 7 Horticulture/Trifolium , 17 7 Horticulture/Toxicodendron radicans , 18 7 Muggles' Guide to Harry Potter , 19 7 Solar System/Authors , 20 7 Blender 3D: Noob to Pro , 21 6 Undergraduate Mathematics/Continuous function , 22 6 Undergraduate Mathematics/Squeeze theorem , 23 6 Inkscape/About , 24 6 The Holocaust/Anti-Semitism/Untermensch , 25 6 Horticulture/Centaurea diffusa

set 2005: 1 17 Blended Learning in K-12 , 2 11 LimeWire , 3 10 Adventist Youth Honors Answer Book/Arts and Crafts/Africa Lore , 4 10 Engineering Acoustics , 5 8 Horticulture/Rosa , 6 8 New Title Suggestions , 7 8 Blender 3D: Noob to Pro , 8 7 Intellectual Property and the Internet/Intellectual property , 9 7 Adventist Youth Honors Answer Book/Arts and Crafts/Model Railroad , 10 7 Adventist Youth Honors Answer Book/Nature/Cats - Advanced , 11 6 Undergraduate Mathematics/Continuous function , 12 6 When It Hits the Fan/Specific Calamities/Pandemy , 13 6 Horticulture/Vitis , 14 6 Horticulture/Fragaria , 15 6 Field Guide/Birds/Haliaeetus leucocephalus , 16 6 Adventist Youth Honors Answer Book/Nature/Life cycle of a frog , 17 6 X Window Programming/OpenGL , 18 6 Dendrochronology , 19 6 Blended Learning in K-12/References , 20 6 Engineering Acoustics/Electro-acoustic analogies , 21 6 Ancient Civilizations , 22 6 C++ Programming , 23 5 Undergraduate Mathematics/Least common multiple , 24 5 Undergraduate Mathematics/Sequence , 25 5 Colonizing Outer Space/Colonization

out 2005: 1 18 Blended Learning in K-12/References , 2 14 Adventist Youth Honors Answer Book/Nature/Life cycle of a frog , 3 10 LimeWire , 4 10 Blender 3D: Noob to Pro , 5 9 When It Hits the Fan/Specific Calamities/Pandemy , 6 9 Adventist Youth Honors Answer Book/Arts and Crafts/Africa Lore , 7 8 Intellectual Property and the Internet/Intellectual property , 8 8 X Window Programming/GTK+ , 9 8 Solar System/About gravity, mass, and weight , 10 7 Strategy for Information Markets/e-Commerce , 11 7 Adventist Youth Honors Answer Book/Recreation/Gold Prospecting , 12 7 Blended Learning in K-12 , 13 7 C++ Programming , 14 6 Adventist Youth Honors Answer Book/Outreach/Maori Lore , 15 6 Adventist Youth Honors Answer Book/Nature/Small Mammal Pets , 16 6 Horticulture/Trifolium , 17 6 Field Guide/Birds/Falco peregrinus , 18 6 Horticulture/Salix , 19 6 Horticulture/Beetles , 20 6 Locksmithing , 21 6 Rhetoric and Composition/Editing , 22 6 Rhetoric and Composition/Researching , 23 6 New Title Suggestions , 24 5 Guide to The Lord of the Rings/Characters/Morgoth , 25 5 Undergraduate Mathematics/Compact space

nov 2005: 1 19 Engineering Acoustics , 2 16 Horticulture/Fragaria , 3 11 Introduction to Software Engineering/Process/Extreme Programming , 4 11 Adventist Youth Honors Answer Book/Nature/Life cycle of a frog , 5 9 Strategy for Information Markets/e-Commerce , 6 9 Human Body/Lungs , 7 9 Field Guide/Birds/Haliaeetus leucocephalus , 8 9 XML - Managing Data Exchange , 9 9 Japanese/Contents , 10 8 LimeWire , 11 8 Intellectual Property and the Internet/Intellectual property , 12 8 Adventist Youth Honors Answer Book/Arts and Crafts/Africa Lore , 13 8 The Computer Revolution/Timeline , 14 7 Undergraduate Mathematics/Quotient group , 15 7 Introduction to Software Engineering/Testing/Test-driven Development , 16 7 Adventist Youth Honors Answer Book/Arts and Crafts/Model Railroad , 17 7 Horticulture/Vitis , 18 7 Horticulture/Rosa , 19 7 New Book of the Quarter/2006-1st Quarter Vote , 20 6 When It Hits the Fan/Specific Calamities/Pandemy , 21 6 Georgian/Introduction , 22 6 Algebra/Functions , 23 6 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/General information on Science and its interface with society/Human genetic engineering , 24 6 Adventist Youth Honors Answer Book/Arts and Crafts/Model Hot Air Balloons , 25 6 Wikiversity

dez 2005: 1 25 Adventist Youth Honors Answer Book/Nature/Life cycle of a frog , 2 15 Horticulture/Pineapple , 3 13 Adventist Youth Honors Answer Book/Arts and Crafts/Africa Lore , 4 13 Human Body/Lungs , 5 12 LimeWire , 6 12 Adventist Youth Honors Answer Book/Nature/Waterfalls , 7 11 Wikiversity , 8 11 Horticulture/Rosa , 9 10 California Public Policy and Citizen Participation/Chapter Ten , 10 10 X Window Programming/OpenGL , 11 9 Undergraduate Mathematics/Stokes' theorem , 12 9 Stokes' theorem , 13 9 New Book of the Quarter/2006-1st Quarter Vote , 14 8 Strategy for Information Markets/e-Commerce , 15 8 When It Hits the Fan/Specific Calamities/Pandemy , 16 8 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Named Reactions/Aldol Reaction , 17 8 Cashew , 18 8 Inkscape/About , 19 8 Horticulture/Acer , 20 8 The Holocaust/Holocaust denial , 21 8 Rhetoric and Composition/Collaborating , 22 8 Engineering Acoustics , 23 7 Undergraduate Mathematics/Partial derivative , 24 7 Adventist Youth Honors Answer Book/Nature/Cats - Advanced , 25 7 Horticulture/Aconitum

jan 2006: 1 36 Adventist Youth Honors Answer Book/Nature/Life cycle of a frog , 2 19 LimeWire , 3 17 Adventist Youth Honors Answer Book/Nature/Small Mammal Pets , 4 16 Georgian/Introduction , 5 16 Colonizing Outer Space/Colonization , 6 16 Adventist Youth Honors Answer Book/Arts and Crafts/Africa Lore , 7 13 New Book of the Quarter/2006-2nd Quarter Vote , 8 12 Introduction to Software Engineering/Process/Extreme Programming , 9 12 Adventist Youth Honors Answer Book/Arts and Crafts/Aboriginal Lore , 10 12 Horticulture/Vitis , 11 11 Strategy for Information Markets/e-Commerce , 12 11 Human Body/Lungs , 13 11 Turkish Delight , 14 10 Knots/Rope , 15 10 Horticulture/Rosa , 16 9 Intellectual Property and the Internet/Intellectual property , 17 9 California Public Policy and Citizen Participation/Chapter Ten , 18 9 Adventist Youth Honors Answer Book/Outreach/Maori Lore , 19 9 Adventist Youth Honors Answer Book/Health and Science/Home Nursing , 20 9 Locksmithing , 21 9 X Window Programming/GTK+ , 22 8 Principles of Finance/Section 1/Chapter 7/Capital Asset Pricing Model , 23 8 When It Hits the Fan/Specific Calamities/Pandemy , 24 8 Sign language , 25 8 Adventist Youth Honors Answer Book/Recreation/Skiing - Cross Country

fev 2006: 1 48 Adventist Youth Honors Answer Book/Nature/Life cycle of a frog , 2 14 Adventist Youth Honors Answer Book/Nature/Small Mammal Pets , 3 13 Locksmithing , 4 12 Intellectual Property and the Internet/Intellectual property , 5 12 Adventist Youth Honors Answer Book/Recreation/Skiing - Cross Country , 6 12 Human Body/Lungs , 7 12 Field Guide/Birds/Haliaeetus leucocephalus , 8 12 Horticulture/Rosa , 9 11 Adventist Youth Honors Answer Book/Arts and Crafts/Africa Lore , 10 11 The Holocaust/Holocaust denial , 11 11 Horticulture/Lettuce , 12 10 LimeWire , 13 10 California Public Policy and Citizen Participation/Chapter Ten , 14 9 Adventist Youth Honors Answer Book/Outreach/Maori Lore , 15 9 Computer Programming/Hello world , 16 8 Colonizing Outer Space/Colonization , 17 8 Knots/Rope , 18 8 Adventist Youth Honors Answer Book/Nature/Fishes , 19 8 Horticulture/Vitis , 20 8 Horticulture/Nematodes , 21 8 Horticulture/Beetles , 22 7 Guide to The Lord of the Rings/Characters/Morgoth , 23 7 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/X-ray crystallography , 24 7 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Nuclear magnetic resonance , 25 7 Knots/Introduction

mar 2006: 1 26 Strategy for Information Markets/e-Commerce , 2 20 Adventist Youth Honors Answer Book/Arts and Crafts/Africa Lore , 3 18 Adventist Youth Honors Answer Book/Nature/Life cycle of a frog , 4 15 X Window Programming/OpenGL , 5 14 Wikiversity , 6 13 Horticulture/Nematodes , 7 12 LimeWire , 8 11 Adventist Youth Honors Answer Book/Outreach/Maori Lore , 9 11 Field Guide/Birds/Haliaeetus leucocephalus , 10 11 Horticulture/Beetles , 11 11 Horticulture/Pineapple , 12 11 French/Cover , 13 10 Adventist Youth Honors Answer Book/Nature/Waterfalls , 14 10 California Public Policy and Citizen Participation/Chapter Ten , 15 10 Table of Contents , 16 10 Horticulture/Rosa , 17 10 New Title Suggestions , 18 9 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Nuclear magnetic resonance , 19 9 Adventist Youth Honors Answer Book/Arts and Crafts/Model Railroad , 20 9 Adventist Youth Honors Answer Book/Nature/Small Mammal Pets , 21 9 Adventist Youth Honors Answer Book/Nature/Cats - Advanced , 22 9 Field Guide/Birds/Falco peregrinus , 23 9 Horticulture/Caterpillars , 24 9 Computer Programming/Hello world , 25 8 Intellectual Property and the Internet/Intellectual property

abr 2006: 1 17 Adventist Youth Honors Answer Book/Arts and Crafts/Africa Lore , 2 15 Languages , 3 15 Learning Theories , 4 14 Adventist Youth Honors Answer Book/Nature/Cats - Advanced , 5 13 Horticulture/Vitis , 6 13 Horticulture/Pineapple , 7 12 Intellectual Property and the Internet/Intellectual property , 8 12 Adventist Youth Honors Answer Book/Arts and Crafts/Model Hot Air Balloons , 9 12 Field Guide/Birds/Falco peregrinus , 10 12 New Title Suggestions , 11 11 Field Guide/Birds/Haliaeetus leucocephalus , 12 10 LimeWire , 13 10 Human Body/Lungs , 14 10 Horticulture/Lettuce , 15 9 Adventist Youth Honors Answer Book/Outreach/Maori Lore , 16 9 Goats/Introduction , 17 9 Field Guide/Birds/Columba livia , 18 9 Horticulture/Taraxacum , 19 9 New Book of the Quarter/2006-3rd Quarter Vote , 20 8 SQLite , 21 8 Strategy for Information Markets/e-Commerce , 22 8 When It Hits the Fan/Specific Calamities/Pandemy , 23 8 Wikiversity , 24 8 Horticulture/Narcissus , 25 8 The Holocaust/Victims/Homosexuals

mai 2006: 1 21 Field Guide/Birds/Haliaeetus leucocephalus , 2 21 Horticulture/Pineapple , 3 20 Goats/Introduction , 4 18 Field Guide/Birds/Falco peregrinus , 5 17 Horticulture/Bamboo , 6 14 Fukushima Aftermath/Yucca Mountain , 7 14 Wikiversity , 8 13 Adventist Youth Honors Answer Book/Nature/Small Mammal Pets , 9 13 Horticulture/Vitis , 10 13 Horticulture/Lilium , 11 13 Horticulture/Taraxacum , 12 12 LimeWire , 13 12 Adventist Youth Honors Answer Book/Outreach/Maori Lore , 14 12 Adventist Youth Honors Answer Book/Nature/Cats - Advanced , 15 12 Horticulture/Fragaria , 16 12 Learning Theories , 17 10 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/High performance liquid chromatography , 18 10 Horticulture/Beetles , 19 10 Languages , 20 10 Managing Groups and Teams , 21 9 Guide to The Lord of the Rings/Characters/Morgoth , 22 9 Strategy for Information Markets/e-Commerce , 23 9 Horticulture/Acer , 24 9 The Holocaust/Anti-Semitism/Untermensch , 25 9 Horticulture/Lettuce

jun 2006: 1 20 Training Best Practices/Authors , 2 19 LimeWire , 3 19 Goats/Introduction , 4 18 Strategy for Information Markets/e-Commerce , 5 18 Horticulture/Pineapple , 6 18 Computer Programming/Hello world , 7 16 Training Best Practices , 8 15 Adventist Youth Honors Answer Book/Arts and Crafts/Aboriginal Lore , 9 15 Adventist Youth Honors Answer Book/Nature/Small Mammal Pets , 10 13 Field Guide/Birds/Haliaeetus leucocephalus , 11 12 Managing Groups and Teams , 12 12 Blender 3D: Noob to Pro , 13 11 Colonizing Outer Space/Colonization , 14 11 Adventist Youth Honors Answer Book/Nature/Fishes , 15 11 Inkscape/About , 16 11 Learning Theories , 17 10 Horticulture/Earwigs , 18 10 Horticulture/Fragaria , 19 9 Adventist Youth Honors Answer Book/Outreach/Maori Lore , 20 9 Adventist Youth Honors Answer Book/Nature/Cats - Advanced , 21 9 Horticulture/Vitis , 22 9 Field Guide/Birds/Columba livia , 23 9 Field Guide/Birds/Branta canadensis , 24 9 New Title Suggestions , 25 8 Guide to The Lord of the Rings/Characters/Morgoth

jul 2006: 1 23 Strategy for Information Markets/e-Commerce , 2 23 Goats/Introduction , 3 19 LimeWire , 4 18 Adventist Youth Honors Answer Book/Nature/Cats - Advanced , 5 18 Horticulture/Earwigs , 6 16 Intellectual Property and the Internet/Intellectual property , 7 12 Hinduism/The Puranas , 8 12 Horticulture/Maggots , 9 12 Computer Programming/Hello world , 10 11 Adventist Youth Honors Answer Book/Arts and Crafts/Africa Lore , 11 11 Field Guide/Birds/Haliaeetus leucocephalus , 12 11 Horticulture/Beetles , 13 10 Adventist Youth Honors Answer Book/Arts and Crafts/Aboriginal Lore , 14 10 Horticulture/Wasps , 15 9 Horticulture/Caterpillars , 16 9 New Book of the Quarter/2006-4th Quarter Vote , 17 9 Blender 3D: Noob to Pro , 18 8 Guide to The Lord of the Rings/Characters/Morgoth , 19 8 Colonizing Outer Space/Colonization , 20 8 Introduction to Software Engineering/Process/Extreme Programming , 21 8 Hinduism/Hindu Temples , 22 8 Adventist Youth Honors Answer Book/Outreach/Puppetry , 23 8 Horticulture/Fragaria , 24 8 Field Guide/Birds/Falco peregrinus , 25 8 Horticulture/Thrips

ago 2006: 1 28 Locksmithing , 2 21 Field Guide/Birds/Haliaeetus leucocephalus , 3 20 LimeWire , 4 19 Human Physiology/Appendix 1: answers to review questions , 5 18 Human Physiology/Assignments , 6 17 Goats/Introduction , 7 15 Radioactive Waste Management/Radiation Interaction Fundamentals , 8 15 Adventist Youth Honors Answer Book/Nature/Cats - Advanced , 9 15 Horticulture/Fragaria , 10 14 Adventist Youth Honors Answer Book/Outreach/Maori Lore , 11 13 Intellectual Property and the Internet/Intellectual property , 12 12 Strategy for Information Markets/e-Commerce , 13 12 Colonizing Outer Space/Colonization , 14 12 Human Physiology/The cardiovascular system , 15 12 Human Physiology/The Nervous System , 16 11 Adventist Youth Honors Answer Book/Arts and Crafts/Aboriginal Lore , 17 11 Adventist Youth Honors Answer Book/Nature/Small Mammal Pets , 18 11 Horticulture/Pineapple , 19 11 Human Physiology/The female reproductive system , 20 11 Human Physiology/Genetics and inheritance , 21 10 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/High performance liquid chromatography , 22 10 Adventist Youth Honors Answer Book/Outreach/Puppetry , 23 10 Field Guide/Birds/Branta canadensis , 24 10 Human Physiology/Pregnancy and birth , 25 10 Human Physiology/Development: birth through death

set 2006: 1 28 Strategy for Information Markets/e-Commerce , 2 22 Adventist Youth Honors Answer Book/Outreach/Maori Lore , 3 22 Social and Cultural Foundations of American Education/Philosophy and Ethics/Educational Philosophies , 4 19 LimeWire , 5 19 Goats/Introduction , 6 16 Intellectual Property and the Internet/Intellectual property , 7 16 Social and Cultural Foundations of American Education/Philosophy and Ethics/Purpose , 8 16 Horticulture/Slugs , 9 16 Computer Programming/Hello world , 10 14 Drinking Water/Scarcity , 11 14 Adventist Youth Honors Answer Book/Outreach/Puppetry , 12 14 Adventist Youth Honors Answer Book/Arts and Crafts/Africa Lore , 13 14 Field Guide/Birds/Haliaeetus leucocephalus , 14 14 Locksmithing , 15 12 Social and Cultural Foundations of American Education/Philosophy and Ethics/Wiki Philosophy , 16 11 Adventist Youth Honors Answer Book/Nature/Waterfalls , 17 11 Horticulture/Vitis , 18 11 Horticulture/Lettuce , 19 11 Social and Cultural Foundations of American Education/Dynamic Learning Environment/Motivation , 20 10 Guide to The Lord of the Rings/Characters/Morgoth , 21 10 Colonizing Outer Space/Colonization , 22 10 The History of the Native Peoples of the Americas/Mesoamerican Cultures/Tarascans , 23 10 Software Tools For Molecular Microscopy , 24 10 Adventist Youth Honors Answer Book/Nature/Small Mammal Pets , 25 10 Field Guide/Birds/Branta canadensis

out 2006: 1 29 Social and Cultural Foundations of American Education/History/20th Century , 2 24 Field Guide/Birds/Branta canadensis , 3 23 LimeWire , 4 22 Goats/Introduction , 5 19 Adventist Youth Honors Answer Book/Nature/Cats - Advanced , 6 19 Social and Cultural Foundations of American Education/Educational Change/Theory , 7 19 Social and Cultural Foundations of American Education/History/21st Century , 8 19 Social and Cultural Foundations of American Education/Philosophy and Ethics/Educational Philosophies , 9 18 Social and Cultural Foundations of American Education/Educational Change/NCLB , 10 17 Horticulture/Vitis , 11 17 Field Guide/Birds/Falco peregrinus , 12 17 Locksmithing , 13 17 Social and Cultural Foundations of American Education/Barriers/Mobility , 14 16 Human Body/Lungs , 15 15 Adventist Youth Honors Answer Book/Nature/Small Mammal Pets , 16 15 Field Guide/Birds/Haliaeetus leucocephalus , 17 15 Social and Cultural Foundations of American Education/History/19th Century , 18 15 Social and Cultural Foundations of American Education/Classroom Issues/Discipline , 19 14 Intellectual Property and the Internet/Intellectual property , 20 14 Horticulture/Pineapple , 21 14 Social and Cultural Foundations of American Education/Philosophy and Ethics/Purpose , 22 13 Social and Cultural Foundations of American Education/History/17th Century , 23 13 Social and Cultural Foundations of American Education/Barriers/Obsolescence , 24 12 Guide to The Lord of the Rings/Characters/Morgoth , 25 12 Colonizing Outer Space/Colonization

nov 2006: 1 39 Goats/Introduction , 2 26 Strategy for Information Markets/e-Commerce , 3 22 Horticulture/Pineapple , 4 21 LimeWire , 5 19 Human Body/Lungs , 6 19 Field Guide/Birds/Haliaeetus leucocephalus , 7 17 Horticulture/Lettuce , 8 15 Inorganic Chemistry/Chemical Bonding/Lewis Dot Structures , 9 14 Intellectual Property and the Internet/Intellectual property , 10 14 Adventist Youth Honors Answer Book/Nature/Waterfalls , 11 14 Field Guide/Birds/Falco peregrinus , 12 14 The Computer Revolution , 13 13 Adventist Youth Honors Answer Book/Outreach/Maori Lore , 14 13 Horticulture/Vitis , 15 13 Field Guide/Birds/Aquila chrysaetos , 16 13 Horticulture/Bamboo , 17 12 Adventist Youth Honors Answer Book/Nature/Small Mammal Pets , 18 12 Field Guide/Birds/Buteo jamaicensis , 19 12 Social and Cultural Foundations of American Education/Relationships/Disconnect , 20 11 Adventist Youth Honors Answer Book/Recreation/Drumming & Percussion , 21 11 Horticulture/Nematodes , 22 11 Locksmithing , 23 10 Remembering the Templars , 24 10 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/High performance liquid chromatography , 25 10 Horticulture/Chainsaws

dez 2006: 1 34 Field Guide/Birds/Haliaeetus leucocephalus , 2 28 LimeWire , 3 27 Strategy for Information Markets/e-Commerce , 4 25 Goats/Introduction , 5 19 Horticulture/Bamboo , 6 18 Adventist Youth Honors Answer Book/Nature/Cats - Advanced , 7 18 Horticulture/Euphorbia pulcherrima , 8 17 Body Hair Removal , 9 16 Adventist Youth Honors Answer Book/Arts and Crafts/Africa Lore , 10 16 The Computer Revolution , 11 15 Colonizing Outer Space/Colonization , 12 14 Horticulture/Vitis , 13 14 Field Guide/Birds/Falco peregrinus , 14 12 Sign language , 15 12 Adventist Youth Honors Answer Book/Nature/Small Mammal Pets , 16 12 Adventist Youth Honors Answer Book/Nature/Fishes , 17 12 Horticulture/Pyrus , 18 12 Field Guide/Birds/Branta canadensis , 19 11 Intellectual Property and the Internet/Intellectual property , 20 11 Adventist Youth Honors Answer Book/Health and Science/Home Nursing , 21 11 Human Body/Lungs , 22 10 Pressure Cooking , 23 10 Field Guide/Birds/Pandion haliaetus , 24 10 Horticulture/Nematodes , 25 9 Adventist Youth Honors Answer Book/Recreation/Drumming & Percussion

jan 2007: 1 21 Horticulture/Vitis , 2 20 LimeWire , 3 20 Field Guide/Birds/Haliaeetus leucocephalus , 4 17 Field Guide/Birds/Columba livia , 5 15 Adventist Youth Honors Answer Book/Nature/Small Mammal Pets , 6 15 Biblical Studies/New Testament Commentaries/The Gospel of John/Chapter 1 , 7 14 When It Hits the Fan/Specific Calamities/Pandemy , 8 14 Adventist Youth Honors Answer Book/Outreach/Maori Lore , 9 14 Horticulture/Fragaria , 10 13 Adventist Youth Honors Answer Book/Nature/Cats - Advanced , 11 12 Adventist Youth Honors Answer Book/Arts and Crafts/Africa Lore , 12 12 Horticulture/Pyrus , 13 12 Field Guide/Birds/Branta canadensis , 14 11 Strategy for Information Markets/e-Commerce , 15 11 Introduction to Software Engineering/Architecture/Anti-Patterns , 16 11 Human Body/Lungs , 17 11 Field Guide/Birds/Buteo jamaicensis , 18 11 Horticulture/Bamboo , 19 10 Intellectual Property and the Internet/Intellectual property , 20 10 Adventist Youth Honors Answer Book/Arts and Crafts/Model Railroad , 21 10 Adventist Youth Honors Answer Book/Health and Science/Home Nursing , 22 10 Field Guide/Birds/Falco peregrinus , 23 10 Horticulture/Capsicum , 24 9 Adventist Youth Honors Answer Book/Nature/Waterfalls , 25 9 Wikimedia/Wikibooks

fev 2007: 1 22 Training Best Practices/Authors , 2 20 Horticulture/Fragaria , 3 20 Field Guide/Birds/Haliaeetus leucocephalus , 4 19 Adventist Youth Honors Answer Book/Nature/Waterfalls , 5 18 Field Guide/Birds/Falco peregrinus , 6 17 Adventist Youth Honors Answer Book/Nature/Cats - Advanced , 7 16 Adventist Youth Honors Answer Book/Nature/Small Mammal Pets , 8 16 Human Body/Lungs , 9 16 Training Best Practices , 10 15 Field Guide/Birds/Columba livia , 11 15 Horticulture/Chainsaws , 12 14 LimeWire , 13 14 Colonizing Outer Space/Colonization , 14 14 The History of the Native Peoples of the Americas/Mesoamerican Cultures/Teotihuacanos , 15 14 Adventist Youth Honors Answer Book/Outreach/Puppetry , 16 14 Inkscape/About , 17 14 Biblical Studies/New Testament Commentaries/The Gospel of John/Chapter 5 , 18 13 Strategy for Information Markets/e-Commerce , 19 13 Adventist Youth Honors Answer Book/Arts and Crafts/Africa Lore , 20 13 Horticulture/Capsicum , 21 13 Biblical Studies/New Testament Commentaries/The Gospel of John/Chapter 3 , 22 13 Biblical Studies/New Testament Commentaries/The Gospel of John/Chapter 2 , 23 12 Feminism/Literature/A Vindication of the Rights of Woman , 24 12 Sign language , 25 12 Biblical Studies/New Testament Commentaries/The Gospel of John/Chapter 6

mar 2007: 1 21 Horticulture/Fragaria , 2 17 Adventist Youth Honors Answer Book/Nature/Waterfalls , 3 17 Adventist Youth Honors Answer Book/Nature/Small Mammal Pets , 4 17 Adventist Youth Honors Answer Book/Nature/Seeds , 5 16 Adventist Youth Honors Answer Book/Nature/Cats - Advanced , 6 16 Human Body/Lungs , 7 16 Field Guide/Birds/Falco peregrinus , 8 15 Human Physiology/The Immune System , 9 14 Strategy for Information Markets/e-Commerce , 10 14 Human Physiology/The respiratory system , 11 13 Colonizing Outer Space/Colonization , 12 13 Bards Irish Fiddle Tunebook Supplement/Whiskey in the Jar , 13 13 Human Physiology/Blood physiology , 14 13 Human Physiology/The Urinary System , 15 12 When It Hits the Fan/Specific Calamities/Pandemy , 16 12 Horticulture/Pyrus , 17 12 Field Guide/Birds/Aquila chrysaetos , 18 12 Biblical Studies/New Testament Commentaries/The Gospel of John/Chapter 9 , 19 11 Feminism/Literature/A Vindication of the Rights of Woman , 20 11 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/General information on Science and its interface with society/Human genetic engineering , 21 11 Adventist Youth Honors Answer Book/Outreach/Maori Lore , 22 11 Horticulture/Lilium , 23 11 Adventist Youth Honors Answer Book/Arts and Crafts/Felt Craft , 24 11 Field Guide/Birds/Branta canadensis , 25 11 Human Physiology/The cardiovascular system

abr 2007: 1 23 Strategy for Information Markets/e-Commerce , 2 22 LimeWire , 3 19 Adventist Youth Honors Answer Book/Nature/Waterfalls , 4 19 Knowledge Management Cases in Asia , 5 17 Adventist Youth Honors Answer Book/Nature/Small Mammal Pets , 6 17 Human Physiology/The female reproductive system , 7 15 Adventist Youth Honors Answer Book/Arts and Crafts/Aboriginal Lore , 8 15 Horticulture/Pyrus , 9 15 Human Physiology/Development: birth through death , 10 14 Horticulture/Toxicodendron radicans , 11 14 Human Physiology/Pregnancy and birth , 12 13 Adventist Youth Honors Answer Book/Nature/Cats - Advanced , 13 13 Human Physiology/Nutrition , 14 13 Human Physiology/The gastrointestinal system , 15 12 Human Physiology/Genetics and inheritance , 16 11 Fukushima Aftermath/Yucca Mountain , 17 11 Adventist Youth Honors Answer Book/Outreach/Maori Lore , 18 11 Adventist Youth Honors Answer Book/Arts and Crafts/Model Hot Air Balloons , 19 11 Adventist Youth Honors Answer Book/ADRA/Hunger Relief , 20 10 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Infrared spectroscopy , 21 10 Adventist Youth Honors Answer Book/Arts and Crafts/Africa Lore , 22 10 Adventist Youth Honors Answer Book/Health and Science/Home Nursing , 23 10 Biblical Studies/New Testament Commentaries/The Gospel of John/Chapter 19 , 24 10 Biblical Studies/New Testament Commentaries/The Gospel of John/Chapter 16 , 25 10 Social and Cultural Foundations of American Education/Dynamic Learning Environment/Multiple Strategies

mai 2007: 1 120 Ethnomedicine/Ethnomedicine by Culture Group , 2 106 Ethnomedicine/Home Remedies , 3 46 Ethnomedicine/Ethnomedicine by Illness , 4 43 Ethnomedicine/Disease Prevention Practices , 5 37 Writing a Good Book for Children , 6 26 Applied History of Psychology , 7 21 Horticulture/Toxicodendron radicans , 8 20 Adventist Youth Honors Answer Book/Nature/Cats - Advanced , 9 17 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/X-ray crystallography , 10 15 Adventist Youth Honors Answer Book/Nature/Small Mammal Pets , 11 13 Strategy for Information Markets/e-Commerce , 12 13 Fukushima Aftermath/Yucca Mountain , 13 13 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Doppler spectroscopy , 14 13 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/General information on Science and its interface with society/Human genetic engineering , 15 13 Adventist Youth Honors Answer Book/Arts and Crafts/Africa Lore , 16 13 Adventist Youth Honors Answer Book/Nature/Marsupials , 17 11 Guide to The Lord of the Rings/Characters/Morgoth , 18 11 LimeWire , 19 11 Sign language , 20 11 Inkscape/About , 21 10 Colonizing Outer Space/Colonization , 22 10 Adventist Youth Honors Answer Book/Arts and Crafts/Aboriginal Lore , 23 10 IB Biology/Study Guide , 24 9 Remembering the Templars , 25 9 Introduction to Software Engineering/Process/Extreme Programming

jun 2007: 1 29 IB Biology/Study Guide , 2 26 Horticulture/Toxicodendron radicans , 3 24 Applied History of Psychology , 4 20 LimeWire , 5 16 Adventist Youth Honors Answer Book/Nature/Waterfalls , 6 13 Ancient History/Human Evolution/Recent African Origin , 7 13 Adventist Youth Honors Answer Book/Arts and Crafts/Aboriginal Lore , 8 13 Adventist Youth Honors Answer Book/Nature/Small Mammal Pets , 9 10 Strategy for Information Markets/e-Commerce , 10 10 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Nuclear magnetic resonance , 11 10 Adventist Youth Honors Answer Book/Outreach/Puppetry , 12 10 Adventist Youth Honors Answer Book/Arts and Crafts/Africa Lore , 13 10 Adventist Youth Honors Answer Book/Outreach/Maori Lore , 14 9 Adventist Youth Honors Answer Book/Nature/Cats - Advanced , 15 9 Ethnomedicine/Ethnomedicine by Culture Group , 16 9 LaTeX , 17 8 Undergraduate Mathematics/Proof by contradiction , 18 8 Change Issues in Curriculum and Instruction/Curriculum and instruction reform: Making America competitive in a \"flat\" world , 19 8 Classroom Management Theorists and Theories , 20 7 SQLite , 21 7 Guide to The Lord of the Rings/Characters/Morgoth , 22 7 When It Hits the Fan/Specific Calamities/Pandemy , 23 7 Hinduism/Hindu Temples , 24 7 Bartending/Cocktails/Bloody Mary , 25 7 Change Issues in Curriculum and Instruction/Accountability

jul 2007: 1 17 LimeWire , 2 16 Adventist Youth Honors Answer Book/Nature/Small Mammal Pets , 3 15 Ancient History/Human Evolution/Recent African Origin , 4 14 Strategy for Information Markets/e-Commerce , 5 13 Horticulture/Toxicodendron radicans , 6 12 Adventist Youth Honors Answer Book/Arts and Crafts/Aboriginal Lore , 7 11 Adventist Youth Honors Answer Book/Arts and Crafts/Africa Lore , 8 10 Adventist Youth Honors Answer Book/Outreach/Maori Lore , 9 10 Inkscape/About , 10 9 Bicycles/Road Safety , 11 8 Sign language , 12 7 Bards Irish Fiddle Tunebook Supplement/Whiskey in the Jar , 13 7 Fukushima Aftermath/Yucca Mountain , 14 7 Prosciutto , 15 7 Adventist Youth Honors Answer Book/Nature/Cats - Advanced , 16 7 Adventist Youth Honors Answer Book/Nature/Fishes , 17 6 Guide to The Lord of the Rings/Characters/Morgoth , 18 6 Undergraduate Mathematics/Continuous function , 19 6 Undergraduate Mathematics/Least common multiple , 20 6 Undergraduate Mathematics/Sequence , 21 6 Undergraduate Mathematics/Homeomorphism , 22 6 Undergraduate Mathematics/Mathematical induction , 23 6 Ethnography of Fiddle/Ethnography , 24 6 Introduction to Software Engineering/Tools/Project Management , 25 6 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/X-ray crystallography

ago 2007: 1 27 LimeWire , 2 26 Adventist Youth Honors Answer Book/Nature/Small Mammal Pets , 3 18 Adventist Youth Honors Answer Book/Arts and Crafts/Aboriginal Lore , 4 12 Diablo Canyon Nuclear Power Plant: The WikiBook/Anti nuclear movement , 5 11 Adventist Youth Honors Answer Book/Outreach/Maori Lore , 6 9 Linguistics/Sociolinguistics , 7 9 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Nuclear magnetic resonance , 8 8 Guide to The Lord of the Rings/Characters/Morgoth , 9 8 Ancient History/Human Evolution/Recent African Origin , 10 8 Sign language , 11 8 California Public Policy and Citizen Participation/Chapter Ten , 12 7 Strategy for Information Markets/e-Commerce , 13 7 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Gas chromatography , 14 7 Adventist Youth Honors Answer Book/Health and Science/Home Nursing , 15 7 Bartending/Cocktails/Bloody Mary , 16 7 Horticulture/Toxicodendron radicans , 17 7 Inkscape/About , 18 6 Diablo Canyon Nuclear Power Plant: The WikiBook/Union of Concerned Scientists , 19 6 The History of the Native Peoples of the Americas/Mesoamerican Cultures/Teotihuacanos , 20 6 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/High performance liquid chromatography , 21 6 Hinduism/The Puranas , 22 6 JavaServer Pages , 23 6 Adventist Youth Honors Answer Book/Outreach/Puppetry , 24 6 Adventist Youth Honors Answer Book/Arts and Crafts/Africa Lore , 25 6 Adventist Youth Honors Answer Book/Arts and Crafts/Whistles

set 2007: 1 25 Strategy for Information Markets/e-Commerce , 2 23 LimeWire , 3 14 Literary Criticism/Poems for Close Reading with Questions , 4 13 Adventist Youth Honors Answer Book/Nature/Small Mammal Pets , 5 13 Adventist Youth Honors Answer Book/Nature/Fishes , 6 11 Horticulture/Toxicodendron radicans , 7 10 Adventist Youth Honors Answer Book/Health and Science/Home Nursing , 8 9 Adventist Youth Honors Answer Book/Nature/Waterfalls , 9 9 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/X-ray crystallography , 10 9 Hinduism/Hindu Temples , 11 9 Adventist Youth Honors Answer Book/Arts and Crafts/Aboriginal Lore , 12 8 Cuisine of Afghanistan , 13 8 Social and Cultural Foundations of American Education/Dynamic Learning Environment/Fun and Joy , 14 8 Social and Cultural Foundations of American Education/Choice/For Home Schooling , 15 8 Literary Criticism/Shakespeare Our Contemporary , 16 7 Chinese Stories/Pangu , 17 7 Adventist Youth Honors Answer Book/Recreation/Gold Prospecting , 18 7 History of the National Hockey League , 19 7 Adventist Youth Honors Answer Book/Nature/Cats - Advanced , 20 7 Social and Cultural Foundations of American Education/History/19th Century , 21 7 Social and Cultural Foundations of American Education/Philosophy and Ethics/Educational Philosophies , 22 6 Undergraduate Mathematics/Mathematical induction , 23 6 Drinking Water/Scarcity , 24 6 When It Hits the Fan/Specific Calamities/Pandemy , 25 6 Linguistics/Semantics

out 2007: 1 29 LimeWire , 2 24 Social and Cultural Foundations of American Education/Classroom Issues/Rewards , 3 19 Strategy for Information Markets/e-Commerce , 4 16 Social and Cultural Foundations of American Education/Dynamic Learning Environment/Fun and Joy , 5 16 Training Best Practices/Authors , 6 15 Adventist Youth Honors Answer Book/Nature/Small Mammal Pets , 7 13 Adventist Youth Honors Answer Book/Arts and Crafts/Aboriginal Lore , 8 13 Social and Cultural Foundations of American Education/Relationships/Mutual Responsibilities , 9 12 Diablo Canyon Nuclear Power Plant: The WikiBook/Anti nuclear movement , 10 10 Adventist Youth Honors Answer Book/Nature/Waterfalls , 11 10 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/X-ray crystallography , 12 10 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/General information on Science and its interface with society/Human genetic engineering , 13 10 Adventist Youth Honors Answer Book/Recreation/Skiing - Cross Country , 14 10 Horticulture/Acer rubrum , 15 10 Social and Cultural Foundations of American Education/Hot Topics/Homework , 16 10 Social and Cultural Foundations of American Education/Forgotten Half/Learned Helplessness , 17 10 Training Best Practices , 18 9 Social and Cultural Foundations of American Education/Technology/Classroom Technology , 19 9 Social and Cultural Foundations of American Education/Classroom Issues/Group Work , 20 9 Blender 3D: Noob to Pro , 21 8 Ancient History/Human Evolution/Recent African Origin , 22 8 Colonizing Outer Space/Colonization , 23 8 Inorganic Chemistry/Chemical Bonding/Lewis Dot Structures , 24 8 Horticulture/Toxicodendron radicans , 25 8 Social and Cultural Foundations of American Education/Choice/For Home Schooling

nov 2007: 1 20 Adventist Youth Honors Answer Book/Nature/Small Mammal Pets , 2 18 Adventist Youth Honors Answer Book/Outreach/Maori Lore , 3 16 Adventist Youth Honors Answer Book/Arts and Crafts/Aboriginal Lore , 4 14 LimeWire , 5 14 Strategy for Information Markets/e-Commerce , 6 14 Adventist Youth Honors Answer Book/Nature/Waterfalls , 7 14 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/General information on Science and its interface with society/Human genetic engineering , 8 11 Diablo Canyon Nuclear Power Plant: The WikiBook/Anti nuclear movement , 9 10 Prosciutto , 10 9 Intellectual Property and the Internet/Web search engines , 11 9 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Fluorescence , 12 8 When It Hits the Fan/Specific Calamities/Pandemy , 13 8 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Paper chromatography , 14 8 Messier Index/M34 , 15 8 Adventist Youth Honors Answer Book/Health and Science/Home Nursing , 16 8 Horticulture/Toxicodendron radicans , 17 8 Ecology/Parasitism , 18 8 Social and Cultural Foundations of American Education/Classroom Issues/Positive Discipline , 19 8 Ecology/Ecosystems , 20 7 Undergraduate Mathematics/Metric space , 21 7 Undergraduate Mathematics/Mathematical induction , 22 7 Ancient History/Human Evolution/Recent African Origin , 23 7 Colonizing Outer Space/Colonization , 24 7 Adventist Youth Honors Answer Book/Recreation/Drumming & Percussion , 25 7 Adventist Youth Honors Answer Book/Outreach/Puppetry

dez 2007: 1 20 Adventist Youth Honors Answer Book/Nature/Small Mammal Pets , 2 11 Strategy for Information Markets/e-Commerce , 3 10 Diablo Canyon Nuclear Power Plant: The WikiBook/Anti nuclear movement , 4 9 SQLite , 5 9 Adventist Youth Honors Answer Book/Arts and Crafts/Africa Lore , 6 9 Adventist Youth Honors Answer Book/Health and Science/Home Nursing , 7 9 Chestnut , 8 8 Colonizing Outer Space/Colonization , 9 8 Introduction to Software Engineering/Tools/Project Management , 10 8 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/General information on Science and its interface with society/Human genetic engineering , 11 8 Adventist Youth Honors Answer Book/Outreach/Maori Lore , 12 8 IB Physics/Astrophysics SL , 13 8 Web 2.0 and Emerging Learning Technologies/Digital Divide , 14 8 Web 2.0 and Emerging Learning Technologies/Web 2.0 Tools , 15 8 Ecology/Biogeochemical cycles , 16 7 California Public Policy and Citizen Participation/Chapter Ten , 17 7 Adventist Youth Honors Answer Book/Arts and Crafts/Aboriginal Lore , 18 7 Cuisine of Afghanistan , 19 7 Web 2.0 and Emerging Learning Technologies/Learning Styles , 20 7 Web 2.0 and Emerging Learning Technologies/GIS , 21 6 Undergraduate Mathematics/Alternating group , 22 6 Undergraduate Mathematics/Cyclic group , 23 6 Remembering the Templars/Age , 24 6 Sign language , 25 6 Introduction to Software Engineering/Tools/IDE

jan 2008: 1 55 Introduction to Physical Science/Authors , 2 38 PsycholARTSical: Psyched about the arts , 3 15 Adventist Youth Honors Answer Book/Nature/Waterfalls , 4 14 Intellectual Property and the Internet/Web search engines , 5 13 Adventist Youth Honors Answer Book/Health and Science/Home Nursing , 6 12 Adventist Youth Honors Answer Book/Nature/Small Mammal Pets , 7 11 Sign language , 8 11 Adventist Youth Honors Answer Book/Outreach/Puppetry , 9 11 Adventist Youth Honors Answer Book/Arts and Crafts/Aboriginal Lore , 10 11 Advanced Interactive Media , 11 10 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/General information on Science and its interface with society/Human genetic engineering , 12 10 Adventist Youth Honors Answer Book/Arts and Crafts/Africa Lore , 13 10 Adventist Youth Honors Answer Book/Recreation/Skiing - Cross Country , 14 9 Introduction to Software Engineering/Testing/Test-driven Development , 15 9 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/X-ray crystallography , 16 9 The History of the Native Peoples of the Americas/Mesoamerican Cultures/Teotihuacanos , 17 9 Adventist Youth Honors Answer Book/Nature/Marsupials , 18 9 Inorganic Chemistry/Chemical Bonding/VSEPR theory , 19 9 Megauniversity , 20 8 SQLite , 21 8 Introduction to Software Engineering/Architecture/Anti-Patterns , 22 8 Introduction to Software Engineering/Process/Extreme Programming , 23 8 Curd , 24 7 Guide to The Lord of the Rings/Characters/Morgoth , 25 7 Undergraduate Mathematics/Continuous function

fev 2008: 1 52 Introduction to Physical Science/A.1 , 2 17 Intellectual Property and the Internet/Web search engines , 3 17 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Paper chromatography , 4 17 Adventist Youth Honors Answer Book/Nature/Small Mammal Pets , 5 17 PsycholARTSical: Psyched about the arts/Cognitive Views of Learning , 6 15 Adventist Youth Honors Answer Book/Outreach/Puppetry , 7 13 Chestnut , 8 12 PsycholARTSical: Psyched about the arts , 9 11 Strategy for Information Markets/e-Commerce , 10 11 Fukushima Aftermath/Yucca Mountain , 11 11 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/General information on Science and its interface with society/Human genetic engineering , 12 11 PsycholARTSical: Psyched about the arts/Sociocultural Views of Learning , 13 10 Adventist Youth Honors Answer Book/Nature/Waterfalls , 14 9 Colonizing Outer Space/Colonization , 15 9 Adventist Youth Honors Answer Book/Arts and Crafts/Whistles , 16 9 Adventist Youth Honors Answer Book/Outreach/Maori Lore , 17 8 Guide to The Lord of the Rings/Characters/Morgoth , 18 8 Adventist Youth Honors Answer Book/Recreation/Snowshoeing , 19 8 The History of the Native Peoples of the Americas/Mesoamerican Cultures/Teotihuacanos , 20 8 Adventist Youth Honors Answer Book/Arts and Crafts/Aboriginal Lore , 21 8 Advanced Interactive Media/A New Challenge: Ethics and Morality for Future Media , 22 8 Blender 3D: Noob to Pro , 23 7 Dungeons & Dragons/Commercial settings/Dragonlance/Flint Fireforge , 24 7 Ancient History/Human Evolution/Recent African Origin , 25 7 Introduction to Software Engineering/Testing/Test-driven Development

mar 2008: 1 29 Adventist Youth Honors Answer Book/Nature/Small Mammal Pets , 2 23 Intellectual Property and the Internet/Web search engines , 3 20 Project Management , 4 15 Fukushima Aftermath/Yucca Mountain , 5 15 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/General information on Science and its interface with society/Human genetic engineering , 6 14 Colonizing Outer Space/Colonization , 7 13 Adventist Youth Honors Answer Book/Nature/Waterfalls , 8 13 The History of the Native Peoples of the Americas/Mesoamerican Cultures/Teotihuacanos , 9 12 Sign language , 10 11 Adventist Youth Honors Answer Book/Outreach/Maori Lore , 11 10 Linguistics/Semantics , 12 10 Adventist Youth Honors Answer Book/Arts and Crafts/Aboriginal Lore , 13 10 Adventist Youth Honors Answer Book/Nature/Cats - Advanced , 14 10 How to Solve the Rubik's Cube , 15 9 Adventist Youth Honors Answer Book/Vocational/Forestry , 16 8 Strategy for Information Markets/e-Commerce , 17 8 Cashew , 18 8 Knots/Rope , 19 7 Introduction to Software Engineering/Architecture/Anti-Patterns , 20 7 Adventist Youth Honors Answer Book/Recreation/Drumming & Percussion , 21 7 Adventist Youth Honors Answer Book/Health and Science/Home Nursing , 22 7 Inorganic Chemistry/Chemical Bonding/VSEPR theory , 23 6 Ancient History/Human Evolution/Recent African Origin , 24 6 C Programming/complex.h , 25 6 Computer Science Design Patterns/Composite

abr 2008: 1 48 Introduction to Physical Science/A.2 , 2 46 Introduction to Physical Science/A.3 , 3 23 Intellectual Property and the Internet/Web search engines , 4 20 Adventist Youth Honors Answer Book/Nature/Small Mammal Pets , 5 18 Strategy for Information Markets/e-Commerce , 6 13 Knots/Rope , 7 13 PsycholARTSical: Psyched about the arts/Personal Development , 8 13 PsycholARTSical: Psyched about the arts/Cognitive Development , 9 12 Adventist Youth Honors Answer Book/Nature/Waterfalls , 10 12 PsycholARTSical: Psyched about the arts/Diversity , 11 11 Adventist Youth Honors Answer Book/Vocational/Forestry , 12 10 Adventist Youth Honors Answer Book/Arts and Crafts/Model Hot Air Balloons , 13 9 Sign language , 14 9 Fukushima Aftermath/Yucca Mountain , 15 9 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Nuclear magnetic resonance , 16 9 Adventist Youth Honors Answer Book/Arts and Crafts/Africa Lore , 17 9 Adventist Youth Honors Answer Book/Outreach/Maori Lore , 18 9 Foundations of Education and Instructional Assessment/Classroom Management/Positive Discipline , 19 9 Foundations of Education and Instructional Assessment/Educational Reform/Home Schooling , 20 9 Adventist Youth Honors Answer Book/Nature/Cats - Advanced , 21 9 PsycholARTSical: Psyched about the arts , 22 9 Blender 3D: Noob to Pro , 23 8 Colonizing Outer Space/Colonization , 24 8 Adventist Youth Honors Answer Book/Nature/Parrots and Cockatoos , 25 7 Cashew

mai 2008: 1 19 Adventist Youth Honors Answer Book/Recreation/Gold Prospecting , 2 18 Adventist Youth Honors Answer Book/Nature/Small Mammal Pets , 3 15 Intellectual Property and the Internet/Web search engines , 4 15 Adventist Youth Honors Answer Book/Arts and Crafts/Africa Lore , 5 14 Adventist Youth Honors Answer Book/Outreach/Puppetry , 6 13 Adventist Youth Honors Answer Book/Nature/Waterfalls , 7 12 Colonizing Outer Space/Colonization , 8 12 Bards Irish Fiddle Tunebook Supplement/Whiskey in the Jar , 9 12 Fukushima Aftermath/Yucca Mountain , 10 12 The History of the Native Peoples of the Americas/Mesoamerican Cultures/Teotihuacanos , 11 10 Strategy for Information Markets/e-Commerce , 12 10 Teach Cough Hygiene Everywhere/Epidemic , 13 10 Adventist Youth Honors Answer Book/Nature/Cats - Advanced , 14 9 Sign language , 15 9 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/General information on Science and its interface with society/Human genetic engineering , 16 9 Cashew , 17 9 Adventist Youth Honors Answer Book/Nature/Parrots and Cockatoos , 18 9 Blender 3D: Noob to Pro , 19 8 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Gas chromatography , 20 7 Undergraduate Mathematics/Random variable , 21 7 Drinking Water/Scarcity , 22 7 California Public Policy and Citizen Participation/Chapter Eight , 23 7 Introduction to Software Engineering/Testing/Unit Tests , 24 7 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/X-ray fluorescence , 25 7 The History of the Native Peoples of the Americas/Mesoamerican Cultures/Toltecs

jun 2008: 1 14 Adventist Youth Honors Answer Book/Arts and Crafts/Aboriginal Lore , 2 13 Intellectual Property and the Internet/Web search engines , 3 12 Strategy for Information Markets/e-Commerce , 4 12 Adventist Youth Honors Answer Book/Outreach/Maori Lore , 5 11 Hinduism/Hindu Temples , 6 11 Adventist Youth Honors Answer Book/Nature/Small Mammal Pets , 7 10 Radioactive Waste Management/Radiation Interaction Fundamentals , 8 9 The History of the Native Peoples of the Americas/Mesoamerican Cultures/Teotihuacanos , 9 8 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Nuclear magnetic resonance , 10 8 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Magnetometer , 11 8 Adventist Youth Honors Answer Book/Recreation/Gold Prospecting , 12 8 History of the National Hockey League/1917–1942 , 13 8 Adventist Youth Honors Answer Book/Arts and Crafts/Model Hot Air Balloons , 14 8 Knots/Rope , 15 8 Issues in Digital Technology in Education , 16 8 Cuisine of Austria , 17 7 SQLite , 18 7 Adventist Youth Honors Answer Book/Nature/Waterfalls , 19 7 Introduction to Software Engineering/Testing/Refactoring , 20 7 Cashew , 21 7 Stone Masonry , 22 6 Undergraduate Mathematics/Compact space , 23 6 Feminism/Literature/A Vindication of the Rights of Woman , 24 6 Introduction to Software Engineering/Testing/Unit Tests , 25 6 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Gas chromatography-mass spectrometry

jul 2008: 1 20 Intellectual Property and the Internet/Web search engines , 2 15 History of the National Hockey League/1917–1942 , 3 14 Strategy for Information Markets/e-Commerce , 4 13 Introduction to Information Literacy in the K12 Classroom/Contributors , 5 12 Adventist Youth Honors Answer Book/Nature/Waterfalls , 6 12 Adventist Youth Honors Answer Book/Nature/Small Mammal Pets , 7 12 Blender 3D: Noob to Pro , 8 9 Adventist Youth Honors Answer Book/Arts and Crafts/Africa Lore , 9 8 Drinking Water/Disinfection/Solar , 10 8 Bards Irish Fiddle Tunebook Supplement/Whiskey in the Jar , 11 8 The History of the Native Peoples of the Americas/Mesoamerican Cultures/Teotihuacanos , 12 8 Adventist Youth Honors Answer Book/Arts and Crafts/Aboriginal Lore , 13 8 Introduction to Information Literacy in the K12 Classroom , 14 7 Undergraduate Mathematics/Fundamental theorem of calculus , 15 7 Sign language , 16 7 Cashew , 17 7 Hinduism/Hindu Temples , 18 7 Adventist Youth Honors Answer Book/Health and Science/Home Nursing , 19 6 C Programming/stdlib.h/malloc , 20 6 Castles of England/Chesire , 21 6 Adventist Youth Honors Answer Book/Recreation/Track & Field , 22 6 Blackcurrant , 23 6 Messier Index/M104 , 24 6 Adventist Youth Honors Answer Book/Nature/Cats - Advanced , 25 6 Java Programming

ago 2008: 1 16 Adventist Youth Honors Answer Book/Nature/Small Mammal Pets , 2 12 Adventist Youth Honors Answer Book/Arts and Crafts/Africa Lore , 3 11 Adventist Youth Honors Answer Book/Recreation/Track & Field , 4 10 Undergraduate Mathematics/Abelian group , 5 9 Strategy for Information Markets/e-Commerce , 6 9 Adventist Youth Honors Answer Book/Arts and Crafts/Model Hot Air Balloons , 7 7 Drinking Water/Scarcity , 8 7 Sign language , 9 7 Adventist Youth Honors Answer Book/Outreach/Puppetry , 10 7 History of the National Hockey League/1942–1967 , 11 7 Adventist Youth Honors Answer Book/Arts and Crafts/Aboriginal Lore , 12 6 Undergraduate Mathematics/Fundamental theorem of calculus , 13 6 Principles of Finance/Section 1/Chapter 7/Efficient-Market Hypothesis , 14 6 Teach Cough Hygiene Everywhere/Epidemic , 15 6 Georgian/Introduction , 16 6 Cream Cheese , 17 6 Adventist Youth Honors Answer Book/Recreation/Drumming & Percussion , 18 6 Adventist Youth Honors Answer Book/Arts and Crafts/Whistles , 19 6 Adventist Youth Honors Answer Book/Nature/Palm Trees , 20 5 Ancient History/Human Evolution/Recent African Origin , 21 5 Linguistics/Sociolinguistics , 22 5 Linguistics/Semantics , 23 5 Adventist Youth Honors Answer Book/Nature/Waterfalls , 24 5 C Programming/stdlib.h/malloc , 25 5 Bards Irish Fiddle Tunebook Supplement/Whiskey in the Jar

set 2008: 1 18 Intellectual Property and the Internet/Web search engines , 2 13 Strategy for Information Markets/e-Commerce , 3 13 Adventist Youth Honors Answer Book/Nature/Waterfalls , 4 12 History of the National Hockey League/1942–1967 , 5 11 Adventist Youth Honors Answer Book/Recreation/Track & Field , 6 11 Cashew , 7 11 Adventist Youth Honors Answer Book/Arts and Crafts/Aboriginal Lore , 8 10 Training Best Practices , 9 9 History of the National Hockey League/1967–1992 , 10 9 Costume History , 11 9 Adventist Youth Honors Answer Book/Nature/Small Mammal Pets , 12 8 Undergraduate Mathematics/Stokes' theorem , 13 8 Stokes' theorem , 14 8 Sign language , 15 8 Bards Irish Fiddle Tunebook Supplement/Whiskey in the Jar , 16 7 Linguistics/Semantics , 17 7 History of the National Hockey League/1992–present , 18 7 Foundations of Education and Instructional Assessment/Educator as a Professional/Why Teach , 19 7 Adventist Youth Honors Answer Book/Arts and Crafts/Model Hot Air Balloons , 20 6 Undergraduate Mathematics/Green's theorem , 21 6 Ancient History/Human Evolution/Recent African Origin , 22 6 Introduction to Software Engineering/Process/Extreme Programming , 23 6 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Electron paramagnetic resonance , 24 6 Adventist Youth Honors Answer Book/Outreach/Maori Lore , 25 6 Foundations of Education and Instructional Assessment/Sociological Influences/Poverty

out 2008: 1 33 Structural Biochemistry/Proteins/Structures , 2 31 Structural Biochemistry , 3 23 Structural Biochemistry/Evolutionary Bases , 4 17 Adventist Youth Honors Answer Book/Nature/Waterfalls , 5 16 Structural Biochemistry/Proteins/Introduction , 6 13 Structural Biochemistry/Proteins/Western Blotting , 7 13 Structural Biochemistry/pH , 8 13 Structural Biochemistry/Water , 9 12 Adventist Youth Honors Answer Book/Arts and Crafts/Africa Lore , 10 12 Structural Biochemistry/Osmosis , 11 11 History of the National Hockey League/1967–1992 , 12 10 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Paper chromatography , 13 10 Structural Biochemistry/Lipids , 14 10 Structural Biochemistry/Cellular Basis/Eukaryotic Cell , 15 10 Structural Biochemistry/Chemical Bonding/Hydrogen bonds , 16 10 Structural Biochemistry/Genetic Bases , 17 9 Intellectual Property and the Internet/Web search engines , 18 9 Bards Irish Fiddle Tunebook Supplement/Whiskey in the Jar , 19 9 Adventist Youth Honors Answer Book/Arts and Crafts/Aboriginal Lore , 20 9 Structural Biochemistry/Carbohydrates , 21 9 Structural Biochemistry/RNA World Hypothesis , 22 9 Structural Biochemistry/Proteins/X-ray Crystallography , 23 9 Structural Biochemistry/First law , 24 9 Structural Biochemistry/Proteins/Gel Electrophoresis , 25 9 Structural Biochemistry/Chemical Bonding/Van der Waals interaction

nov 2008: 1 36 Structural Biochemistry , 2 19 Structural Biochemistry/Lipids , 3 19 Structural Biochemistry/Carbohydrates , 4 17 Intellectual Property and the Internet/Web search engines , 5 17 Structural Biochemistry/Carbohydrates/Monosaccharides , 6 15 Structural Biochemistry/DNA recombinant techniques/DNA sequencing , 7 14 Structural Biochemistry/DNA recombinant techniques/Plasmid , 8 14 New Learning and New Literacies , 9 13 Structural Biochemistry/DNA recombinant techniques/Restriction endonucleases , 10 12 Structural Biochemistry/DNA recombinant techniques/DNA synthesis , 11 11 Adventist Youth Honors Answer Book/Outreach/Puppetry , 12 11 Structural Biochemistry/DNA Amplification Technique:Polymerase Chain Reaction (PCR) , 13 11 Structural Biochemistry/Lipids/Micelles , 14 11 Structural Biochemistry/Bioinformatics/Sequences Alignments , 15 10 Adventist Youth Honors Answer Book/Nature/Waterfalls , 16 10 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/General information on Science and its interface with society/Human genetic engineering , 17 10 Adventist Youth Honors Answer Book/Outreach/Maori Lore , 18 10 Structural Biochemistry/Nucleic Acid/DNA/DNA structure , 19 10 Structural Biochemistry/Nucleic Acid/RNA/Other RNA , 20 10 Structural Biochemistry/Genetic code , 21 9 Adventist Youth Honors Answer Book/Arts and Crafts/Africa Lore , 22 9 Structural Biochemistry/Lipids/Membrane Fluidity , 23 9 Structural Biochemistry/Bioinformatics/Homology , 24 9 Structural Biochemistry/DNA recombinant techniques/Northern Blot , 25 9 Structural Biochemistry/Nucleic Acid/Difference between DNA and RNA

dez 2008: 1 34 Structural Biochemistry , 2 18 Structural Biochemistry/Protein function/Heme group/Hemoglobin , 3 18 K-12 School Computer Networking/Chapter 25 , 4 16 Structural Biochemistry/Enzyme Catalytic Mechanism/Proteases/Chymotrypsin , 5 15 Adventist Youth Honors Answer Book/Nature/Waterfalls , 6 14 Structural Biochemistry/Enzyme Regulation/Proteolytic activation , 7 14 Structural Biochemistry/Protein function/Heme group , 8 13 Structural Biochemistry/Enzyme/Cofactors , 9 12 Structural Biochemistry/Enzyme/Reversible Inhibitors/Competitive Inhibitor/Penicillin , 10 12 Structural Biochemistry/Enzyme Catalytic Mechanism/Carbonic Anhydrase , 11 12 Cuisine of Austria , 12 11 Structural Biochemistry/Enzyme/Michaelis constant , 13 11 Structural Biochemistry/Enzyme/Prosthetic Group , 14 11 Structural Biochemistry/Enzyme Regulation/Isozymes , 15 10 SQLite , 16 10 Structural Biochemistry/Enzyme/Cysteine Proteases , 17 10 Structural Biochemistry/Enzyme/Group Specific Reagent , 18 10 Structural Biochemistry/Enzyme Regulation/Allosteric Control , 19 10 Structural Biochemistry/Enzyme/Specificity , 20 10 Structural Biochemistry/Enzyme/Transition state , 21 9 Sign language , 22 9 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/General information on Science and its interface with society/Human genetic engineering , 23 9 Adventist Youth Honors Answer Book/Arts and Crafts/Africa Lore , 24 9 Structural Biochemistry/Enzyme/Double-Reciprocal plot: Lineweaver Burk plote , 25 9 Structural Biochemistry/Enzyme Catalytic Mechanism/Regulation/Regulation by 2,3-bisphosphoglycerate

jan 2009: 1 195 Foundations of Education and Instructional Assessment/About the Authors , 2 15 History of the National Hockey League/1967–1992 , 3 14 Adventist Youth Honors Answer Book/Nature/Waterfalls , 4 13 Sign language , 5 12 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/General information on Science and its interface with society/Human genetic engineering , 6 12 Black-eyed Pea , 7 11 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/High performance liquid chromatography , 8 9 California Public Policy and Citizen Participation/Chapter Ten , 9 9 Hinduism/Hindu Temples , 10 9 Adventist Youth Honors Answer Book/Arts and Crafts/Africa Lore , 11 8 Cream Cheese , 12 8 Adventist Youth Honors Answer Book/Arts and Crafts/Aboriginal Lore , 13 7 Undergraduate Mathematics/Least common multiple , 14 7 Teach Cough Hygiene Everywhere/Epidemic , 15 7 Adventist Youth Honors Answer Book/Recreation/Snowshoeing , 16 7 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Raman spectroscopy , 17 7 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Paper chromatography , 18 7 Adventist Youth Honors Answer Book/Recreation/Track & Field , 19 7 Cashew , 20 7 Adventist Youth Honors Answer Book/Outreach/Maori Lore , 21 6 Colonizing Outer Space/Colonization , 22 6 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Emission spectrum , 23 6 Stuffed Breast of Duck , 24 6 Fleischkrapfen , 25 6 Clove

fev 2009: 1 28 Cultural Anthropology/Ritual and Religion , 2 17 Cultural Anthropology/Communication and Language , 3 13 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/General information on Science and its interface with society/Human genetic engineering , 4 13 Foundations of Education and Instructional Assessment/About the Authors , 5 12 Cultural Anthropology/Marriage, Reproduction and Kinship , 6 11 Adventist Youth Honors Answer Book/Nature/Waterfalls , 7 9 Intellectual Property and the Internet/Web search engines , 8 9 Undergraduate Mathematics/Fundamental theorem of calculus , 9 9 Colonizing Outer Space/Colonization , 10 9 The History of the Native Peoples of the Americas/Mesoamerican Cultures/Toltecs , 11 9 Cream Cheese , 12 9 Cultural Anthropology/Introduction , 13 8 SQLite , 14 8 Adventist Youth Honors Answer Book/Arts and Crafts/Africa Lore , 15 8 Concurrent Engineering/Contributors , 16 8 Foundations of Education and Instructional Assessment/Educational Philosophy/Defined , 17 8 Constructivism & Technology/Introduction , 18 7 Sign language , 19 7 The History of the Native Peoples of the Americas/Mesoamerican Cultures/Teotihuacanos , 20 7 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Nuclear magnetic resonance , 21 7 Cashew , 22 7 Cultural Anthropology/Health and Healing , 23 7 Cultural Anthropology/Globalization and Migration , 24 7 Foundations of Education and Instructional Assessment/Educational Philosophy/Teacher-Student , 25 7 Foundations of Education and Instructional Assessment/History of Education/17th-18th Centuries

mar 2009: 1 110 Cultural Anthropology/Ritual and Religion , 2 91 Cultural Anthropology/Communication and Language , 3 84 Cultural Anthropology/Marriage, Reproduction and Kinship , 4 70 Cultural Anthropology/Health and Healing , 5 54 Cultural Anthropology/Social Stratification, Power and Conflict , 6 48 Cultural Anthropology/Globalization and Migration , 7 47 Cultural Anthropology/Production, Inequality and Development , 8 41 Cultural Anthropology/Introduction , 9 24 Cultural Anthropology/History of Anthropological Theory , 10 19 Cultural Anthropology/Anthropological Methods , 11 15 Intellectual Property and the Internet/Web search engines , 12 15 Adventist Youth Honors Answer Book/Arts and Crafts/Africa Lore , 13 15 History of the National Hockey League/1992–present , 14 12 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/General information on Science and its interface with society/Human genetic engineering , 15 11 Colonizing Outer Space/Colonization , 16 11 Radioactive Waste Management/Radiation Interaction Fundamentals , 17 11 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Fluorescence , 18 10 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Nuclear magnetic resonance , 19 10 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Paper chromatography , 20 9 Blender 3D: Noob to Pro , 21 8 Adventist Youth Honors Answer Book/Nature/Waterfalls , 22 7 SQLite , 23 7 Introduction to Software Engineering/Testing/Unit Tests , 24 7 Adventist Youth Honors Answer Book/Recreation/Gold Prospecting , 25 7 History of the National Hockey League

abr 2009: 1 70 Cultural Anthropology/Play, Sport and Arts , 2 64 Cultural Anthropology/Ritual and Religion , 3 34 Feminism/Literature/A Vindication of the Rights of Woman , 4 33 Cultural Anthropology/Communication and Language , 5 26 Cultural Anthropology/Marriage, Reproduction and Kinship , 6 12 Cultural Anthropology/Health and Healing , 7 12 Cultural Anthropology/Introduction , 8 11 Intellectual Property and the Internet/Web search engines , 9 11 Colonizing Outer Space/Colonization , 10 11 Cultural Anthropology/Human Rights , 11 10 Teach Cough Hygiene Everywhere/Epidemic , 12 10 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/General information on Science and its interface with society/Human genetic engineering , 13 9 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/X-ray image intensifier , 14 9 Cultural Anthropology/Globalization and Migration , 15 8 Software Engineers Handbook/Language Dictionary/Qi , 16 8 Adventist Youth Honors Answer Book/Nature/Waterfalls , 17 8 Algorithm Implementation/Sorting/Bogosort , 18 8 The History of the Native Peoples of the Americas/Mesoamerican Cultures/Teotihuacanos , 19 8 Cashew , 20 8 History of the National Hockey League , 21 8 Cultural Anthropology/Social Stratification, Power and Conflict , 22 7 Linguistics/Semantics , 23 7 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Paper chromatography , 24 7 Adventist Youth Honors Answer Book/Arts and Crafts/Africa Lore , 25 7 Digital Rhetoric

mai 2009: 1 75 Cultural Anthropology/Play, Sport and Arts , 2 37 Cultural Anthropology/Ritual and Religion , 3 36 Foundations and Assessment of Education/Edition 1/About the Authors , 4 33 Effective Student Organization/Problems that Student Organizations Face , 5 27 Foundations and Assessment of Education/Edition 1/Assessment Table of Contents/Assessment Chapter 1: Feedback/Student Soapbox , 6 23 Effective Student Organization/Recruiting and Membership , 7 20 Cultural Anthropology/Communication and Language , 8 19 Cultural Anthropology/Health and Healing , 9 19 Cultural Anthropology/Marriage, Reproduction and Kinship , 10 18 Foundations and Assessment of Education/Edition 1/Assessment Table of Contents/Assessment Chapter 1: Feedback/Article 1 Reader Responses , 11 16 Foundations and Assessment of Education/Edition 1/Assessment Table of Contents/Assessment Chapter 1: Feedback/Article 2 Reader Responses , 12 14 Adventist Youth Honors Answer Book/Nature/Waterfalls , 13 14 Effective Student Organization/Leadership and Communication , 14 11 Effective Student Organization/Fundraising , 15 11 Digital Rhetoric/Digital Rhetoric in Action , 16 11 Cultural Anthropology/Human Rights , 17 10 Intellectual Property and the Internet/Web search engines , 18 10 Cultural Anthropology/Social Stratification, Power and Conflict , 19 9 Teach Cough Hygiene Everywhere/Epidemic , 20 8 L. Ron Hubbard/Navy , 21 8 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/General information on Science and its interface with society/Human genetic engineering , 22 8 Cream Cheese , 23 8 Adventist Youth Honors Answer Book/Outreach/Puppetry , 24 7 Principles of Finance/Section 1/Chapter 7/Efficient-Market Hypothesis , 25 7 Ancient History/Human Evolution/Recent African Origin

jun 2009: 1 251 Effective Student Organization/Problems that Student Organizations Face , 2 143 Effective Student Organization/Recruiting and Membership , 3 111 Effective Student Organization/Leadership and Communication , 4 75 Effective Student Organization/Hosting Events , 5 59 Effective Student Organization/Fundraising , 6 48 Effective Student Organization/List of Student Organizations Mentioned in This Book , 7 33 Foundations and Assessment of Education/Edition 1/Assessment Table of Contents/Assessment Chapter 2: Question Writing/Student Soapbox , 8 31 Foundations and Assessment of Education/Edition 1/Assessment Table of Contents/Assessment Chapter 3: Question Writing/Student Soapbox , 9 29 Foundations and Assessment of Education/Edition 1/Assessment Table of Contents/Assessment Chapter 2: Question Writing (section)/Article 1 Reader Responses , 10 28 Foundations and Assessment of Education/Edition 1/Assessment Table of Contents/Assessment Chapter 4: Grading/Student Soapbox , 11 25 Foundations and Assessment of Education/Edition 1/Assessment Table of Contents/Assessment Chapter 4: Grading/Article 1 Reader Responses , 12 25 Cultural Anthropology/Play, Sport and Arts , 13 21 Foundations and Assessment of Education/Edition 1/Assessment Table of Contents/Assessment Chapter 3: Assessment for Learning (section)/Article 2 Reader Responses , 14 16 Intellectual Property and the Internet/Web search engines , 15 13 Foundations and Assessment of Education/Edition 1/Assessment Table of Contents/Assessment Chapter 3: Assessment for Learning (section)/Article 1 Reader Responses , 16 12 Ancient History/Human Evolution/Recent African Origin , 17 9 Adventist Youth Honors Answer Book/Nature/Waterfalls , 18 9 Colonizing Outer Space/Colonization , 19 7 SQLite , 20 7 Sign language , 21 7 Diablo Canyon Nuclear Power Plant: The WikiBook/orphaned pages/Accident , 22 7 California Public Policy and Citizen Participation/Chapter Eight , 23 7 California Public Policy and Citizen Participation/Chapter Ten , 24 7 Introduction to Software Engineering/Process/Extreme Programming , 25 7 Adventist Youth Honors Answer Book/Recreation/Track & Field

jul 2009: 1 28 Foundations and Assessment of Education/Edition 1/Foundations Table of Contents/Chapter 7/Student Soapbox , 2 28 Foundations and Assessment of Education/Edition 1/Foundations Table of Contents/Chapter 4/Student Soapbox , 3 27 Foundations and Assessment of Education/Edition 1/Foundations Table of Contents/Chapter 8/Student Soapbox , 4 27 Foundations and Assessment of Education/Edition 1/Foundations Table of Contents/Chapter 6/Student Soapbox , 5 27 Foundations and Assessment of Education/Edition 1/Foundations Table of Contents/Chapter 5/Student Soapbox , 6 27 Foundations and Assessment of Education/Edition 1/Foundations Table of Contents/Chapter 3/Student Soapbox , 7 22 Foundations and Assessment of Education/Edition 1/Foundations Table of Contents/Chapter 2/Student Soapbox , 8 22 Foundations and Assessment of Education/Edition 1/Foundations Table of Contents/Chapter 1/Student Soapbox , 9 17 Intellectual Property and the Internet/Web search engines , 10 13 Foundations and Assessment of Education/Edition 1/Foundations Table of Contents/Chapter 10/Student Soapbox , 11 12 Foundations and Assessment of Education/Edition 1/Foundations Table of Contents/Chapter 9/Student Soapbox , 12 10 Foundations and Assessment of Education/Edition 1/Foundations Table of Contents/Chapter 11/Student Soapbox , 13 8 Cream Cheese , 14 8 Blender 3D: Noob to Pro , 15 7 Introduction to Software Engineering/Process/Extreme Programming , 16 7 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Nuclear magnetic resonance , 17 7 Prosciutto , 18 7 Adventist Youth Honors Answer Book/Recreation/Gold Prospecting , 19 7 Adventist Youth Honors Answer Book/Arts and Crafts/Africa Lore , 20 6 Principles of Finance/Section 1/Chapter 7/Efficient-Market Hypothesis , 21 6 Diablo Canyon Nuclear Power Plant: The WikiBook/orphaned pages/disaster , 22 5 L. Ron Hubbard/Navy , 23 5 Undergraduate Mathematics/Random variable , 24 5 Undergraduate Mathematics/Sylow theorems , 25 5 Undergraduate Mathematics/Compact space

ago 2009: 1 29 Foundations and Assessment of Education/Edition 1/Foundations Table of Contents/Chapter 14/Student Soapbox , 2 29 Foundations and Assessment of Education/Edition 1/Foundations Table of Contents/Chapter 13/Student Soapbox , 3 29 Foundations and Assessment of Education/Edition 1/Foundations Table of Contents/Chapter 12/Student Soapbox , 4 22 Foundations and Assessment of Education/Edition 1/Foundations Table of Contents/Chapter 11/Student Soapbox , 5 20 Foundations and Assessment of Education/Edition 1/Foundations Table of Contents/Chapter 10/Student Soapbox , 6 18 Foundations and Assessment of Education/Edition 1/Foundations Table of Contents/Chapter 9/Student Soapbox , 7 16 Intellectual Property and the Internet/Web search engines , 8 10 Adventist Youth Honors Answer Book/Recreation/Track & Field , 9 10 Foundations and Assessment of Education/Edition 1/In Today's Schools Table of Contents/Parental Involvement , 10 9 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Nuclear magnetic resonance , 11 8 Foundations and Assessment of Education/Edition 1/In Today's Schools Table of Contents/Bullying , 12 8 Foundations and Assessment of Education/Edition 1/In Today's Schools Table of Contents/Classroom Environment , 13 6 Georgian/Introduction , 14 6 The History of the Native Peoples of the Americas/Mesoamerican Cultures/Teotihuacanos , 15 5 SQLite , 16 5 Teach Cough Hygiene Everywhere/Swine flu , 17 5 Sign language , 18 5 Linguistics/Semantics , 19 5 Introduction to Software Engineering/Tools/Continuous Integration , 20 5 Algorithm Implementation/Sorting/Bogosort , 21 5 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Fluorescence , 22 5 Hinduism/Hindu Temples , 23 5 Historical Rhetorics , 24 5 Foundations and Assessment of Education/Edition 1/Foundations Table of Contents/Chapter 5/Student Soapbox , 25 5 Foundations and Assessment of Education/Edition 1/In Today's Schools Table of Contents/Teacher - Student Interaction

set 2009: 1 22 Intellectual Property and the Internet/Web search engines , 2 13 Strategy for Information Markets , 3 10 The History of the Native Peoples of the Americas/Mesoamerican Cultures/Teotihuacanos , 4 9 Ancient History/Human Evolution/Recent African Origin , 5 8 Introduction to Software Engineering/Process/Methodology , 6 7 SQLite , 7 7 Teach Cough Hygiene Everywhere/Epidemic , 8 6 Linguistics/Semantics , 9 6 Introduction to Software Engineering/Testing/Test-driven Development , 10 6 Hinduism/Hindu Temples , 11 5 Undergraduate Mathematics/Sequence , 12 5 Principles of Finance/Section 1/Chapter 7/Modern Portfolio Theory , 13 5 Bards Bluegrass Fiddle Tunebook Supplement/Rocky Top , 14 5 Introduction to Software Engineering/Tools/Bug tracking system , 15 5 Introduction to Software Engineering/Quality , 16 5 Introduction to Software Engineering/Testing/Unit Tests , 17 5 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Nuclear magnetic resonance , 18 5 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Paper chromatography , 19 5 Adventist Youth Honors Answer Book/Recreation/Track & Field , 20 5 JavaServer Pages , 21 5 Historical Rhetorics/The Big Aristotle , 22 5 Sustainable Business/Sustainable business practice , 23 5 Nanotechnology/Glossary , 24 5 Nanotechnology/Nano and Society/Sample Syllabus , 25 5 Blender 3D: Noob to Pro

out 2009: 1 37 Intellectual Property and the Internet/Web search engines , 2 28 Structural Biochemistry , 3 11 SQLite , 4 10 Teach Cough Hygiene Everywhere/Epidemic , 5 9 K-12 School Computer Networking/Chapter 25 , 6 8 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Nuclear magnetic resonance , 7 8 Structural Biochemistry/Proteins/Amino Acids , 8 8 Strategy for Information Markets , 9 7 Undergraduate Mathematics/Least common multiple , 10 7 Sign language , 11 7 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Emission spectrum , 12 7 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Advanced Microscopy Group , 13 7 Structural Biochemistry/Alkali Earth metals , 14 7 Structural Biochemistry/Chemistry of important organic molecules in Biochemistry/Vitamins and Cofactors , 15 7 Structural Biochemistry/Proteins/Cryo-Electron Microscopy , 16 7 Structural Biochemistry/Proteins/X-ray Crystallography , 17 7 Introduction to Information Literacy in the K12 Classroom , 18 6 Principles of Finance/Section 1/Chapter 7/Modern Portfolio Theory , 19 6 Adventist Youth Honors Answer Book/Nature/Waterfalls , 20 6 Cashew , 21 6 Structural Biochemistry/The Endosymbiotic Theory , 22 6 Structural Biochemistry/Unique Properties/Versatility as a Solvent , 23 6 Structural Biochemistry/Organic Chemistry/Important Organic Reactions in Biochemistry/Peptide Bonding , 24 6 Structural Biochemistry/Inorganic Chemistry , 25 6 Structural Biochemistry/Organic Chemistry/Organic Functional Group/Hydroxyl

nov 2009: 1 45 Structural Biochemistry , 2 23 Intellectual Property and the Internet/Web search engines , 3 14 Structural Biochemistry/Lipids/Membrane Transport , 4 13 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/General information on Science and its interface with society/Human genetic engineering , 5 10 K-12 School Computer Networking/Chapter 25 , 6 8 Colonizing Outer Space/Colonization , 7 8 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/High performance liquid chromatography , 8 8 Structural Biochemistry/Polyermase Chain Reaction/Uses of PCR , 9 7 SQLite , 10 7 Undergraduate Mathematics/Least common multiple , 11 7 Teach Cough Hygiene Everywhere/Epidemic , 12 7 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Paper chromatography , 13 7 Structural Biochemistry/Polyermase Chain Reaction , 14 7 Structural Biochemistry/Carbohydrates , 15 6 Undergraduate Mathematics/Greatest common divisor , 16 6 Undergraduate Mathematics/Compact space , 17 6 Ancient History/Human Evolution/Recent African Origin , 18 6 Adventist Youth Honors Answer Book/Nature/Waterfalls , 19 6 Remembering the Templars , 20 6 Bards Old Time Fiddle Tunebook Supplement/Turkey in the Straw , 21 6 California Public Policy and Citizen Participation/Chapter Eight , 22 6 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Fluorescence , 23 6 Blackcurrant , 24 6 Structural Biochemistry/Genome Analysis/Sequenced Genomes , 25 6 Structural Biochemistry/Lipids/Lipid Bilayer

dez 2009: 1 44 Structural Biochemistry , 2 13 Intellectual Property and the Internet/Web search engines , 3 13 Colonizing Outer Space/Colonization , 4 11 Structural Biochemistry/Enzyme/Acid-Base Catalysis , 5 11 Strategy for Information Markets , 6 10 Structural Biochemistry/Cell Signaling Pathways/Muscular System , 7 10 Structural Biochemistry/Protein function/Binding Sites/Cooperativity , 8 9 Structural Biochemistry/Enzyme/Coenzymes , 9 9 Structural Biochemistry/Cell Signaling Pathways/Calcium Signaling , 10 9 Structural Biochemistry/Cell Signaling Pathways/G-Proteins and G-Protein Coupled Receptors , 11 8 Teach Cough Hygiene Everywhere/Epidemic , 12 8 Adventist Youth Honors Answer Book/Recreation/Snowshoeing , 13 8 Structural Biochemistry/Cell Signaling Pathways/Juxtacrine Signaling , 14 8 Professional and Technical Writing/FAQ , 15 8 Professional and Technical Writing , 16 7 Adventist Youth Honors Answer Book/Nature/Waterfalls , 17 7 Introduction to Software Engineering/Tools/Continuous Integration , 18 7 The History of the Native Peoples of the Americas/Mesoamerican Cultures/Toltecs , 19 7 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/General information on Science and its interface with society/Human genetic engineering , 20 7 Professional and Technical Writing/Rhetoric/Author/Style , 21 7 Structural Biochemistry/Cell Signaling Pathways/Nervous System , 22 7 Structural Biochemistry/Fluorescent Proteins , 23 7 Structural Biochemistry/Cell Signaling Pathways/Problems in Signaling that cause Cancer , 24 7 Structural Biochemistry/Membrane Proteins/Ligand-gated Ion Channels , 25 7 Structural Biochemistry/Membrane Proteins/Uniporters

jan 2010: 1 24 Social Research Methods/Ethics , 2 24 Social Research Methods/Theory , 3 14 History of Western Theatre: Greeks to Elizabethans , 4 12 Social Research Methods/Research Design , 5 9 Intellectual Property and the Internet/Web search engines , 6 9 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/General information on Science and its interface with society/Human genetic engineering , 7 8 Adventist Youth Honors Answer Book/Nature/Waterfalls , 8 7 Colonizing Outer Space/Colonization , 9 6 SQLite , 10 6 Undergraduate Mathematics/Least common multiple , 11 6 The History of the Native Peoples of the Americas/Mesoamerican Cultures/Toltecs , 12 5 Introduction to Software Engineering/Testing/Unit Tests , 13 5 Making Neon Signs , 14 5 Adventist Youth Honors Answer Book/Recreation/Snowshoeing , 15 5 Radioactive Waste Management/Radiation Interaction Fundamentals , 16 5 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/High performance liquid chromatography , 17 5 Cream Cheese , 18 5 Clotted Cream , 19 5 Biblical Studies/New Testament Commentaries/Galatians/Chapter 6 , 20 5 A-level Computing 2009/AQA/Problem Solving, Programming, Operating Systems, Databases and Networking/Communication and Networking , 21 5 Blender 3D: Noob to Pro , 22 5 Chinese (Mandarin) , 23 4 Undergraduate Mathematics/Greatest common divisor , 24 4 Principles of Finance/Section 1/Chapter/Financial Markets and Institutions/Interest , 25 4 Georgian/Alphabet

fev 2010: 1 21 Social Research Methods/Indexes, Scales, Typologies , 2 20 Social Research Methods/Surveys , 3 13 Social Research Methods/Quantitative Research , 4 13 Social Research Methods/Research Design , 5 11 Principles of Finance/Section 1/Chapter/Financial Markets and Institutions/Interest , 6 10 Adventist Youth Honors Answer Book/Nature/Waterfalls , 7 9 Principles of Finance/Section 1/Chapter 7/Efficient-Market Hypothesis , 8 9 Ancient History/Human Evolution/Recent African Origin , 9 9 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/General information on Science and its interface with society/Human genetic engineering , 10 9 Professional and Technical Writing/Career/Resumes , 11 8 Colonizing Outer Space/Colonization , 12 8 Managing Groups and Teams , 13 7 SQLite , 14 7 Georgian/Alphabet , 15 7 C Programming/stdlib.h/malloc , 16 6 Adventist Youth Honors Answer Book/Recreation/Snowshoeing , 17 6 The History of the Native Peoples of the Americas/Mesoamerican Cultures/Zapotecs , 18 6 History of Western Theatre: Greeks to Elizabethans , 19 6 Professional and Technical Writing , 20 5 Teach Cough Hygiene Everywhere/Epidemic , 21 5 Bards Irish Fiddle Tunebook Supplement/Whiskey in the Jar , 22 5 Introduction to Software Engineering/Tools/Continuous Integration , 23 5 Introduction to Software Engineering/Tools/Obfuscation , 24 5 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Molecular vibration , 25 5 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Fluorescence

mar 2010: 1 16 Social Research Methods/Unobtrusive Research , 2 13 Social Research Methods/Qualitative Research , 3 13 Social Research Methods/Statistical Analysis , 4 11 Principles of Finance/Section 1/Chapter 7/Efficient-Market Hypothesis , 5 11 Ancient History/Human Evolution/Recent African Origin , 6 11 Adventist Youth Honors Answer Book/Nature/Waterfalls , 7 8 Support Vector Machines , 8 8 Radioactive Waste Management/Radiation Interaction Fundamentals , 9 8 Choosing High Quality Children's Literature/Children's Book Authors/Grades K-2 Authors , 10 7 Intellectual Property and the Internet/Web search engines , 11 7 Bards Irish Fiddle Tunebook Supplement/Whiskey in the Jar , 12 7 Ethnography of Fiddle/Ethnography , 13 7 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/X-ray crystallography , 14 7 The History of the Native Peoples of the Americas/Mesoamerican Cultures/Teotihuacanos , 15 7 The History of the Native Peoples of the Americas/Mesoamerican Cultures/Zapotecs , 16 7 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/General information on Science and its interface with society/Human genetic engineering , 17 6 SQLite , 18 6 Colonizing Outer Space/Colonization , 19 6 Remembering the Templars , 20 6 Introduction to Software Engineering/Testing/Unit Tests , 21 6 Adventist Youth Honors Answer Book/Recreation/Track & Field , 22 6 Professional and Technical Writing/Basics/Revising , 23 6 Managing Groups and Teams/Groupthink , 24 6 Professional and Technical Writing/Career/Cover Letters , 25 6 Professional and Technical Writing/Career/Resumes

abr 2010: 1 15 Social Research Methods/Evaluation Research , 2 14 Social Research Methods/Reading and Writing Social Research , 3 11 Colonizing Outer Space/Colonization , 4 9 The History of the Native Peoples of the Americas/Mesoamerican Cultures/Teotihuacanos , 5 9 Information Security in Education , 6 8 Adventist Youth Honors Answer Book/Nature/Waterfalls , 7 8 Social Research Methods/Experiments , 8 8 Professional and Technical Writing/Basics/Revising , 9 8 Professional and Technical Writing/Rhetoric , 10 8 Professional and Technical Writing/Career/Resumes , 11 7 Principles of Finance/Section 1/Chapter 7/Efficient-Market Hypothesis , 12 6 SQLite , 13 6 Linguistics/Semantics , 14 6 Georgian/Alphabet , 15 6 C Programming/stdlib.h/malloc , 16 6 Bards Irish Fiddle Tunebook Supplement/Whiskey in the Jar , 17 6 Social Research Methods/Ethics , 18 6 Choosing High Quality Children's Literature/Children's Book Authors/Grades K-2 Authors , 19 6 Professional and Technical Writing/FAQ , 20 6 Professional and Technical Writing/Business Communications/Memos , 21 5 Introduction to Software Engineering/Tools/Continuous Integration , 22 5 Application Development with Harbour/Paradigms , 23 5 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Fluorescence , 24 5 Information Security in Education/Malicious Software , 25 5 Information Security in Education/Security Policies for Mobile Devices

mai 2010: 1 10 Adventist Youth Honors Answer Book/Nature/Waterfalls , 2 10 Software Tools For Molecular Microscopy , 3 9 Ancient History/Human Evolution/Recent African Origin , 4 8 Principles of Finance/Section 1/Chapter 7/Modern Portfolio Theory , 5 7 Principles of Finance/Section 1/Chapter/Financial Markets and Institutions/Interest , 6 7 Linguistics/Semantics , 7 7 Colonizing Outer Space/Colonization , 8 7 C Programming/stdlib.h/malloc , 9 7 Ethnography of Fiddle/Ethnography , 10 7 Making Neon Signs , 11 7 Adventist Youth Honors Answer Book/Recreation/Snowshoeing , 12 7 Professional and Technical Writing/Basics/Revising , 13 6 Drinking Water/Disinfection/Solar , 14 6 Georgian/Alphabet , 15 6 California Public Policy and Citizen Participation/Chapter Nine , 16 6 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/X-ray crystallography , 17 6 Chinese Stories/Jade Rabbit , 18 6 Professional and Technical Writing/Rhetoric/Author/Style , 19 6 Professional and Technical Writing/Business Communications/E-Mail , 20 6 Professional and Technical Writing/Career/Resumes , 21 6 Ancient Civilizations/Mayans , 22 5 Linguistics/Sociolinguistics , 23 5 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Spectrophotometry , 24 5 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Raman spectroscopy , 25 5 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Near-infrared spectroscopy

jun 2010: 1 22 Metabolomics/Nutrition , 2 9 Georgian/Alphabet , 3 8 Colonizing Outer Space/Colonization , 4 8 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Nuclear magnetic resonance , 5 7 Intellectual Property and the Internet/Web search engines , 6 7 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Mössbauer spectroscopy , 7 6 SQLite , 8 6 Ancient History/Human Evolution/Recent African Origin , 9 6 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Infrared spectroscopy , 10 5 Undergraduate Mathematics/Compact space , 11 5 Introduction to Software Engineering/Tools/Continuous Integration , 12 5 Introduction to Software Engineering/Process/Rapid Application Development , 13 5 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Raman spectroscopy , 14 4 Undergraduate Mathematics/Greatest common divisor , 15 4 Principles of Finance/Section 1/Chapter/Financial Markets and Institutions/Interest , 16 4 California Public Policy and Citizen Participation/Chapter Eight , 17 4 Introduction to Software Engineering/Process/Extreme Programming , 18 4 Introduction to Software Engineering/Process/Methodology , 19 4 Support Vector Machines , 20 4 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/Ultraviolet-visible spectroscopy , 21 4 The History of the Native Peoples of the Americas/Mesoamerican Cultures/Teotihuacanos , 22 4 GLPK/Python , 23 4 GLPK , 24 4 Chinese Stories/Pangu , 25 4 Mastering Sleep

jul 2010: 1 13 Intellectual Property and the Internet/Web search engines , 2 7 Adventist Youth Honors Answer Book/Nature/Waterfalls , 3 6 Undergraduate Mathematics/Continuous function , 4 6 Support Vector Machines , 5 6 LaTeX/Paragraph Formatting , 6 6 Blender 3D: Noob to Pro , 7 5 Undergraduate Mathematics/Compact space , 8 5 Linguistics/Pragmatics , 9 5 C Programming/stdlib.h/malloc , 10 4 SQLite , 11 4 Principles of Finance/Section 1/Chapter/Financial Markets and Institutions/Interest , 12 4 Principles of Finance/Section 1/Chapter 7/Efficient-Market Hypothesis , 13 4 Georgian/Alphabet , 14 4 Introduction to Software Engineering/Software Engineer , 15 4 Radioactive Waste Management/Radiation Interaction Fundamentals , 16 4 The Scientific Method/Components of the Method , 17 4 Famous Americans , 18 4 Spaghetti alla Puttanesca , 19 4 Drugs:Fact and Fiction , 20 4 Muggles' Guide to Harry Potter/Characters , 21 3 Undergraduate Mathematics/Dihedral group , 22 3 Principles of Finance/Section 1/Chapter 7/Capital Asset Pricing Model , 23 3 Ancient History/Human Evolution/Recent African Origin , 24 3 Linguistics/Semantics , 25 3 C Programming/stdio.h/gets

ago 2010: 1 12 Intellectual Property and the Internet/Web search engines , 2 8 Hydroculture/Aeration , 3 8 Support Vector Machines , 4 8 Blender 3D: Noob to Pro , 5 7 Georgian/Alphabet , 6 6 SQLite , 7 6 Principles of Finance/Section 1/Chapter 7/Modern Portfolio Theory , 8 6 Georgian/Introduction , 9 6 California Public Policy and Citizen Participation/Chapter Eight , 10 6 Intermediate Accounting/Liabilities , 11 5 Undergraduate Mathematics/Continuous function , 12 5 Ancient History/Human Evolution/Recent African Origin , 13 5 Linguistics/Semantics , 14 5 Colonizing Outer Space/Colonization , 15 5 Intermediate Accounting/Assets , 16 4 Teach Cough Hygiene Everywhere/Epidemic , 17 4 Adventist Youth Honors Answer Book/Nature/Waterfalls , 18 4 C Programming/stdio.h/remove , 19 4 Introduction to Software Engineering/Tools/Project Management , 20 4 Introduction to Software Engineering/Process/Extreme Programming , 21 4 Introduction to Software Engineering/Process/Methodology , 22 4 Computer Science Design Patterns/Strategy , 23 4 Trigonometry/For Enthusiasts/Chebyshev Polynomials , 24 4 Knots/Hitch knots/Buntline hitch , 25 4 Solar System/Test

set 2010: 1 17 Intellectual Property and the Internet/Web search engines , 2 15 Biblical Studies/New Testament Commentaries/Revelation/Chapter 5 , 3 14 Biblical Studies/New Testament Commentaries/Revelation/Chapter 3 , 4 14 Strategy for Information Markets , 5 13 Biblical Studies/New Testament Commentaries/Revelation/Chapter 6 , 6 12 Biblical Studies/New Testament Commentaries/Revelation/Chapter 4 , 7 11 Biblical Studies/New Testament Commentaries/Revelation/Chapter 8 , 8 11 Biblical Studies/New Testament Commentaries/Revelation/Chapter 2 , 9 10 Adventist Youth Honors Answer Book/Nature/Waterfalls , 10 10 Biblical Studies/New Testament Commentaries/Revelation/Chapter 7 , 11 8 Undergraduate Mathematics/Least common multiple , 12 8 Remembering the Templars , 13 7 Intercontinental Motorcycle Touring , 14 6 Ukrainian/Diaspora , 15 6 Introduction to Software Engineering/Tools/Code Coverage , 16 6 Biblical Studies/New Testament Commentaries/Revelation/Chapter 9 , 17 6 Biblical Studies/New Testament Commentaries/Revelation/Chapter 1 , 18 5 Undergraduate Mathematics/Sequence , 19 5 Undergraduate Mathematics/Homeomorphism , 20 5 Principles of Finance/Section 1/Chapter/Financial Markets and Institutions/Bond Markets , 21 5 Ancient History/Human Evolution/Recent African Origin , 22 5 Ethnography of Fiddle/Ethnography , 23 5 Introduction to Software Engineering/Tools/Continuous Integration , 24 5 Strategy for Information Markets/Piracy , 25 5 Strategy for Information Markets/Compatibility and Standards

out 2010: 1 32 Structural Biochemistry , 2 15 Engineering Acoustics , 3 13 Biblical Studies/New Testament Commentaries/Revelation/Chapter 13 , 4 12 Biblical Studies/New Testament Commentaries/Revelation/Chapter 14 , 5 11 Biblical Studies/New Testament Commentaries/Revelation/Chapter 11 , 6 10 Intellectual Property and the Internet/Web search engines , 7 10 Support Vector Machines , 8 10 Biblical Studies/New Testament Commentaries/Revelation/Chapter 12 , 9 10 Biblical Studies/New Testament Commentaries/Revelation/Chapter 10 , 10 9 Adventist Youth Honors Answer Book/Nature/Waterfalls , 11 9 Strategy for Information Markets/Piracy , 12 9 Biblical Studies/New Testament Commentaries/Revelation/Chapter 15 , 13 8 SQLite , 14 8 Structural Biochemistry/Mental Inertia in the Biological Sciences , 15 7 Undergraduate Mathematics/Least common multiple , 16 7 Human Sexuality and Gender , 17 7 Biblical Studies/New Testament Commentaries/Revelation/Chapter 9 , 18 7 Structural Biochemistry/Proteins/Amino Acids , 19 7 Strategy for Information Markets , 20 6 Georgian/Alphabet , 21 6 Introduction to Software Engineering/Quality/Metrics , 22 6 Structural Biochemistry/Translational Science , 23 6 Strategy for Information Markets/Compatibility and Standards , 24 6 Strategy for Information Markets/Dynamic Competition , 25 6 Strategy for Information Markets/Globalization

nov 2010: 1 73 Human Sexuality and Gender , 2 39 Structural Biochemistry , 3 19 Intellectual Property and the Internet/Web search engines , 4 11 Biblical Studies/New Testament Commentaries/Revelation/Chapter 19 , 5 10 Biblical Studies/New Testament Commentaries/Revelation/Chapter 18 , 6 9 Adventist Youth Honors Answer Book/Nature/Waterfalls , 7 8 Colonizing Outer Space/Colonization , 8 7 Linguistics/Semantics , 9 7 Strategy for Information Markets/Piracy , 10 7 Strategy for Information Markets/Globalization , 11 7 Lentis , 12 7 Biblical Studies/New Testament Commentaries/Revelation/Chapter 20 , 13 7 Biblical Studies/New Testament Commentaries/Revelation/Chapter 17 , 14 6 SQLite , 15 6 California Public Policy and Citizen Participation/Chapter Eight , 16 6 Introduction to Software Engineering/Software Engineer , 17 6 Lentis/Popular Hygiene: Perceptions and Practices , 18 6 Strategy for Information Markets/Dynamic Competition , 19 6 Biblical Studies/New Testament Commentaries/Revelation/Chapter 21 , 20 6 Biblical Studies/New Testament Commentaries/Revelation/Chapter 16 , 21 6 Strategy for Information Markets/Search engine business models , 22 6 Structural Biochemistry/Proteins/Protein Folding , 23 5 Writing Adolescent Fiction/Character names/Ancient Egyptian , 24 5 Principles of Finance/Section 1/Chapter 7/Modern Portfolio Theory , 25 5 Ethnography of Fiddle/Ethnography

dez 2010: 1 86 Human Sexuality and Gender , 2 29 Structural Biochemistry , 3 10 US History/War, Nationalism, and Division , 4 10 US History/Exploration , 5 9 Intellectual Property and the Internet/Web search engines , 6 9 SQLite , 7 9 US History/Reconstruction , 8 9 US History/Westward Expansion and Manifest Destiny , 9 8 Colonizing Outer Space/Colonization , 10 8 Biblical Studies/New Testament Commentaries/Revelation/Chapter 21 , 11 8 Literary Criticism/Shakespeare Our Contemporary , 12 7 Strategy for Information Markets/Globalization , 13 7 US History/Constitution Early Years , 14 7 US History/English Colonies , 15 6 Introduction to Software Engineering/Quality/Metrics , 16 6 Biblical Studies/New Testament Commentaries/Revelation/Chapter 22 , 17 6 Blender 3D: Noob to Pro , 18 6 US History/European History , 19 5 Writing Adolescent Fiction/Character names/Ancient Egyptian , 20 5 Remembering the Templars , 21 5 Fukushima Aftermath/J. Samuel Walker , 22 5 US History/Colonial Religion , 23 5 Integrating Technology In K12/Adaptive Technology , 24 5 Lentis/Probation Technology , 25 5 Lentis/The United States - Mexico Border

jan 2011: 1 15 Intellectual Property and the Internet/Web search engines , 2 14 SQLite , 3 12 Ancient History/Human Evolution/Recent African Origin , 4 9 Colonizing Outer Space/Colonization , 5 8 US History/Age of Invention and Gilded Age , 6 7 Georgian/Introduction , 7 7 Introduction to Software Engineering/Tools/Project Management , 8 6 C Programming/stdio.h/printf , 9 6 Contemporary Fiddlers/Sierra Noble , 10 6 Introduction to Software Engineering/Testing/Unit Tests , 11 6 Introduction to Software Engineering/Process/Methodology , 12 6 US History/Progressive Era , 13 5 Georgian/Alphabet , 14 5 Fukushima Aftermath: Whither the Indian Point Nuke?/Ramapo Fault , 15 5 Fukushima Aftermath/US Department of Energy , 16 5 Introduction to Software Engineering/Process/Extreme Programming , 17 5 Future/10 years into the future , 18 4 Undergraduate Mathematics/Least common multiple , 19 4 Undergraduate Mathematics/Compact space , 20 4 Ethnography of Fiddle/Ethnomusicology , 21 4 Introduction to Software Engineering/Tools/Profiling , 22 4 Introduction to Software Engineering/Testing/Profiling , 23 4 Introduction to Software Engineering/Process/Rapid Application Development , 24 4 An Introduction to Molecular Biology/Macromolecules and Cells , 25 4 Intercontinental Motorcycle Touring

fev 2011: 1 12 US History/Roaring Twenties and Prohibition , 2 11 Systems Analysis and Design/Introduction , 3 10 Intellectual Property and the Internet/Web search engines , 4 10 US History/Age of Invention and Gilded Age , 5 9 Adventist Youth Honors Answer Book/Nature/Waterfalls , 6 9 California Public Policy and Citizen Participation/Warming center , 7 8 US History/Great Depression and New Deal , 8 7 Bards Irish Fiddle Tunebook Supplement/Whiskey in the Jar , 9 6 Undergraduate Mathematics/Compact space , 10 6 Principles of Finance/Section 1/Chapter/Financial Markets and Institutions/Interest , 11 6 Georgian/Alphabet , 12 6 Contemporary Fiddlers/Sierra Noble , 13 6 Introduction to Software Engineering/Testing/Refactoring , 14 6 Introduction to Software Engineering/Architecture , 15 6 Driving/Safety/Wet weather driving , 16 6 The Maryland Entrepreneur's Guide , 17 5 SQLite , 18 5 Writing Adolescent Fiction/Character names/Ancient Egyptian , 19 5 US History/Truman and Cold War , 20 5 Undergraduate Mathematics/Least common multiple , 21 5 Ancient History/Human Evolution/Recent African Origin , 22 5 California Public Policy and Citizen Participation/Homeless Vulnerability Index , 23 5 Fukushima Aftermath/J. Samuel Walker , 24 5 Introduction to Software Engineering/Tools/Obfuscation , 25 5 Ada Programming/Libraries/Ada.Streams

mar 2011: 1 68 Diablo Canyon Nuclear Power Plant: The WikiBook/Fukushima Daini Nuclear Power Plant , 2 40 Diablo Canyon Nuclear Power Plant: The WikiBook/orphaned pages/Tokyo Electric Power Company , 3 37 Diablo Canyon Nuclear Power Plant: The WikiBook/Boiling water reactor , 4 25 Human Sexuality and Gender/Gender , 5 15 Diablo Canyon Nuclear Power Plant: The WikiBook/Chemistry/Caesium137 , 6 12 Diablo Canyon Nuclear Power Plant: The WikiBook/DCPP , 7 10 Intellectual Property and the Internet/Web search engines , 8 9 US History/Kennedy and Johnson , 9 8 California Public Policy and Citizen Participation/San Onofre , 10 8 Human Sexuality and Gender/Research , 11 7 Remembering the Templars , 12 7 Human Sexuality and Gender/STIs and HIV/AIDS , 13 6 Adventist Youth Honors Answer Book/Nature/Waterfalls , 14 6 Diablo Canyon Nuclear Power Plant: The WikiBook/Nuclear reactor core , 15 6 Diablo Canyon Nuclear Power Plant: The WikiBook/Containment building , 16 6 Professionalism/Ernest Fitzgerald and the Lockheed C-5A , 17 5 US History/Truman and Cold War , 18 5 Principles of Finance/Section 1/Chapter/Financial Markets and Institutions/Interest , 19 5 Ancient History/Human Evolution/Recent African Origin , 20 5 Linguistics/Semantics , 21 5 Georgian/Alphabet , 22 5 Strategy for Information Markets/Compatibility and Standards/Forking , 23 5 Diablo Canyon Nuclear Power Plant: The WikiBook/orphaned pages/National opinion trends shifts after Fukushima , 24 5 Fukushima Aftermath: Whither the Indian Point Nuke?/Nuclear policy in the United States , 25 5 Diablo Canyon Nuclear Power Plant: The WikiBook/Light water reactor

abr 2011: 1 15 Diablo Canyon Nuclear Power Plant: The WikiBook/orphaned pages/National opinion trends shifts after Fukushima , 2 11 Diablo Canyon Nuclear Power Plant: The WikiBook/Fukushima Daini Nuclear Power Plant , 3 10 Diablo Canyon Nuclear Power Plant: The WikiBook/DCPP , 4 9 Intellectual Property and the Internet/Web search engines , 5 8 US History/Truman and Cold War , 6 8 Diablo Canyon Nuclear Power Plant: The WikiBook/Chemistry/Caesium137 , 7 8 US History/Bush Clinton , 8 7 Diablo Canyon Nuclear Power Plant: The WikiBook/Boiling water reactor , 9 7 Diablo Canyon Nuclear Power Plant: The WikiBook/orphaned pages/Tokyo Electric Power Company , 10 7 Sociological Theory/Conflict Theory , 11 6 C Programming/stdio.h/printf , 12 6 Professionalism/Myron Mehlman and Mobil Corporation , 13 6 Professionalism/Peter Rost and Pfizer , 14 6 US History/Kennedy and Johnson , 15 5 SQLite , 16 5 Cuisine of Haiti , 17 5 Remembering the Templars , 18 5 Professionalism/Marketing of Pharmaceuticals , 19 5 Professionalism/Collapse of the TV Antenna in Missouri City, Texas , 20 5 US History/Great Depression and New Deal , 21 5 Human Physiology/The male reproductive system , 22 5 US History/Ford Carter Reagan , 23 5 European History/Renaissance Europe , 24 5 US History/Eisenhower Civil Rights Fifties , 25 4 Guide to The Lord of the Rings/Characters/Morgoth

mai 2011: 1 26 Human Sexuality and Gender/Gender , 2 21 Intellectual Property and the Internet/Web search engines , 3 10 Undergraduate Mathematics/Sequence , 4 9 Adventist Youth Honors Answer Book/Nature/Waterfalls , 5 9 Diablo Canyon Nuclear Power Plant: The WikiBook/orphaned pages/Tokyo Electric Power Company , 6 6 Ancient History/Human Evolution/Recent African Origin , 7 6 Intellectual Property and the Internet/PROTECT IP Act , 8 6 International Service Learning Study Abroad Handbook , 9 6 Human Sexuality and Gender/Developmental , 10 5 Principles of Finance/Section 1/Chapter/Financial Markets and Institutions/Interest , 11 5 Adventist Youth Honors Answer Book/Vocational/Forestry , 12 5 Castles of England/Chesire , 13 5 Diablo Canyon Nuclear Power Plant: The WikiBook/orphaned pages/National opinion trends shifts after Fukushima , 14 5 Diablo Canyon Nuclear Power Plant: The WikiBook/Chemistry/Caesium137 , 15 5 Diablo Canyon Nuclear Power Plant: The WikiBook/Fukushima Daini Nuclear Power Plant , 16 5 Diablo Canyon Nuclear Power Plant: The WikiBook/DCPP , 17 5 Game Creation with XNA/Audio Sound/Creation , 18 5 Human Sexuality and Gender/Pregnancy , 19 5 Human Sexuality and Gender/Contraception and Abortion , 20 5 Human Sexuality and Gender/STIs and HIV/AIDS , 21 5 LaTeX/Mathematics , 22 5 US History/Bush Clinton , 23 5 US History/Kennedy and Johnson , 24 5 US History/Nixon and Indochina , 25 4 Guide to The Lord of the Rings/Characters/Morgoth

jun 2011: 1 14 Intellectual Property and the Internet/Web search engines , 2 10 LaTeX/Hyperlinks , 3 8 Adventist Youth Honors Answer Book/Nature/Waterfalls , 4 6 Colonizing Outer Space/Colonization , 5 5 Principles of Finance/Section 1/Chapter/Financial Markets and Institutions/Regulation of Commercial Banks , 6 5 Principles of Finance/Section 1/Chapter 7/Efficient-Market Hypothesis , 7 5 Ancient History/Human Evolution/Recent African Origin , 8 5 Intellectual Property and the Internet/PROTECT IP Act , 9 4 Guide to The Lord of the Rings/Characters/Morgoth , 10 4 Undergraduate Mathematics/Continuous function , 11 4 Dungeons & Dragons/Monsters/Lamia , 12 4 Linguistics/Semantics , 13 4 C Programming/stdio.h/rewind , 14 4 Remembering the Templars , 15 4 Bards Bluegrass Fiddle Tunebook Supplement/Rocky Top , 16 4 R Programming/Sources , 17 4 Diablo Canyon Nuclear Power Plant: The WikiBook/orphaned pages/Mothers for Peace , 18 4 Directing Technology/Chromebook , 19 4 Game Creation with XNA/Other/Level Editors , 20 4 Game Creation with XNA/Audio Sound/Creation , 21 4 R Programming/Manage your workspace , 22 4 Tomato Firmware , 23 4 How To Become A Good Student , 24 3 Undergraduate Mathematics/Compact space , 25 3 Pinyin

jul 2011: 1 10 Georgian/Alphabet , 2 7 Ancient History/Human Evolution/Recent African Origin , 3 6 Principles of Finance/Section 1/Chapter 7/Capital Asset Pricing Model , 4 6 Linguistics/Semantics , 5 6 Colonizing Outer Space/Colonization , 6 6 Remembering the Templars , 7 5 Intellectual Property and the Internet/Web search engines , 8 5 Intellectual Property and the Internet/PROTECT IP Act , 9 5 Georgian/Introduction , 10 5 C Programming/stdlib.h/malloc , 11 5 LaTeX/Hyperlinks , 12 4 Principles of Finance/Section 1/Chapter/Financial Markets and Institutions/Commercial Banks , 13 4 C Programming/ctype.h , 14 4 C Programming/string.h/strlen , 15 4 Castles of England/Bedfordshire , 16 4 The Latin Language/Pronunciation , 17 4 IGNOU Question Paper Solutions/MCA/Semester 2 , 18 4 USMLE Step 1 Review/Biochemistry , 19 4 Biomedical Engineering Theory And Practice , 20 4 Algebra/Real Numbers , 21 4 LaTeX/Mathematics , 22 3 SQLite , 23 3 Undergraduate Mathematics/Compact space , 24 3 Principles of Finance/Section 1/Chapter 7/Modern Portfolio Theory , 25 3 C Programming/stdio.h/printf

ago 2011: 1 10 International Service Learning Study Abroad Handbook/Identity shifts , 2 8 Colonizing Outer Space/Colonization , 3 7 Intellectual Property and the Internet/Web search engines , 4 7 International Service Learning Study Abroad Handbook/Respect , 5 6 User-Generated Content in Education , 6 5 Ancient History/Human Evolution/Recent African Origin , 7 5 Linguistics/Semantics , 8 5 Georgian/Alphabet , 9 5 C Programming/wchar.h/mbrlen , 10 4 Undergraduate Mathematics/Continuous function , 11 4 Undergraduate Mathematics/Least common multiple , 12 4 User-Generated Content in Education/Podcasting in the 21st Century , 13 4 Historical Rhetorics/Plato's Relationship to Rhetoric , 14 4 Art History/Preface , 15 3 Undergraduate Mathematics/Alternating group , 16 3 Computer Science Design Patterns/Builder , 17 3 Principles of Finance/Section 1/Chapter/Financial Markets and Institutions/Interest , 18 3 Intellectual Property and the Internet/Online Copyright Infringement Liability Limitation Act , 19 3 Georgian/Introduction , 20 3 Ukrainian/Diaspora , 21 3 Adventist Youth Honors Answer Book/Nature/Waterfalls , 22 3 C Programming/stdio.h/putc , 23 3 C Programming/MS Windows Reference/alloc.h , 24 3 C Programming/C Reference/nonstandard/memccpy , 25 3 C Programming/math.h/atan

set 2011: 1 14 Intellectual Property and the Internet/Web search engines , 2 8 SQLite , 3 7 Adventist Youth Honors Answer Book/Nature/Waterfalls , 4 7 C Programming/wchar.h/mbrtowc , 5 7 C Programming/C Reference/nonstandard/mempcpy , 6 7 C Programming/wchar.h/fgetws , 7 6 Undergraduate Mathematics/Least common multiple , 8 6 C Programming/stdlib.h/malloc , 9 6 C Programming/complex.h/carg , 10 6 C Programming/wctype.h/iswdigit , 11 6 Canadian History/The People of the Lands/Haudenosaunee , 12 6 The Computer Revolution/Software , 13 5 Georgian/Alphabet , 14 5 Colonizing Outer Space/Colonization , 15 5 C Programming/math.h/sqrt , 16 5 C Programming/wchar.h , 17 5 C Programming/time.h/localtime , 18 5 C Programming/stdio.h/fgetpos , 19 5 C Programming/POSIX Reference/sys/mman.h/mprotect , 20 5 C Programming/math.h/labs , 21 5 C Programming/wchar.h/wcsncmp , 22 5 C Programming/wchar.h/mbrlen , 23 5 Exercise as it relates to Disease , 24 5 LaTeX/Paragraph Formatting , 25 4 Java Programming/Java Native Interface

out 2011: 1 43 Exercise as it relates to Disease , 2 26 Structural Biochemistry , 3 14 Transportation Deployment Casebook , 4 11 Intellectual Property and the Internet/PROTECT IP Act , 5 8 C Programming/stdio.h , 6 8 C Programming/complex.h/carg , 7 8 Lentis , 8 7 Adventist Youth Honors Answer Book/Vocational/Forestry , 9 7 C Programming/string.h , 10 7 Structural Biochemistry/Proteins/Protein Folding , 11 6 Intellectual Property and the Internet/Web search engines , 12 6 Undergraduate Mathematics/Least common multiple , 13 6 Undergraduate Mathematics/Intermediate value theorem , 14 6 Principles of Finance/Section 1/Chapter 7/Modern Portfolio Theory , 15 6 Adventist Youth Honors Answer Book/Nature/Waterfalls , 16 6 C Programming/wchar.h , 17 6 C Programming/string.h/strcspn , 18 6 C Programming/stdlib.h/malloc , 19 6 C Programming/math.h/acos , 20 5 Undergraduate Mathematics/Continuous function , 21 5 Principles of Finance/Section 1/Chapter 7/Capital Asset Pricing Model , 22 5 Color Models: RGB, HSV, HSL , 23 5 C Programming/C Reference/nonstandard/strncasecmp , 24 5 C Programming/C Reference/nonstandard/strcasecmp , 25 5 C Programming/inttypes.h

nov 2011: 1 49 Structural Biochemistry , 2 39 Intellectual Property and the Internet/SOPA , 3 27 Lentis , 4 26 History of Hawaii/Further Reading , 5 23 Intellectual Property and the Internet/PROTECT IP Act , 6 21 History of Hawaii/World War II and Statehood , 7 16 History of Hawaii/Missionaries Sugar Immigration , 8 15 History of Hawaii/Hawaii in Popular Culture , 9 15 History of Hawaii/End of Independence , 10 13 History of Hawaii/Territorial Years , 11 9 Intellectual Property and the Internet/Web search engines , 12 9 History of Hawaii/Early Independence , 13 7 Adventist Youth Honors Answer Book/Nature/Waterfalls , 14 6 Lentis/Portrayal of Women in Video Games , 15 6 Lentis/Mass Collaboration , 16 6 Lentis/Malaria and Mosquito Nets , 17 5 Undergraduate Mathematics/Continuous function , 18 5 Lentis/Nanotechnology and Health , 19 5 Open Metadata Handbook/Recommendations , 20 5 Open Metadata Handbook/Metadata Standards , 21 5 Lentis/Dissociative Identity Disorder (Multiple Personality Disorder) , 22 5 Structural Biochemistry/Drug Resistance , 23 5 Structural Biochemistry/Cell Signaling Pathways/Nervous System , 24 5 Structural Biochemistry/Membrane Proteins , 25 5 Structural Biochemistry/Cell Organelles/Mitochondria

dez 2011: 1 34 Roman Culture , 2 26 Structural Biochemistry , 3 14 Intellectual Property and the Internet/PROTECT IP Act , 4 12 Intellectual Property and the Internet/Web search engines , 5 8 TripleA , 6 7 Feminism/Literature/The Second Sex , 7 7 Intellectual Property and the Internet/OPEN Act , 8 7 Structural Biochemistry/Hemoglobin , 9 6 Rhetoric and Writing in the Public Sphere: An Introduction/Technology and the Public Sphere , 10 6 Lentis/Playing Games at Work: Employees versus Employers, Surveillance and Stealth , 11 6 Lentis/Malaria and Mosquito Nets , 12 5 Georgian/Alphabet , 13 5 Georgian/Introduction , 14 5 Rhetoric and Writing in the Public Sphere: An Introduction/The Media and the Public Sphere , 15 5 Roman Culture/Octavian's Civil War , 16 5 Roman Culture/Early Republic , 17 5 Roman Culture/Coinage , 18 5 Roman Culture/Dining , 19 5 Lentis/Bicycling in the Netherlands , 20 5 Lentis/Where It Goes: Electronic Waste and Salvage , 21 5 The Devonshire Manuscript , 22 5 Sport Innovation , 23 5 Lentis/Cell Phones in Prison , 24 5 Lentis , 25 5 Structural Biochemistry/Enzyme

jan 2012: 1 24 Intellectual Property and the Internet/PROTECT IP Act , 2 21 Strategy for Information Markets , 3 12 Intellectual Property and the Internet/Web search engines , 4 6 SQLite , 5 5 Ancient History/Human Evolution/Recent African Origin , 6 5 A-level Computing 2009/AQA/Java , 7 5 Software Engineers Handbook/Language Dictionary/Qi , 8 5 Intellectual Property and the Internet/OPEN Act , 9 5 Mathematics with Python and Ruby , 10 5 The Devonshire Manuscript , 11 5 Colonizing Outer Space/Colonization/Space/Generalities/Celestial Bodies , 12 4 Intellectual Property and the Internet/Chilling effect , 13 4 Principles of Finance/Section 1/Chapter 7/Capital Asset Pricing Model , 14 4 Pixlr Editor , 15 4 Strategy for Information Markets/Globalization , 16 4 Hawaiian , 17 4 Ancient History/Human Evolution/Neolithic Age , 18 4 LaTeX/Bibliography Management , 19 4 Blender 3D: Noob to Pro/Tutorial Links List , 20 4 US History/English Colonies , 21 3 US History/Truman and Cold War , 22 3 Undergraduate Mathematics/Sequence , 23 3 Drinking Water/Scarcity/Australia , 24 3 Linguistics/Semantics , 25 3 A-level Computing 2009/AQA/Python

fev 2012: 1 14 Intellectual Property and the Internet/Web search engines , 2 13 The Computer Revolution , 3 10 The Computer Revolution/Software/OS , 4 9 Undergraduate Mathematics/Projectile motion , 5 9 The Computer Revolution/Hardware/Storage , 6 8 The Computer Revolution/System Software , 7 7 Open Metadata Handbook/Technical Overview , 8 7 Professionalism , 9 7 The Computer Revolution/Peripherals/Printers , 10 6 Cuisine of Haiti , 11 6 The Computer Revolution/Software/Software Licenses , 12 6 The Computer Revolution/Software , 13 5 Sport Innovation/AFL Bid , 14 5 The Devonshire Manuscript , 15 5 The Computer Revolution/Graphics Software , 16 5 The Computer Revolution/Software/Word processing , 17 4 L. Ron Hubbard/Early life , 18 4 Undergraduate Mathematics/Sequence , 19 4 Principles of Finance/Section 1/Chapter 7/Modern Portfolio Theory , 20 4 The Computer Revolution/Hardware/RAID , 21 4 The Devonshire Manuscript/At last withdrawe yowre cruellte , 22 4 The Devonshire Manuscript/I lowe lovyd and so doithe she , 23 4 The Devonshire Manuscript/My harte I gave the not to do it paine , 24 4 The Devonshire Manuscript/O cruell causer of vndeserrved chaynge , 25 4 The Devonshire Manuscript/To wette yowr Iye withouten teare

mar 2012: 1 16 Professionalism , 2 9 The Computer Revolution , 3 8 Intellectual Property and the Internet/Web search engines , 4 7 The Computer Revolution/E commerce/Web Site Design , 5 6 Web Development/Creating a phpBB3 Forum , 6 6 Native American Cuisine , 7 5 TPACKing for a Wonderful Educational Trip , 8 4 Undergraduate Mathematics/Sequence , 9 4 The Computer Revolution/E commerce/Flowchart , 10 4 The Computer Revolution/E commerce/M-commerce , 11 4 Ancient History/Human Evolution/Recent African Origin , 12 4 TPACKing for a Wonderful Educational Trip/Group 3 , 13 4 TPACKing for a Wonderful Educational Trip/Group 2 , 14 4 The Computer Revolution/Security/Cyber Bullying , 15 4 The Computer Revolution/E commerce/PayPal , 16 4 Fractals/Iterations in the complex plane/q-iterations , 17 4 Australian History/1960s , 18 4 The Computer Revolution/E commerce/Benefits , 19 4 Open Source Handbook of Nursing , 20 3 Writing Adolescent Fiction/Character names/Manchu , 21 3 Drinking Water/Distillation , 22 3 Remembering the Templars/Age , 23 3 Teach Cough Hygiene Everywhere/Epidemic , 24 3 Professionalism/David Lewis and EPA , 25 3 Geography of France/The French Antilles and French Guiana

abr 2012: 1 13 The Computer Revolution , 2 9 Intellectual Property and the Internet/Web search engines , 3 8 The Computer Revolution/Communication/Computers and Health , 4 7 The Computer Revolution/Programming/Programming Languages Used Today , 5 6 The Computer Revolution/Digital Counterfeiting , 6 6 Knowledge Management Cases in a University in Asia/Group 1 , 7 6 Strategy for Information Markets/Monopoly , 8 6 Strategy for Information Markets , 9 5 Principles of Finance/Section 1/Chapter/Financial Markets and Institutions/Interest , 10 5 Strategy for Information Markets/e-Commerce , 11 5 Knowledge Management Cases in a University in Asia/Group 4 , 12 5 Knowledge Management Cases in a University in Asia/Group 2 , 13 5 Ancient History/Human Evolution/Recent African Origin , 14 5 Professionalism/Using Animals in Research , 15 5 Strategy for Information Markets/Cost Structure , 16 5 Strategy for Information Markets/Compatibility and Standards , 17 5 Strategy for Information Markets/Network Externalities/Expectations Management , 18 5 Strategy for Information Markets/Search engine business models , 19 5 The Computer Revolution/Software/Database , 20 5 LaTeX , 21 4 Drinking Water/Scarcity/Africa , 22 4 Drinking Water/Scarcity , 23 4 How To Succeed in College/Financial Aid , 24 4 The Computer Revolution/Security/Surveillance Systems , 25 4 Knowledge Management Cases in a University in Asia/Group 3

mai 2012: 1 13 Intellectual Property and the Internet/Web search engines , 2 7 Rhetoric and Writing in the Public Sphere: An Introduction/The Media and the Public Sphere , 3 6 Strategy for Information Markets/Monopoly , 4 5 SQLite , 5 5 Undergraduate Mathematics/Stokes' theorem , 6 5 Introduction to Programming Languages , 7 5 Professionalism/David Lewis and EPA , 8 5 Ancient History/Human Evolution/Recent African Origin , 9 5 Professionalism/Joe Paterno and the Penn State Board of Trustees , 10 5 Strategy for Information Markets/Non-IP approaches to innovation , 11 5 Bestiary of Behavioral Economics , 12 4 Drinking Water/Distillation , 13 4 Drinking Water/Scarcity/Africa , 14 4 Principles of Finance/Section 1/Chapter/Financial Markets and Institutions/Money Markets , 15 4 Professionalism/Roger Boisjoly, Morton Thiokol, and NASA , 16 4 Professionalism/Rodney Rocha and Columbia , 17 4 Professionalism/URS and the I-35 Bridge , 18 4 Professionalism/Therac-25 , 19 4 Professionalism/Office Ethics according to The Office , 20 4 Strategy for Information Markets/Micropayments , 21 4 Aros/Platforms/x86 Complete System HCL , 22 4 Strategy for Information Markets/Network Neutrality , 23 4 Strategy for Information Markets , 24 3 Undergraduate Mathematics/Sequence , 25 3 Principles of Finance/Section 1/Chapter/Financial Markets and Institutions/Commercial Banks

jun 2012: 1 9 Intellectual Property and the Internet/Web search engines , 2 7 Principles of Finance/Section 1/Chapter/Financial Markets and Institutions/Money Markets , 3 7 Sport Innovation , 4 4 Undergraduate Mathematics/Projectile motion , 5 4 High School Mathematics Extensions/Discrete Probability , 6 3 Undergraduate Mathematics/Continuous function , 7 3 Java Programming/Java Native Interface , 8 3 Drinking Water/Scarcity , 9 3 Principles of Finance/Section 1/Chapter/Financial Markets and Institutions/Regulation of Commercial Banks , 10 3 Principles of Finance/Section 1/Chapter 7/Port/Arbitrage pricing theory , 11 3 Dungeons & Dragons/Monsters/Lamia , 12 3 Dungeons & Dragons/Monsters/Ascomoid , 13 3 Bridge/Glossary , 14 3 ROSE Compiler Framework/Code Review , 15 3 Sport Innovation/Power Plate® powerBIKE™ , 16 3 PlanoTse Handbook for Job Search Automation/Web Search Scripting Language , 17 3 Android/Testing/Unit Testing/Injecting Static Methods , 18 3 SI521 \"Open Educational Resources at the University of Michigan\" Open Textbook/Glossary , 19 3 SI521 \"Open Educational Resources at the University of Michigan\" Open Textbook/OpenHealth , 20 3 SI521 \"Open Educational Resources at the University of Michigan\" Open Textbook/Class Materials , 21 3 Traditional Chinese Medicine/Chinese Medical Terms , 22 3 PlanoTse Handbook for Job Search Automation/PlanoTseScript Language Reference , 23 3 Wisdom in wiki production , 24 3 Social Web/Collaboration , 25 3 The Devonshire Manuscript/Who hath more cawse for to complayne

jul 2012: 1 10 Intellectual Property and the Internet/Web search engines , 2 7 Dungeons & Dragons/Monsters/Lamia , 3 6 Dungeons & Dragons/Monsters/Death watch beetle , 4 6 Dungeons & Dragons/Monsters/Crabman , 5 6 Dungeons & Dragons/Monsters/Cooshee , 6 6 Dungeons & Dragons/Monsters/Cave fisher , 7 6 Dungeons & Dragons/Monsters/Brownie , 8 6 Dungeons & Dragons/Monsters/Algoid , 9 6 Dungeons & Dragons/Monsters/Al-mi'raj , 10 6 Dungeons & Dragons/Monsters/Adherer , 11 5 Dungeons & Dragons/Monsters/Axe beak , 12 5 Dungeons & Dragons/Monsters/Ki-rin , 13 5 Dungeons & Dragons/Monsters/Slicer beetle , 14 5 Dungeons & Dragons/Monsters/Crypt thing , 15 5 Dungeons & Dragons/Monsters/Coffer corpse , 16 5 Dungeons & Dragons/Monsters/Cave cricket , 17 5 Dungeons & Dragons/Monsters/Caterwaul , 18 5 Dungeons & Dragons/Monsters/Caryatid column , 19 5 Dungeons & Dragons/Monsters/Bunyip , 20 5 Dungeons & Dragons/Monsters/Buckawn , 21 5 Dungeons & Dragons/Monsters/Bonesnapper , 22 5 Dungeons & Dragons/Monsters/Blindheim , 23 5 Dungeons & Dragons/Monsters/Basidirond , 24 5 Dungeons & Dragons/Monsters/Aurumvorax , 25 5 Dungeons & Dragons/Monsters/Atomie

ago 2012: 1 8 Intellectual Property and the Internet/Web search engines , 2 7 Undergraduate Mathematics/Least common multiple , 3 7 Principles of Finance/Section 1/Chapter 7/Modern Portfolio Theory , 4 6 Principles of Finance/Section 1/Chapter/Financial Markets and Institutions/Interest , 5 5 Principles of Finance/Section 1/Chapter 7/Capital Asset Pricing Model , 6 5 InteriCAD T6 User Manual , 7 5 Australian History/1920s , 8 4 Undergraduate Mathematics/Cyclic group , 9 4 Guitar/Different Types of Guitars , 10 3 Undergraduate Mathematics/Differentiable function , 11 3 Undergraduate Mathematics/Homotopy , 12 3 Undergraduate Mathematics/Sequence , 13 3 Computer Science Design Patterns/Abstract Factory , 14 3 Computer Science Design Patterns/Builder , 15 3 Hydroculture/Physiology/Rhizosphere , 16 3 Vegan and vegetarian phrases/Finnish , 17 3 Vegan and vegetarian phrases , 18 3 Principles of Finance/Section 1/Chapter/Financial Markets and Institutions/Federal Reserve , 19 3 Australian Contract Law/The Right to Terminate , 20 3 Ancient Civilizations/Australia , 21 3 Chemistry Friends/Matter , 22 3 ROSE Compiler Framework/Coding Standard , 23 3 ROSE Compiler Framework/How to add a new project directory , 24 3 ROSE Compiler Framework/Program Analysis , 25 3 LaTeX/List Structures

set 2012: 1 16 Exercise as it relates to Disease , 2 7 Intellectual Property and the Internet/Web search engines , 3 7 Lentis , 4 6 Choral Techniques and Literature for the Real World , 5 6 The Computer Revolution , 6 4 SQLite , 7 4 Undergraduate Mathematics/Sequence , 8 4 Transportation Planning Casebook/Twin Cities Bike Networks , 9 4 Next Generation Sequencing (NGS)/Bioinformatics from the outside , 10 4 Traditional Chinese Medicine/Prescriptions , 11 4 OpenGL Programming , 12 3 Undergraduate Mathematics/Continuous function , 13 3 Undergraduate Mathematics/Least common multiple , 14 3 Undergraduate Mathematics/Squeeze theorem , 15 3 The Computer Revolution/Hardware/Motherboard , 16 3 Next Generation Sequencing (NGS)/Introduction , 17 3 Next Generation Sequencing (NGS) , 18 3 Traditional Chinese Medicine/Usage Of Prescriptions , 19 3 Traditional Chinese Medicine/Usage Of Single Herbs , 20 3 Transportation Planning Casebook/Northeast Corridor High speed Train , 21 3 Exercise as it relates to Disease/Exercise and sudden cardiac death , 22 3 Sensory Systems/NonPrimates , 23 3 Traditional Chinese Medicine/Single Herbs , 24 3 Sensory Systems/Computer Models/Auditory System Simulation , 25 3 The Computer Revolution/Peripherals/Pens/Styluses

out 2012: 1 50 Structural Biochemistry , 2 34 Exercise as it relates to Disease , 3 25 Field Guide/Mammals/Glossary , 4 10 Structural Biochemistry/Cell Signaling Pathways/Phagoptosis , 5 9 The Computer Revolution , 6 6 Field Guide/Mammals/United States/Minnesota , 7 6 Structural Biochemistry/Cell Aging , 8 6 Structural Biochemistry/Nucleic Acid/Biology of Cancer , 9 6 Structural Biochemistry/Three Domains of Life/Bacteria , 10 5 Intellectual Property and the Internet/Web search engines , 11 5 Structural Biochemistry/Cell Organelles/Plant Cell/Heat Stress Response , 12 5 Transportation Planning Casebook/Stockholm Cordon Tolls , 13 5 Next Generation Sequencing (NGS)/Authors , 14 5 Trends and Innovations for K-12 Ed Tech Leaders , 15 5 Exercise as it relates to Disease/Benefit of Exercise During Androgen Deprivation Therapy for Prostate Cancer , 16 5 The Computer Revolution/E commerce/Types of E-Commerce Web Sites , 17 5 Structural Biochemistry/Chemical Bonding/ Disulfide bonds , 18 5 Structural Biochemistry/Proteins/Protein Folding , 19 5 Structural Biochemistry/Chemical Bonding/Hydrogen bonds , 20 4 Writing Adolescent Fiction/Character names/Ancient Egyptian , 21 4 Undergraduate Mathematics/Least common multiple , 22 4 Structural Biochemistry/Properties of Living Organisms , 23 4 Structural Biochemistry/Eye Drop , 24 4 Lentis/Fracking , 25 4 WifiLapper/Speeding up Connection Times

nov 2012: 1 90 Structural Biochemistry , 2 35 History of Wyoming/Further Reading , 3 20 History of Wyoming/Wyoming since 1945 , 4 19 History of Wyoming/Wyoming in Popular Culture, 1868-present , 5 17 History of Wyoming/Modern Wyoming, 1890-1945 , 6 17 History of Wyoming/Territorial Days: Railways, Suffrage and Cattle, 1868-1890 , 7 16 History of Wyoming/Native American \"Wyoming\" to 1868 , 8 14 Transportation Deployment Casebook , 9 12 Lentis , 10 10 Intellectual Property and the Internet/Web search engines , 11 9 History of Wyoming/Introduction , 12 8 History of Wyoming/Yellowstone National Park, 1872 to present , 13 7 Structural Biochemistry/Cell Organelles/Mitochondria , 14 6 Structural Biochemistry/Cell Organelles/Ribosome , 15 6 The Computer Revolution , 16 5 Undergraduate Mathematics/Least common multiple , 17 5 Dovga , 18 5 Structural Biochemistry/Electronegativity , 19 5 Structural Biochemistry/Tylenol , 20 5 Parallel Spectral Numerical Methods , 21 5 Trends and Innovations for K-12 Ed Tech Leaders , 22 5 Structural Biochemistry/Proteins/Protein Folding , 23 4 SQLite , 24 4 Undergraduate Mathematics/Projectile motion , 25 4 Structural Biochemistry/Metallic Behavior

dez 2012: 1 92 Structural Biochemistry , 2 18 Lentis , 3 10 Intellectual Property and the Internet/Web search engines , 4 6 Structural Biochemistry/Diabetes , 5 6 Lentis/Local Food as a Social Movement , 6 6 Choral Techniques and Literature for the Real World , 7 6 Rhetoric and Writing in the Public Sphere: An Introduction/The Media and the Public Sphere , 8 5 Undergraduate Mathematics/Stokes' theorem , 9 5 Fundamentals of Human Nutrition , 10 5 Structural Biochemistry/Antibiotics , 11 5 Lentis/The Singularity , 12 5 Structural Biochemistry/Stem Cells , 13 4 Undergraduate Mathematics/Sequence , 14 4 Lentis/American Automobility and the Car Counter-Culture , 15 4 Lentis/Compulsive Connectivity , 16 4 Lentis/The D.A.R.E. Program , 17 4 Lentis/The Impact of Fans on Technological Innovation in the NFL , 18 4 Structural Biochemistry/Vitamin C , 19 4 Lentis/Online Dating Scams , 20 4 Lentis/Tata Nano and Mobility in India , 21 4 Rhetoric and Writing in the Public Sphere: An Introduction/Technology and the Public Sphere , 22 4 Lentis/Intellectual Property in the Internet Age , 23 4 Lentis/Harmonious Society: Internet Censorship in China , 24 4 Lentis/Conversion to the Metric Standard in the United States , 25 4 Structural Biochemistry/Proteins/Amino Acids

jan 2013: 1 13 Intellectual Property and the Internet/Web search engines , 2 6 Equine Nutrition/Digestive anatomy and physiology , 3 4 Undergraduate Mathematics/Least common multiple , 4 4 Big Cats/Tigards , 5 4 Breaking the Mold: An Educational Perspective on Diffusion of Innovation/Contributors' Biographies , 6 4 JavaScript , 7 4 United States Government/The Three Branches , 8 3 Equine Nutrition/Feed chemistry , 9 3 Equine Nutrition/Introduction to equine nutrition , 10 3 Passover Haggadah/Kadesh , 11 3 Big Cats/Marozi , 12 3 Feng Shui , 13 3 I Ching , 14 3 Fundamentals of Human Nutrition/Introduction to Nutrition , 15 3 Fundamentals of Human Nutrition , 16 3 Breaking the Mold: An Educational Perspective on Diffusion of Innovation , 17 3 Java Programming/Java IDEs , 18 3 LaTeX/Fonts , 19 3 JavaScript/Functions , 20 3 LaTeX/Installing Extra Packages , 21 3 LaTeX/Mathematics , 22 3 Blended Learning in K-12 , 23 3 AutoCAD , 24 2 Constitution of India/Miscellaneous , 25 2 Guide to The Lord of the Rings/Characters/Morgoth

fev 2013: 1 6 Intellectual Property and the Internet/Web search engines , 2 5 Intellectual Property and the Internet/Chilling effect , 3 5 SQLite , 4 5 Undergraduate Mathematics/Dihedral group , 5 5 Sport Innovation , 6 4 Undergraduate Mathematics/Free body diagram , 7 4 Java Programming/Java Native Interface , 8 4 Equine Nutrition/Digestive anatomy and physiology , 9 4 Fundamentals of Human Nutrition/Vitamin A , 10 4 Fundamentals of Human Nutrition/Defining Nutrition , 11 3 Guide to The Lord of the Rings/Characters/Morgoth , 12 3 Undergraduate Mathematics/Cyclic group , 13 3 Undergraduate Mathematics/Abelian group , 14 3 Undergraduate Mathematics/Homotopy , 15 3 Computer Science Design Patterns/Abstract Factory , 16 3 Classic Alphabet Coloring Book/B , 17 3 Feng Shui/Xuan Kong Da Gua , 18 3 Skateboard Alphabet Coloring Pages/8 , 19 3 Skateboard Alphabet Coloring Pages/7 , 20 3 Skateboard Alphabet Coloring Pages/6 , 21 3 Skateboard Alphabet Coloring Pages/5 , 22 3 Skateboard Alphabet Coloring Pages/4 , 23 3 Skateboard Alphabet Coloring Pages/3 , 24 3 Skateboard Alphabet Coloring Pages/2 , 25 3 Skateboard Alphabet Coloring Pages/1

mar 2013: 1 13 A-level Computing 2009/AQA/Problem Solving, Programming, Data Representation and Practical Exercise/Skeleton code/2013 Exam/Section D , 2 11 Intellectual Property and the Internet/Web search engines , 3 7 Writing Adolescent Fiction/Character names/Ancient Egyptian , 4 7 Professionalism , 5 5 Undergraduate Mathematics/Least common multiple , 6 5 Fundamentals of Human Nutrition/Functions , 7 4 Professionalism/Typhoid Mary , 8 4 Feng Shui/Xuan Kong Da Gua , 9 4 Fundamentals of Human Nutrition/Glucose , 10 4 Next Generation Sequencing (NGS)/Pre-processing , 11 4 The Computer Revolution , 12 3 Intellectual Property and the Internet/Chilling effect , 13 3 Dum Aloo , 14 3 Elementary Spanish/Meeting people , 15 3 Quality and Safety in Nursing/Clinical Microsystems , 16 3 The Computer Revolution/Business Models in a Nutshell , 17 3 GNU Health/Intensive Care Unit , 18 3 Circuit Theory/1Initially Excited , 19 3 Quality and Safety in Nursing/Team Development , 20 3 Rope Making for Bondage Use/Questions , 21 3 The Troubles (Northern Ireland)/Background , 22 3 Sport Innovation/Tough Enough to Wear Pink , 23 3 A-level Computing 2009/AQA/Problem Solving, Programming, Data Representation and Practical Exercise/Skeleton code/2013 Exam , 24 3 Professionalism/The Guatemala Syphilis Experiment , 25 3 Dao De Jing

abr 2013: 1 12 Intellectual Property and the Internet/Web search engines , 2 11 Professionalism , 3 8 Pig's Trotters and Ginger Vinegar Stew , 4 7 Porting Open Source to OpenVMS , 5 7 A-level Computing 2009/AQA/Problem Solving, Programming, Data Representation and Practical Exercise/Skeleton code/2013 Exam/Section D , 6 6 SQLite , 7 5 Brazilian Feijoada , 8 5 Rhetoric and Writing in the Public Sphere: An Introduction/Chapter 10: Politics and the Public Sphere , 9 5 Basic Physics of Digital Radiography/The Image Receptor , 10 4 Mentor teacher/Active listening , 11 4 A reference guide to the spelling of Australian Aboriginal languages in early sources , 12 4 Rhetoric and Writing in the Public Sphere: An Introduction/The Media and the Public Sphere , 13 4 Non-Programmer's Tutorial for Python 3/Decisions , 14 4 How to Solve the Rubik's Cube , 15 3 Guide to The Lord of the Rings/Characters/Morgoth , 16 3 Writing Adolescent Fiction/Character names/Ancient Egyptian , 17 3 Computer Science Design Patterns/Builder , 18 3 Professionalism/Ladbroke Grove Rail Collision , 19 3 Xomega Framework for building multi-tier ASP.NET, WPF or Silverlight applications , 20 3 Professionalism/Mectizan Donation Program , 21 3 Elementary Spanish/Meeting people/Lesson 3 , 22 3 Professionalism/The Aviation Safety Reporting System , 23 3 Professionalism/Oscar Pistorius and the Rise of the Iron Man Era , 24 3 Professionalism/Typhoid Mary , 25 3 Professionalism/The Guatemala Syphilis Experiment

mai 2013: 1 11 Professionalism , 2 10 Intellectual Property and the Internet/Web search engines , 3 9 Descriptive Geometry , 4 8 Descriptive Geometry/Shades & Shadows , 5 7 Intellectual Property and the Internet/Chilling effect , 6 7 Descriptive Geometry/Complex Solid Intersections , 7 7 Descriptive Geometry/Piercing Points , 8 5 Professionalism/Chelsea Manning: Integrity Vs. Professionalism , 9 5 Undergraduate Mathematics/Continuous function , 10 5 Descriptive Geometry/Cone Loci , 11 5 Descriptive Geometry/Understanding Views , 12 4 Undergraduate Mathematics/Least common multiple , 13 4 Professionalism/Boston's Big Dig Project , 14 4 Professionalism/Michael Woodford and Olympus , 15 4 Professionalism/Lou van den Dries, George Orwell, and Mandatory Ethics Training , 16 4 Skateboard Alphabet Coloring Pages , 17 4 Next Generation Sequencing (NGS)/Alignment , 18 4 Adventist Adventurer Awards/Animal Homes , 19 4 LaTeX/Tables , 20 3 Chinese cuisine/Cantonese cuisine/Buddha's delight , 21 3 IB Chemistry/Environmental Chemistry , 22 3 Applied Robotics , 23 3 ATRIAS 2.1 Handbook , 24 3 Professionalism/Julia Davis and the Department of Homeland Security , 25 3 Professionalism/Kit Foshee and Beef Product Incorporated

jun 2013: 1 12 Intellectual Property and the Internet/Web search engines , 2 4 How To Assemble A Desktop PC/Choosing the parts , 3 4 Solar System/Jupiter , 4 3 SQLite , 5 3 Flora of New York , 6 3 Adventist Adventurer Awards/Birds , 7 3 User-Generated Content in Education/Wikis in Education , 8 3 User-Generated Content in Education/Blogs , 9 3 OpenSCAD User Manual , 10 3 How Wikipedia Works , 11 3 Adventist Youth Honors Answer Book/Outreach/Christian Grooming & Manners , 12 3 Australian History/1920s , 13 3 LaTeX/Floats, Figures and Captions , 14 3 LaTeX/Bibliography Management , 15 3 Old English/Adjectives , 16 3 Old English/Pronouns , 17 3 AutoCAD , 18 3 Solar System/Introduction , 19 3 High School Mathematics Extensions/Discrete Probability , 20 3 Big Cats/Cheetah , 21 3 Solar System/Venus , 22 3 Solar System , 23 3 European History/European Imperialism and Nationalism , 24 3 JavaScript , 25 2 Dum Aloo

jul 2013: 1 12 Intellectual Property and the Internet/Web search engines , 2 4 Rock Climbing/Technique , 3 3 RAC Attack - Oracle Cluster Database at Home/RAC Attack 12c/Prepare Linux for Oracle , 4 3 RAC Attack - Oracle Cluster Database at Home/RAC Attack 12c/Install VirtualBox Addons , 5 3 RAC Attack - Oracle Cluster Database at Home/RAC Attack 12c/Linux Post Installation With Internet , 6 3 RAC Attack - Oracle Cluster Database at Home/RAC Attack 12c/OS Installation , 7 3 RAC Attack - Oracle Cluster Database at Home/VirtualBox Windoze/Create VM , 8 2 Intellectual Property and the Internet/Chilling effect , 9 2 Writing Adolescent Fiction/Character names/Celtic , 10 2 Undergraduate Mathematics/Cyclic group , 11 2 Undergraduate Mathematics/Proof by infinite descent , 12 2 RAC Attack - Oracle Cluster Database at Home/RAC Attack 12c/Configure Bind DNS , 13 2 RAC Attack - Oracle Cluster Database at Home/RAC Attack 12c/VirtualBox VM CDROM , 14 2 RAC Attack - Oracle Cluster Database at Home/RAC Attack 12c/VirtualBox VM Settings , 15 2 RAC Attack - Oracle Cluster Database at Home/RAC Attack 12c/Create VirtualBox VM , 16 2 RAC Attack - Oracle Cluster Database at Home/RAC Attack 12c/Hardware Requirements , 17 2 RAC Attack - Oracle Cluster Database at Home/RAC Attack 12c/Install Linux , 18 2 Lua Programming Tutorial , 19 2 How Wikipedia Works/Chapter 15 , 20 2 How Wikipedia Works/Chapter 11 , 21 2 How Wikipedia Works/Chapter 10 , 22 2 How Wikipedia Works/Chapter 9 , 23 2 Mentor teacher/Induction of beginning teachers in Ontario , 24 2 RAC Attack - Oracle Cluster Database at Home/Team , 25 2 Mentor teacher/Induction of beginning teachers in Toronto

ago 2013: 1 7 Australian History/1960s , 2 4 Intellectual Property and the Internet/Web search engines , 3 4 Undergraduate Mathematics/Continuous function , 4 4 Grsecurity/Configuring and Installing grsecurity , 5 4 Muggles' Guide to Harry Potter/Characters/Harry Potter , 6 3 C Programming/Side effects and sequence points , 7 3 Development Cooperation Handbook/Stories/Millennium Village Project , 8 3 RAC Attack - Oracle Cluster Database at Home/Events , 9 3 Sensory Systems/Authors , 10 3 Web Development/Creating a phpBB3 Forum , 11 3 LaTeX/Fonts , 12 3 LaTeX/Colors , 13 3 LaTeX/Tables , 14 3 Scouting/BSA/Citizenship in the Nation Merit Badge , 15 2 SQLite , 16 2 Fractals/Conformal map , 17 2 Undergraduate Mathematics/Homotopy , 18 2 Cuisine of Democratic Republic of the Congo , 19 2 Biological Physics/How work, pressure, and volume are related , 20 2 Healthy eating habits/Leigh's help , 21 2 The Geology of Indonesia/Stratigraphy/Paleozoic , 22 2 Computer Science Design Patterns/Object Pool , 23 2 World at Work/Miller , 24 2 RAC Attack - Oracle Cluster Database at Home/RAC Attack 12c/Create Database , 25 2 Adventist Investiture Achievement Awards/Friend/Making Friends

set 2013: 1 20 Exercise as it relates to Disease , 2 15 Introduction to Computer Information Systems/The System Unit , 3 14 Introduction to Computer Information Systems/Input and Output , 4 14 Introduction to Computer Information Systems/Storage , 5 13 Intellectual Property and the Internet/Web search engines , 6 6 Citizen Science , 7 5 Biological Physics/Charles' Law , 8 5 Biological Physics/How work, pressure, and volume are related , 9 4 Transportation Planning Casebook/St. Paul Streetcars vs. Arterial BRT , 10 4 Introduction to Computer Information Systems/Computer Networks and the Internet , 11 4 Introduction to Computer Information Systems/Computers to Fit Every Need , 12 4 Introduction to Computer Information Systems/Computers in Your Life , 13 4 Introduction to Computer Information Systems/Computers and Society , 14 4 Introduction to Computer Information Systems/What is a Computer? , 15 4 RAC Attack - Oracle Cluster Database at Home/RAC Attack 12c/Configure Bind DNS , 16 3 SQLite , 17 3 Citizen Science/Communicating Citizen Science , 18 3 Biological Physics/Probability, Entropy, & the Second Law , 19 3 Elementary English , 20 3 Biological Physics/Boyles Law , 21 3 RAC Attack - Oracle Cluster Database at Home/RAC Attack 12c/Print Book , 22 3 Elementary Spanish/Present Family/Advanced , 23 3 Elementary Spanish/Present Family/Beginner , 24 3 Introduction to Computer Information Systems/Internet , 25 3 Introduction to Computer Information Systems/Application Software

out 2013: 1 79 Exercise as it relates to Disease , 2 37 Healthy eating habits , 3 12 Introduction to Computer Information Systems/System Software , 4 11 Introduction to Computer Information Systems/Application Software , 5 10 Introduction to Computer Information Systems/Security , 6 10 Lentis , 7 9 Introduction to Computer Information Systems/Internet , 8 9 Introduction to Computer Information Systems/Computer Networks , 9 8 Undergraduate Mathematics/Least common multiple , 10 6 Undergraduate Mathematics/Free body diagram , 11 6 Introduction to Computer Information Systems/E-Commerce , 12 6 Introduction to Computer Information Systems/Multimedia , 13 5 Undergraduate Mathematics/Cyclic group , 14 4 Intellectual Property and the Internet/Web search engines , 15 4 Neuroimaging Data Processing , 16 4 Biological Physics/Probability, Entropy, & the Second Law , 17 4 Nazi Germany's Defeat on the Eastern Front, 1941-1945 , 18 4 How Things Work/Toaster , 19 4 Guitar/Buying an Amplifier , 20 3 Undergraduate Mathematics/Continuous function , 21 3 Undergraduate Mathematics/Intermediate value theorem , 22 3 Lentis/Social aspects of cell phone cameras , 23 3 Lentis/Water Bottles , 24 3 Exercise as it relates to Disease/Exercise effects in lung cancer , 25 3 Exercise as it relates to Disease/Resistance Training and Stroke

nov 2013: 1 44 History of New York State/Further Reading , 2 18 History of New York State/Post-War New York , 3 16 History of New York State/Modern New York , 4 14 History of New York State/New York State in American Popular Culture , 5 14 History of New York State/New York State since the Nixon Era , 6 13 History of New York State/New York State: American Revolution to Civil War , 7 11 History of New York State/Introduction , 8 10 History of New York State/Gilded Age New York State , 9 10 Introduction to Computer Information Systems/Program Development , 10 9 Transportation Deployment Casebook/2013 , 11 9 Introduction to Computer Information Systems/Database , 12 9 Introduction to Computer Information Systems/Information Systems , 13 9 Introduction to Computer Information Systems/E-Commerce , 14 9 Introduction to Computer Information Systems/Multimedia , 15 9 Lentis , 16 8 History of New York State/Pre-Colonial History and the \"Province of New York\" , 17 8 Healthy eating habits , 18 7 Intellectual Property and the Internet/Web search engines , 19 7 Transportation Deployment Casebook , 20 5 Writing Adolescent Fiction/Character names/Ancient Egyptian , 21 4 Undergraduate Mathematics/Cyclic group , 22 4 Healthy eating habits/Sports drinks: are they really doing us good? , 23 4 Healthy eating habits/Post-Workout Nutrition , 24 4 Transportation Planning Casebook/Hyperloop , 25 4 Lentis/Food Waste in the United States

dez 2013: 1 10 Introduction to Computer Information Systems/Computer Security , 2 9 Introduction to Computer Information Systems/Ethics , 3 7 Lentis/The Weight Loss Industry in the United States , 4 7 Lentis/Popular Hygiene: Perceptions and Practices , 5 6 Three Dimensional Electron Microscopy/What is 3DEM? , 6 6 Lentis/Social Obstacles to Public Health in Developing Countries , 7 6 Skateboard Alphabet Coloring Pages , 8 6 Lentis , 9 5 Lentis/Social Aspects of Cell Phone Cameras , 10 5 Lentis/The Organic Foods Movement , 11 4 Undergraduate Mathematics/Proof by infinite descent , 12 4 Lentis/Communication Technology and Interpersonal Relationships , 13 4 Lentis/Bedside Manner in the High-Tech Hospital , 14 4 Lentis/The Disappearing American Streetcar , 15 4 Lentis/Medicine and Disgust , 16 4 Lentis/Airline Passengers and Portable Electronics , 17 4 User-Generated Content in Education/Edmodo , 18 4 Lentis/Artificial Wombs , 19 4 Introduction to Select Irish Literature and Film/Irish Poetry , 20 4 Lentis/GPS and Driving , 21 4 Lentis/Internet Memes , 22 4 Lentis/Water Bottles , 23 4 Lentis/Wind Energy , 24 3 Intellectual Property and the Internet/Web search engines , 25 3 SQLite

jan 2014: 1 11 Intellectual Property and the Internet/Web search engines , 2 4 Undergraduate Mathematics/Dihedral group , 3 4 Guitar/Different Types of Guitars , 4 4 French/Vocabulary/Animals , 5 4 Bartending/Cocktails/Singapore Sling , 6 4 European History/European Imperialism and Nationalism , 7 3 Undergraduate Mathematics/Continuous function , 8 3 AQA A-Level Physics/Evidence for the nucleus , 9 3 AQA A-Level Physics/Nuclear Radius , 10 3 AQA A-Level Physics/Alpha, Beta and Gamma radiation , 11 3 AQA A-Level Physics/Nuclear Instability , 12 3 A-level Computing 2009/AQA/Computer Components, The Stored Program Concept and the Internet/Machine Level Architecture/The Fetch–Execute cycle and the role of registers within it , 13 3 General Engineering Introduction/Attitude , 14 3 GCSE Business Studies/Methods of Production , 15 3 History of Western Theatre: 17th Century to Now/French Post-WWII , 16 3 LaTeX/Export To Other Formats , 17 3 AQA A-Level Physics , 18 3 Introduction to Business/Marketing , 19 3 LaTeX/Mathematics , 20 3 High School Mathematics Extensions/Discrete Probability , 21 3 Object Oriented Programming , 22 3 Python Programming/Control Flow , 23 3 Scouting/BSA/Citizenship in the Community Merit Badge , 24 2 Intellectual Property and the Internet/Chilling effect , 25 2 SQLite

fev 2014: 1 10 Intellectual Property and the Internet/Web search engines , 2 5 SQLite , 3 5 Writing Adolescent Fiction/Character names/Ancient Egyptian , 4 5 Introduction to Inorganic Chemistry/Redox Stability and Redox Reactions , 5 4 Geometry/Points, Lines, Line Segments and Rays , 6 4 World History/Causes and course of the Second World War , 7 3 Human Anatomy/Positions/Hands Up , 8 3 Undergraduate Mathematics/Stokes' theorem , 9 3 Let's Talk about Crystallization in the Naica Mine , 10 3 Professionalism , 11 3 High School Earth Science/Wave Erosion and Deposition , 12 3 OpenSCAD User Manual/Other Language Features , 13 3 OpenSCAD User Manual/Primitive Solids , 14 3 Australian History/1920s , 15 3 General Chemistry/Properties of Matter/Classification of Matter , 16 3 Visual Rhetoric/Examples And Analysis Of Visual Literature , 17 3 LaTeX/Mathematics , 18 3 Scouting/BSA/Citizenship in the Nation Merit Badge , 19 3 General Biology/Classification of Living Things/Classification and Domains of Life , 20 2 Constitution of India/Miscellaneous , 21 2 Constitution of India/Emergency provisions , 22 2 Constitution of India/Official language , 23 2 Dum Aloo , 24 2 Undergraduate Mathematics/Burnside's lemma , 25 2 Undergraduate Mathematics/Homotopy

mar 2014: 1 26 A-level Computing 2009/AQA/Problem Solving, Programming, Data Representation and Practical Exercise/Skeleton code/2014 Exam/Section D , 2 18 Digital Media and Culture Yearbook 2014/Chapter 2: Online Identity , 3 15 Intellectual Property and the Internet/Web search engines , 4 14 Digital Media and Culture Yearbook 2014/Chapter 3: Always-on Culture , 5 7 Writing Adolescent Fiction/Character names/Ancient Egyptian , 6 7 Digital Media and Culture Yearbook 2014/Chapter 5: Crowdsourcing , 7 6 Professionalism , 8 6 Ancient China/Government , 9 5 Digital Media and Culture Yearbook 2014/Chapter 4: Cognitive Surplus , 10 5 Game Creation with the Unity Game Engine/Game3 XtremeCurling , 11 5 Spanish/Slang , 12 4 Manga Study Guide: Barefoot Gen , 13 4 Game Creation with the Unity Game Engine/Game2 CubeWars , 14 4 Introduction to Inorganic Chemistry/Coordination Chemistry and Crystal Field Theory , 15 4 TPACKing for a Wonderful Educational Trip , 16 4 GCSE ICT/Edexcel New GCSE ICT , 17 4 Risotto , 18 4 GCSE ICT , 19 3 Undergraduate Mathematics/Cyclic group , 20 3 Professionalism/Bradley Birkenfeld, the UBS Whistle-blower , 21 3 A Comprehensive Guide to World History , 22 3 Tapioca Pudding , 23 3 Game Creation with the Unity Game Engine/Game1 VeganIsland , 24 3 Digital Media and Culture Yearbook 2014 , 25 3 A-level Computing 2009/AQA/Problem Solving, Programming, Data Representation and Practical Exercise/Skeleton code/2014 Exam

abr 2014: 1 23 Digital Media and Culture Yearbook 2014/Chapter 2: Online Identity , 2 22 Digital Media and Culture Yearbook 2014/Chapter 3: Always-on Culture , 3 16 Digital Media and Culture Yearbook 2014 , 4 14 Intellectual Property and the Internet/Web search engines , 5 11 Digital Media and Culture Yearbook 2014/Chapter 4: Cognitive Surplus , 6 10 A-level Computing 2009/AQA/Problem Solving, Programming, Data Representation and Practical Exercise/Skeleton code/2014 Exam/Section D , 7 8 Digital Media and Culture Yearbook 2014/Chapter 1: Technological Determinism , 8 8 Professionalism , 9 7 Digital Media and Culture Yearbook 2014/Chapter 5: Crowdsourcing , 10 6 Arisa Pitha , 11 6 Introduction to Inorganic Chemistry/Metals and Alloys: Structure, Bonding, Electronic and Magnetic Properties , 12 5 RAC Attack - Oracle Cluster Database at Home/RAC Attack Automation , 13 5 Professionalism/Growth Hacking , 14 5 Introduction to Inorganic Chemistry/Ionic and Covalent Solids - Energetics , 15 4 Professionalism/Amy Stroupe and BB&T , 16 4 Professionalism/Marsha Coleman-Adebayo and EPA , 17 4 Chewy Ginger Cookies , 18 3 Professionalism/BP Texas City Refinery Explosion , 19 3 Undergraduate Mathematics/Intermediate value theorem , 20 3 Undergraduate Mathematics/Proof by exhaustion , 21 3 Undergraduate Mathematics/Proof by infinite descent , 22 3 Solitaire card games/Agnes , 23 3 Manga Study Guide: Barefoot Gen/Plot structure (The Weekly Jump) , 24 3 Manga Study Guide: Barefoot Gen/Character summary , 25 3 Manga Study Guide: Barefoot Gen/Use of cartoon violence

mai 2014: 1 10 A-level Computing 2009/AQA/Problem Solving, Programming, Data Representation and Practical Exercise/Skeleton code/2014 Exam/Section D , 2 6 Models and Theories in Human-Computer Interaction/What’s a Model , 3 5 Intellectual Property and the Internet/Web search engines , 4 5 Professionalism/Greenwashing , 5 5 Professionalism/Bernie Madoff's Ponzi Scheme , 6 5 Professionalism/Balancing Individual Rights vs Welfare of Society , 7 5 Professionalism/Andrew Wakefield and the MMR Vaccine , 8 5 Knowledge Management of a utility company in Hong Kong , 9 5 Professionalism , 10 4 Object Alphabet/E , 11 4 A-level Computing 2009/AQA/Problem Solving, Programming, Operating Systems, Databases and Networking/Problem Solving/Reverse Polish Notation , 12 4 Professionalism/Air France Flight 447 , 13 4 Professionalism/Jordan Belfort and Stratton Oakmont , 14 4 Professionalism/Adderall in Academics , 15 4 Professionalism/Kenneth Kendrick and Peanuts , 16 4 Professionalism/Medical Ghostwriting , 17 4 Professionalism/The Mann Gulch Fire , 18 4 Professionalism/Roger Boisjoly, Morton Thiokol, and NASA , 19 4 Ancient History/Egypt/Geography , 20 4 United States Government/The Three Branches , 21 3 Travel Time Reliability Reference Manual/TTRMS Tool , 22 3 Travel Time Reliability Reference Manual/Surface Plots of travel time and VMT , 23 3 Travel Time Reliability Reference Manual/Surface Plots of non-recurring events , 24 3 Cg Programming/Unity/Water Reflection and Refraction , 25 3 KoBo Toolbox

jun 2014: 1 17 Intellectual Property and the Internet/Web search engines , 2 13 Models and Theories in Human-Computer Interaction , 3 8 Introduction to Latina and Latino Literature , 4 5 Models and Theories in Human-Computer Interaction/Diffusion Innovation and TAM 2 , 5 4 Lingwa de planeta , 6 4 Models and Theories in Human-Computer Interaction/What’s a Model , 7 4 A-level Computing 2009/AQA/Computer Components, The Stored Program Concept and the Internet/Hardware Devices/Input devices , 8 3 Listen and Learn Science/Cells , 9 3 Listen and Learn Science/Guide for Visually Impaired Students , 10 3 Models and Theories in Human-Computer Interaction/Accelerating towards Singularity , 11 3 Models and Theories in Human-Computer Interaction/Accelerated Returns , 12 3 Models and Theories in Human-Computer Interaction/Wiener’s Cybernetics: Life Through the Cybernetic Lens , 13 3 Models and Theories in Human-Computer Interaction/The master model (or mind)? , 14 3 Models and Theories in Human-Computer Interaction/Affordances Make the Design , 15 3 Models and Theories in Human-Computer Interaction/The Paradox of Technology , 16 3 Models and Theories in Human-Computer Interaction/Diffusion as a reliable predictor , 17 3 Models and Theories in Human-Computer Interaction/TAM in software updates , 18 3 Models and Theories in Human-Computer Interaction/Diffusion Innovation and TAM , 19 3 Guide to Game Development/Theory/Physical motion/Forces , 20 3 Introduction to Latina and Latino Literature/Cecilia Rodriguez- Milanes , 21 3 Introduction to Latina and Latino Literature/Jack Agüeros , 22 3 Introduction to Latina and Latino Literature/Sandra Cisneros , 23 3 Models and Theories in Human-Computer Interaction/Mechanical models: Human as machine , 24 3 Guide to Game Development/Theory/Physical motion , 25 3 Cross-Platform Game Programming with gameplay3d/Creating a Scene

jul 2014: 1 7 Intellectual Property and the Internet/Web search engines , 2 5 Models and Theories in Human-Computer Interaction , 3 4 Introduction to Sociology/Introduction , 4 3 Pig's Trotters and Ginger Vinegar Stew , 5 3 Neurocognition of Language/Evolution of Language , 6 3 Neurocognition of Language , 7 3 Rice Milk , 8 3 Recipes for the Design of Experiments , 9 3 A Practical Guide To Digital Data Collection , 10 3 A-level Computing 2009/AQA/C Sharp , 11 3 Pinyin , 12 3 Professionalism/The Toyota Recalls of 2009-2010 , 13 3 How to Ace FYLSE , 14 3 Introductory PLC Programming , 15 3 Scouting/BSA/Citizenship in the Nation Merit Badge , 16 3 Vegan Cuisine , 17 2 SQLite , 18 2 Pinyin/Alan Turing , 19 2 Neurocognition of Language/Speech Comprehension and Speech Production , 20 2 Pinyin/China , 21 2 Pinyin/Understanding From Study , 22 2 A Practical Guide To Digital Data Collection/IRB Considerations , 23 2 A Practical Guide To Digital Data Collection/Research Theory: What is the Research Question? , 24 2 A Practical Guide To Digital Data Collection/Personal Safety and Competence , 25 2 Radiation Oncology/Anatomy/Clinical syndromes with cn palsy

ago 2014: 1 15 Intellectual Property and the Internet/Web search engines , 2 6 World Stamp Catalogue/Soviet Union/1989 , 3 5 SQLite , 4 5 Human Anatomy/Positions/Hands Up , 5 4 Using Wikibooks/How To Edit A Wikibook , 6 4 Cuisine of India , 7 3 XQuery/Validation with Schematron , 8 3 C Sharp Programming/Kelly Criteria , 9 3 Chinese (Mandarin)/Lesson 11 , 10 3 French/Vocabulary/Hotels , 11 3 Computers for Beginners/The Basics , 12 3 Graphic Design/Principles of Design , 13 2 Jhilinga , 14 2 Undergraduate Mathematics/Continuous function , 15 2 Piedmontese , 16 2 Elementary Spanish/Unit5.1 , 17 2 OMS Manual/Chapter 12 , 18 2 OMS Manual/Chapter 11 , 19 2 OMS Manual/Chapter 3 , 20 2 OMS Manual/Chapter 2 , 21 2 OMS Manual/Chapter 1 , 22 2 OMS Manual , 23 2 Cryptsetup , 24 2 Baseball/Pitcher , 25 2 Pinyin/Green bean

set 2014: 1 46 Exercise as it relates to Disease , 2 15 Introduction to Computer Information Systems/System Software , 3 15 Introduction to Computer Information Systems/Input and Output , 4 15 Introduction to Computer Information Systems/Storage , 5 15 Rhetoric and Composition/Revising , 6 14 Recipes for the Design of Experiments/Chapter 1: One Factor, Two Level Experiments , 7 14 Introduction to Computer Information Systems/The System Unit , 8 10 Intellectual Property and the Internet/Web search engines , 9 10 Healthy eating habits , 10 8 Rhetoric and Composition/Collaborating , 11 6 Writing Adolescent Fiction/Character names/Ancient Egyptian , 12 5 Recipes for the Design of Experiments/Chapter 2: Two or More Factors , 13 4 Exercise as it relates to Disease/Effects of exercise on people with bipolar disorder , 14 4 Exercise as it relates to Disease/Exercise and its role in living with Chronic Fatigue Syndrome , 15 4 Introduction to Computer Information Systems/Application Software , 16 4 Introduction to Computer Information Systems/Computers to Fit Every Need , 17 4 Introduction to Computer Information Systems/What is a Computer? , 18 4 Using Wikibooks/Setting Up A User Account , 19 3 SQLite , 20 3 Healthy eating habits/Choosing a Healthy Breakfast , 21 3 Transportation Planning Casebook/Transit Plans in Toronto , 22 3 Haskell/Understanding monads/Solutions/State , 23 3 Introduction to Computer Information Systems/Computer Networks and the Internet , 24 3 Introduction to Computer Information Systems/Computers and Society , 25 3 Sensory Systems/NonPrimates

out 2014: 1 32 Healthy eating habits , 2 14 Introduction to Computer Information Systems/Multimedia , 3 14 Introduction to Computer Information Systems/Security , 4 14 Introduction to Computer Information Systems/Internet , 5 14 Introduction to Computer Information Systems/Computer Networks , 6 12 Recipes for the Design of Experiments/Chapter 5: Blocked Designs with multiple explanatory and nuisance factors , 7 11 Recipes for the Design of Experiments/Chapter 2: Two or More Factors , 8 11 Introduction to Computer Information Systems/Application Software , 9 10 Intellectual Property and the Internet/Web search engines , 10 10 Recipes for the Design of Experiments/Chapter 4: Completely Randomized Block Designs from the literature , 11 10 Introduction to Computer Information Systems/E-Commerce , 12 9 Recipes for the Design of Experiments/Chapter 3: Completely Randomized Designs , 13 8 Recipes for the Design of Experiments/Chapter 6: The Analysis of Covariance , 14 8 Lentis , 15 4 Writing Adolescent Fiction/Character names/Ancient Egyptian , 16 4 Lentis/Genetically Modified Food Controversy in the United States , 17 4 Public-Private Partnership Policy Casebook/460 , 18 4 Learning Python 3 with the Linkbot/Who Goes There? , 19 4 Learning Python 3 with the Linkbot/Intro , 20 4 Introduction to Computer Information Systems/System Software , 21 4 Exercise as it relates to Disease , 22 4 American Indians Today/Current problems , 23 4 Castles of England/Methods of Attack , 24 4 Ancient Civilizations/Ancient Pueblo Peoples , 25 3 SQLite

nov 2014: 1 67 Fluid Mechanics Applications , 2 19 Transportation Deployment Casebook/2014 , 3 15 Introduction to Computer Information Systems/Computer Security , 4 15 Introduction to Computer Information Systems/Information Systems , 5 14 Introduction to Computer Information Systems/Database , 6 14 Introduction to Computer Information Systems/Program Development , 7 12 Intellectual Property and the Internet/Web search engines , 8 8 Lentis , 9 6 Recipes for the Design of Experiments/Chapter 8: Fractional Factorial Designs , 10 6 Recipes for the Design of Experiments/Chapter 7: Resampling Methods , 11 6 Introduction to Computer Information Systems/E-Commerce , 12 5 Writing Adolescent Fiction/Character names/Ancient Egyptian , 13 5 Transportation Planning Casebook/Autonomous Cars , 14 4 Fluid Mechanics Applications/B25:Supersonic Flow In Convergent-Divergent Type of Nozzles , 15 4 Transportation Systems Casebook/Crude , 16 4 Legal Aspects of Text and Data Mining , 17 4 Transportation Deployment Casebook/2014/Guangzhou Bus Transit , 18 4 Public-Private Partnership Policy Casebook/Presidio , 19 4 Transportation Systems Casebook/Ride-sharing , 20 4 Transportation Systems Casebook/Disease , 21 4 Introduction to Computer Information Systems/Ethics , 22 3 SQLite , 23 3 US History/Truman and Cold War , 24 3 Fluid Mechanics Applications/A50:Optimisation of Intake Manifold of a Car , 25 3 Lentis/Clean Coal

dez 2014: 1 15 Fluid Mechanics Applications , 2 12 Intellectual Property and the Internet/Web search engines , 3 11 Lentis , 4 10 Introduction to Computer Information Systems/Ethics , 5 6 Lentis/Shopkeepers and Shoplifters: Technology and the Changing Balance of Power , 6 5 Lentis/Technology and Conventional Norms of Personal Beauty , 7 5 Lentis/Direct-to-Consumer Personal Genomics , 8 5 Recipes for the Design of Experiments/Chapter 10: Taguchi Designs , 9 5 Recipes for the Design of Experiments/Chapter 9: Response Surface Methods , 10 5 Lentis/Reddit: Anonymity and Social Norms , 11 4 SQLite , 12 4 OpenSCAD User Manual/Building on Microsoft Windows , 13 4 Fluid Mechanics Applications/A50:Optimisation of Intake Manifold of a Car , 14 4 Lentis/Moe Anthropomorphism , 15 4 Lentis/Ellie, the Microsoft Kinect, and Psychotherapy , 16 4 Lentis/The Psychology and Technology of Game Immersion , 17 4 Lentis/Real-time Ridesharing , 18 4 Lentis/International Air Travel as a Disease Vector , 19 4 Lentis/Pedestrians and Walkability in Cities and Suburbs , 20 4 Lentis/Peak Oil , 21 4 Lentis/Solar Energy Policy in Germany , 22 4 Lentis/Identity Theft , 23 4 Lentis/8 House , 24 4 Lentis/password1234: Internet Security and Password Culture , 25 4 Lentis/The Dietary and Bodybuilding Supplement Industry in the United States

jan 2015: 1 5 Intellectual Property and the Internet/Web search engines , 2 5 Writing Adolescent Fiction/Character names/Ancient Egyptian , 3 5 World Stamp Catalogue/Soviet Union/1969 , 4 5 GNU Health/Operating System-Specific Notes , 5 5 Chicken Tikka Masala , 6 4 SQLite , 7 4 US History/Truman and Cold War , 8 4 World Stamp Catalogue/Soviet Union/1939 , 9 4 IB Physics/Thermal Physics , 10 3 Intellectual Property and the Internet/Chilling effect , 11 3 Professionalism/Response to Sony Hack of 2014 , 12 3 GNU Health/Vital Records , 13 3 Indonesian/Lessons/Alphabet , 14 3 RattleCAD User Manual/User Interface/MenuBar , 15 3 Radiation Biology for Physical Scientists/Outcomes after cell exposure to radiation , 16 3 RattleCAD User Manual , 17 3 GNU Health , 18 3 A-level Computing 2009/AQA/Computer Components, The Stored Program Concept and the Internet/Hardware Devices/Input devices , 19 3 GCSE Business Studies/Training , 20 3 American Indians Today/Current problems , 21 3 Survey of Communication Study/Chapter 3 - Nonverbal Communication , 22 3 Cultural Anthropology/Ritual and Religion , 23 3 Guitar/Different Types of Guitars , 24 3 GRE/Resources , 25 3 Introduction to Business/Marketing

fev 2015: 1 99 Perspectives in Digital Culture , 2 23 Perspectives in Digital Culture/Web as Public and Private Space , 3 16 Perspectives in Digital Culture/Digital Labour and Social Media , 4 15 Perspectives in Digital Culture/Creative Commons and Participation , 5 9 Perspectives in Digital Culture/The Prosumer Society , 6 8 Perspectives in Digital Culture/Technological Innovation , 7 6 Intellectual Property and the Internet/Web search engines , 8 6 VSphere Web Client , 9 4 Intellectual Property and the Internet/Chilling effect , 10 4 Professionalism/Response to Sony Hack of 2014 , 11 4 GNU Health , 12 4 Vehicle Identification Numbers (VIN codes)/Hyundai/VIN Codes , 13 4 Canadian History/Canadian Pacific Railway , 14 4 The Elements/Lithium , 15 4 Python Programming/Creating Python Programs , 16 4 US History/Reconstruction , 17 3 Transportation Geography and Network Science/Vulnerability , 18 3 Next Generation Sequencing (NGS)/cover , 19 3 Asia/Sri Lanka , 20 3 Asia , 21 3 World Stamp Catalogue/Soviet Union/1969 , 22 3 World Stamp Catalogue/Russia/1918 , 23 3 Nimrod Programming , 24 3 DIY Book Scanner , 25 3 GNU Health/Installation

mar 2015: 1 35 A-level Computing 2009/AQA/Problem Solving, Programming, Data Representation and Practical Exercise/Skeleton code/2015 Exam/Section D , 2 31 Perspectives in Digital Culture/Web as Public and Private Space , 3 22 Perspectives in Digital Culture/The Prosumer Society , 4 22 Perspectives in Digital Culture/Digital Labour and Social Media , 5 19 Perspectives in Digital Culture/Creative Commons and Participation , 6 9 Perspectives in Digital Culture/Technological Innovation , 7 7 Intellectual Property and the Internet/Web search engines , 8 5 GCSE ICT/Edexcel New GCSE ICT , 9 4 Nem chua rán , 10 4 Asia/China , 11 4 Asia/India , 12 4 Transportation Geography and Network Science/Vulnerability , 13 4 Asia , 14 4 Perspectives in Digital Culture , 15 4 Mujje Tulye from Uganda/Growing coffee in Mbale , 16 4 High School Earth Science/Surface Water , 17 4 Lolita , 18 4 Robotics , 19 3 SQLite , 20 3 Writing Adolescent Fiction/Character names/Ancient Egyptian , 21 3 Transportation Geography and Network Science/Spatial Econometrics , 22 3 Asia/Indonesia , 23 3 A-level Computing 2009/AQA/Problem Solving, Programming, Data Representation and Practical Exercise/Skeleton code/2015 Exam/Section C , 24 3 Asia/Pakistan , 25 3 Mujje Tulye from Uganda/A tour of Kampala markets

abr 2015: 1 19 KS3 Computing , 2 12 A-level Computing 2009/AQA/Problem Solving, Programming, Data Representation and Practical Exercise/Skeleton code/2015 Exam/Section D , 3 12 Professionalism , 4 6 KS3 Computing/Binary , 5 5 Intellectual Property and the Internet/Web search engines , 6 5 Writing Adolescent Fiction/Character names/Ancient Egyptian , 7 5 KS3 Computing/How a computer works , 8 5 KS3 Computing/Images , 9 5 KS3 Computing/Logic , 10 4 KS3 Computing/Projects Ideas , 11 4 KS3 Computing/Data representation , 12 4 Asia/Bangladesh , 13 4 Professionalism/Jose Rodriguez and the CIA Interrogation Tapes , 14 4 Transportation Geography and Network Science/Small-world network , 15 4 Transportation Geography and Network Science/Network flexibility and adaptability , 16 4 Hindi/Numbers , 17 3 Professionalism/Corporate Psychopaths , 18 3 KS3 Computing/Glossary , 19 3 KS3 Computing/Logic/And , 20 3 KS3 Computing/Applications , 21 3 KS3 Computing/Logic/Boolean , 22 3 KS3 Computing/Logic/OR , 23 3 KS3 Computing/Programming , 24 3 Professionalism/Rolling Stone & UVA: A Case on Professional Journalism , 25 3 Professionalism/Victoria Hampshire and Lester Crawford

mai 2015: 1 14 A-level Computing 2009/AQA/Problem Solving, Programming, Data Representation and Practical Exercise/Skeleton code/2015 Exam/Section D , 2 13 Professionalism , 3 8 Forensic sciences: Effects of stress and perturbations on soil communities/Introduction , 4 7 Forensic sciences: Effects of stress and perturbations on soil communities , 5 6 Intellectual Property and the Internet/Web search engines , 6 6 Forensic sciences: Effects of stress and perturbations on soil communities/materials and methods , 7 5 Guide to The Lord of the Rings/Characters/Morgoth , 8 5 Writing Adolescent Fiction/Character names/Ancient Egyptian , 9 5 Forensic sciences: Effects of stress and perturbations on soil communities/Results and discussion , 10 5 Fundamentals of Human Nutrition , 11 5 Football (Soccer)/The Leagues and Teams , 12 4 Forensic sciences: Effects of stress and perturbations on soil communities/Conclusion , 13 4 Professionalism/Gepp, Dee, and Lentz, and the leak at Aberdeen Proving Ground , 14 4 Methods in Human Computer Interaction/Qualitative/An ethnographic research study of the deaf community in the workplace , 15 4 Professionalism/Jane Akre, Steve Wilson, and Posilac , 16 4 Professionalism/Victoria Hampshire and Lester Crawford , 17 4 Mujje Tulye from Uganda/A special dish of the Ankole tribe: the karo , 18 4 A-level Computing 2009/AQA/Problem Solving, Programming, Data Representation and Practical Exercise/Skeleton code/2015 Exam/Section C , 19 4 World Stamp Catalogue/Soviet Union/1970 , 20 4 X86 Disassembly/Disassemblers and Decompilers , 21 4 NCEA Level 1 Science/Life processes , 22 4 How Things Work/Nuclear Bomb , 23 3 Forensic sciences: Effects of stress and perturbations on soil communities/Appendices , 24 3 Methods in Human Computer Interaction/Project Proposal Turing , 25 3 Professionalism/The Precautionary Principle

jun 2015: 1 33 Models and Theories in Human-Computer Interaction , 2 20 Models and Theories in Human-Computer Interaction/Introduction to Models and Theories in HCI , 3 15 Models and Theories in Human-Computer Interaction/Framework: Computer as Human, Human as Computer: Perception-Input, Thinking- Processing, Action- Output , 4 9 Models and Theories in Human-Computer Interaction/Diffusion Innovation and TAM , 5 8 Intellectual Property and the Internet/Web search engines , 6 5 Research Methods/Types of Research , 7 4 Development Cooperation Handbook/Interviews/Floris Francesco Capovilla , 8 4 Digital Financial Reporting , 9 4 Trends and Innovations for K-12 Ed Tech Leaders , 10 4 Wikipage , 11 4 Big Cats/Lion , 12 3 Models and Theories in Human-Computer Interaction/Consolidating Diffusion of Innovation and TAM , 13 3 Pragmalinguistic Peculiarities of English Slogan in Fashion Domain/Chapter 6. Analysis of pragmalinguistic peculiarities of English slogan in fashion domain , 14 3 A-level Computing 2009/AQA/Problem Solving, Programming, Data Representation and Practical Exercise/Skeleton code/2015 Exam/Section D , 15 3 Introduction to Business English , 16 3 Introduction to Computer Information Systems/Ethics , 17 3 GCSE Business Studies/Methods of Production , 18 3 Fundamentals of Physics , 19 3 William Shakespeare's Works/The World of William Shakespeare , 20 3 Spanish/Lessons/¿Cómo te llamas? , 21 3 Human Physiology/The male reproductive system , 22 3 Linguistics/Morphology , 23 2 Fire Simulation for Engineers , 24 2 Models and Theories in Human-Computer Interaction/Kurzweil & Future of Human Evolution , 25 2 Models and Theories in Human-Computer Interaction/Diffusion of Innovation - Adopter categories

jul 2015: 1 19 Models and Theories in Human-Computer Interaction , 2 12 Intellectual Property and the Internet/Web search engines , 3 6 Monopoly/Official Rules , 4 4 SQLite , 5 4 Guide to The Lord of the Rings/Characters/Morgoth , 6 4 World Stamp Catalogue/Soviet Union/1968 , 7 4 Robotics , 8 3 Models and Theories in Human-Computer Interaction/CSCW and DCog , 9 3 Haskell/The Functor class , 10 3 Wikijunior , 11 3 Telugu/Common Phrases , 12 3 Big Cats/Lion , 13 3 Haskell , 14 2 Writing Adolescent Fiction/Character names/Ancient Egyptian , 15 2 C Programming/Side effects and sequence points , 16 2 Unsolved Problems in Biology/How Did It Start? , 17 2 Introductory Agrometeorology/Solar radiation , 18 2 Caramel , 19 2 Haskell/Foldable , 20 2 Models and Theories in Human-Computer Interaction/Wikibooks and Action Theory, Subject and Object , 21 2 Dreamer , 22 2 The BT Cloud Sync Summary , 23 2 Models and Theories in Human-Computer Interaction/The investigation based on a single theory (Fitts' Law) might not help for the success. , 24 2 English-Arabic dictionary/Plurals in Arabic , 25 2 Dutch/Lesson 15A

ago 2015: 1 7 Intellectual Property and the Internet/Web search engines , 2 7 Exercise as it relates to Disease , 3 4 SQLite , 4 3 Bicycles/Maintenance and Repair/Appendix/Moulton/Leading link , 5 3 NCEA Level 1 Science/Life processes , 6 3 Tamil/Vocabulary phases , 7 3 LaTeX/Title Creation , 8 3 LaTeX/Bibliography Management , 9 3 LaTeX/Document Structure , 10 3 Hindi/Numbers , 11 3 Scouting/BSA/Citizenship in the Community Merit Badge , 12 2 Human Anatomy/Positions/Hands Up , 13 2 Sensory Systems/Physiology of Pain , 14 2 Linguistic Persuasion/How to Manipulate , 15 2 Linguistic Persuasion/Manipulators , 16 2 Linguistic Persuasion , 17 2 Countries A-Z/Vatican City/Image , 18 2 Countries A-Z/Philippines/Image , 19 2 Countries A-Z/Vatican City , 20 2 Asia/Philippines , 21 2 Countries A-Z/Philippines , 22 2 Granite WMS/SQL/Granite , 23 2 Urban Traffic Operations/VISSIM , 24 2 Partial Differential Equations/Print version , 25 2 Caramel

set 2015: 1 103 Exercise as it relates to Disease , 2 11 Refugee Phrasebook , 3 10 Intellectual Property and the Internet/Web search engines , 4 8 Introduction to Computer Information Systems/Computers in Your Life , 5 7 Introduction to Computer Information Systems/Input and Output , 6 6 SQLite , 7 6 Introduction to Computer Information Systems/System Software , 8 6 Introduction to Computer Information Systems/Storage , 9 6 Introduction to Computer Information Systems/The System Unit , 10 5 Transportation Planning Casebook/Crossrail 2 in London , 11 5 Refugee Phrasebook/sandbox , 12 5 Lentis , 13 4 Refugee Phrasebook/Welcome to the Netherlands, Belgium , 14 4 Refugee Phrasebook/Arabic/Syrian, Dari, Albanian, Bos/Cro/Ser, Macedonian , 15 4 4chan Chronicle , 16 4 A-level Computing 2009/AQA/Computer Components, The Stored Program Concept and the Internet/Fundamentals of Computer Systems/Classification of software , 17 4 Using Wikibooks/Vandalism , 18 3 Guide to The Lord of the Rings/Characters/Morgoth , 19 3 Exercise as it relates to Disease/Chronic Neck Pain in the Workplace - The Effectiveness of Resistance Training Interventions , 20 3 Refugee Phrasebook/Arabic (Fusha), Dari, Bos/Cro/Ser, Macedonian, Albanian, English , 21 3 Refugee Phrasebook/Fusha, Dari, Albanian, Bos/Cro/Ser, Hungarian , 22 3 Refugee Phrasebook/Welcome to Hungary, Bosnia, Croatia (shorter) , 23 3 Refugee Phrasebook/Welcome to Macedonia, Serbia, Croatia (shorter; Arabic, BCS, English, Hungarian, Farsi) , 24 3 Refugee Phrasebook/Welcome to Macedonia, Serbia, Croatia (shorter; Arabic, English, BCS, Macedonian, Farsi) , 25 3 Exercise as it relates to Disease/High intensity interval training for fat loss

out 2015: 1 10 Intellectual Property and the Internet/Web search engines , 2 6 IB/Group 4/Computer Science/System Fundamentals/System Design Basics , 3 6 Introduction to Computer Information Systems/Computer Networks , 4 5 Guide to The Lord of the Rings/Characters/Morgoth , 5 5 Cognition and Instruction/Motivation , 6 5 Cognition and Instruction/Metacognition and Self-Regulated Learning , 7 5 Introduction to Computer Information Systems/E-Commerce , 8 5 Introduction to Computer Information Systems/Multimedia , 9 4 Cognition and Instruction/Learning Mathematics , 10 4 Social Knowledge Creation , 11 4 Refugee Phrasebook , 12 4 Introduction to Computer Information Systems/Application Software , 13 4 Exercise as it relates to Disease , 14 4 How Things Work/Nuclear Bomb , 15 4 Football (Soccer) , 16 3 Public-Private Partnership Policy Casebook/Indianapolis Courthouse , 17 3 Transportation Systems Casebook/Gulf carriers vs. U.S. big three carriers and open skies , 18 3 Cognition and Instruction/Attribution and Emotion , 19 3 Cognition and Instruction/Self Regulated Learning (An overview of Self-regulated learning) , 20 3 Cognition and Instruction/Self-Determination Theory and Beliefs About Self , 21 3 Cognition and Instruction/Technologies and Designs for Learning , 22 3 Cognition and Instruction/Learning to Read , 23 3 Pulsars and neutron stars/Searching for gravitational waves , 24 3 Cognition and Instruction/Social Cognitive Theory , 25 3 Cognition and Instruction/Learning Strategies

nov 2015: 1 25 History of Florida/Further Reading , 2 11 Intellectual Property and the Internet/Web search engines , 3 10 History of Florida/Modern Florida, 1900-1945 , 4 9 History of Florida/Introduction , 5 9 History of Florida/Florida and the American Dream, 1945-present , 6 9 History of Florida/Native American and Colonial “Florida,\" 1497-1821 , 7 9 History of Florida/The \"Sunshine State\" in Popular Culture, 1865-present , 8 9 Lentis , 9 8 History of Florida/Florida from Civil War to the Gilded Age, 1861-1900 , 10 7 Transportation Deployment Casebook/2015 , 11 6 History of Florida/Antebellum Florida: Territory to Statehood, 1821-1861 , 12 5 Cognition and Instruction/Social Cognitive Theory , 13 5 Introduction to Computer Information Systems/Information Systems , 14 5 NCEA Level 1 Science/Life processes , 15 4 Cognition and Instruction/Motivation , 16 4 Cognition and Instruction/Attribution and Emotion , 17 4 Cognition and Instruction/Learning Mathematics , 18 4 Cognition and Instruction/Technologies and Designs for Learning , 19 4 Cognition and Instruction/Metacognition and Self-Regulated Learning , 20 4 Transportation Planning Casebook/Bike Lanes in Amsterdam , 21 4 Transportation Planning Casebook/Alaska Way Viaduct in Seattle , 22 4 Introduction to Computer Information Systems/Computer Security , 23 4 Monopoly/Official Rules , 24 4 General Chemistry/Types of chemical reactions , 25 3 SQLite

dez 2015: 1 13 Intellectual Property and the Internet/Web search engines , 2 13 Lentis , 3 8 Cognition and Instruction/Learning Mathematics , 4 7 Cognition and Instruction/Social Cognitive Theory , 5 6 Cognition and Instruction/Technologies and Designs for Learning , 6 6 Cognition and Instruction/Metacognition and Self-Regulated Learning , 7 5 Lentis/Gluten-Free: Nutritional Principle or Social Value , 8 5 Lentis/Online Recruitment by Extremist Groups , 9 5 Lentis/The Culture of Instagram , 10 5 Lentis/Working Conditions at Apple Hardware Factories in China , 11 5 Cognition and Instruction/Social-Emotional Learning , 12 5 Cognition and Instruction/Attribution and Emotion , 13 5 Cognition and Instruction/Argumentation and Critical Thinking , 14 5 Cognition and Instruction/Learning to Read , 15 5 Cognition and Instruction/Learning Strategies , 16 5 Introduction to Computer Information Systems/Ethics , 17 4 Lentis/The Pill, the Vatican, and American Catholics , 18 4 Lentis/Higher Education Online , 19 4 Lentis/Hypoxic Zones , 20 4 Lentis/Hitchhiking in the Digital Age , 21 4 Lentis/Plastic Bags , 22 4 Lentis/Technology, Organized Crime, and Law Enforcement in the early 20th-Century United States , 23 4 Lentis/Education and the Space Race in the United States , 24 4 Lentis/Green Roofing , 25 4 Lentis/Cell Phones and Cancer in Britain

jan 2016: 1 9 Intellectual Property and the Internet/Web search engines , 2 6 CLIL/The world's main volcanoes , 3 4 Introduction to Computer Information Systems/Security , 4 4 How Things Work/Nuclear Bomb , 5 4 Basic Geography/Climate/Global Climate , 6 4 Monopoly/Official Rules , 7 3 Intellectual Property and the Internet/Chilling effect , 8 3 Writing Adolescent Fiction/Character names/Ancient Egyptian , 9 3 Intensive Care Medicine , 10 3 Fire Simulation for Engineers , 11 3 Plastics Molding & Manufacturing/Plastic Charactheristic , 12 3 American Indians Today/Current problems , 13 3 High School Earth Science/Water Erosion and Deposition , 14 3 World Stamp Catalogue/Algeria , 15 3 Canadian History/The Geography of the Lands , 16 3 LaTeX/Presentations , 17 3 LaTeX/Installation , 18 3 LaTeX/Colors , 19 3 Sexual Health/Sexually Transmitted Diseases , 20 3 Ancient History/Egypt/Geography , 21 3 Greek Mythology/Beasts/Cyclops , 22 3 High School Mathematics Extensions , 23 3 Cell Biology/Organelles , 24 2 Guide to The Lord of the Rings/Characters/Morgoth , 25 2 Rebol Programming

fev 2016: 1 119 An Internet of Everything? , 2 5 Intellectual Property and the Internet/Web search engines , 3 5 An Internet of Everything?/Public and Private Spheres in the Digital Age , 4 5 Statistical Thermodynamics and Rate Theories/Vibrational energy , 5 5 How Things Work/Nuclear Bomb , 6 4 An Internet of Everything?/Contributors , 7 4 Statistical Thermodynamics and Rate Theories/Rotational energy , 8 4 Introduction to Computer Information Systems/Database , 9 4 Ancient History/Egypt/Geography , 10 4 Hindi/Numbers , 11 3 Guide to The Lord of the Rings/Characters/Morgoth , 12 3 Advanced Inorganic Chemistry/Stretching frequencies and structure determination (3.3) , 13 3 An Internet of Everything?/Access to Knowledge and Data in Everyday Life , 14 3 CLIL/The world's main volcanoes , 15 3 Statistical Thermodynamics and Rate Theories/Raman spectroscopy , 16 3 Statistical Thermodynamics and Rate Theories/Boltzmann Distribution , 17 3 Statistical Thermodynamics and Rate Theories/Electronic energy , 18 3 Cognition and Instruction , 19 3 IB/Group 3/History/Route 2/Causes, Practices, and Effects of Wars/The Chinese Civil War (1927-37 and 1946-49) , 20 3 Introduction to Inorganic Chemistry/Review of Chemical Bonding , 21 3 High School Earth Science/Water Erosion and Deposition , 22 3 High School Earth Science/Mining and Using Minerals , 23 3 How Things Work/Inclined Plane , 24 3 Castles of England/Methods of Attack , 25 3 Statistics/Displaying Data/Comparative Pie Charts

mar 2016: 1 34 An Internet of Everything?/Public and Private Spheres in the Digital Age , 2 25 An Internet of Everything?/Surveillance and Sousveillance , 3 24 An Internet of Everything?/Technological and Cultural Determinism , 4 23 A-level Computing/AQA/Problem Solving, Programming, Data Representation and Practical Exercise/Skeleton code/2016 Exam/Skeleton code 2016 Problems(section D in comp1 and most likely section c in paper1 this year) , 5 23 An Internet of Everything?/Access to Knowledge and Data in Everyday Life , 6 17 Intellectual Property and the Internet/Web search engines , 7 14 An Internet of Everything?/Open Source and Proprietary Technologies , 8 6 Cognition and Instruction , 9 5 Cognition and Instruction/Beliefs About Learning and Knowledge , 10 4 SQLite , 11 4 Cold War on a Global Scale , 12 4 Cognition and Instruction/Problem Solving, Critical Thinking and Expertise , 13 4 Cognition and Instruction/Long-Term Memory , 14 4 Cognition and Instruction/Decoding Processes in Learning , 15 4 Cognition and Instruction/Social Context of Cognition , 16 4 A-level Computing/AQA/Problem Solving, Programming, Data Representation and Practical Exercise/Skeleton code/2016 Exam , 17 4 OpenSSH/Cookbook/Proxies and Jump Hosts , 18 4 Scouting/BSA/Citizenship in the Nation Merit Badge , 19 3 A-level Computing/AQA/Paper 2/Fundamentals of communication and networking/Subnet masks , 20 3 A-level Computing/AQA/Paper 1/Theory of computation/Halting problem , 21 3 A-level Computing/AQA/Paper 1/Fundamentals of algorithms , 22 3 A-level Computing/AQA/Paper 2/Fundamentals of communication and networking , 23 3 A-level Computing/AQA/Paper 2/Fundamentals of data representation , 24 3 A-level Computing/AQA/Paper 1/Fundamentals of data structures , 25 3 Radium SmartChain/Linux Mint Hack

abr 2016: 1 13 Science: An Elementary Teacher’s Guide/Beyond the Earth , 2 11 Professionalism , 3 9 Information Technology and Ethics , 4 5 Intellectual Property and the Internet/Web search engines , 5 5 Science: An Elementary Teacher’s Guide/Simple machines , 6 5 A-level Computing/AQA/Problem Solving, Programming, Data Representation and Practical Exercise/Skeleton code/2016 Exam/Skeleton code 2016 Problems(section D in comp1 and most likely section c in paper1 this year) , 7 5 Ethics for IT Professionals/What Is Ethics , 8 4 Information Technology and Ethics/Encryption/Cryptography and Privacy , 9 4 Science: An Elementary Teacher’s Guide/Plants , 10 4 Science: An Elementary Teacher’s Guide/Sandbox , 11 4 Emerging Technologies in Transportation Casebook/Commercial Vehicle Registration, Safety & Fleet Management , 12 4 Drinking Water/Scarcity/Africa , 13 4 Information Technology and Ethics/Intellectual Property , 14 4 How Things Work/Inclined Plane , 15 4 Canadian History/Red River Rebellion , 16 3 Professionalism/Jeffrey Sterling and Operation Merlin , 17 3 Professionalism/Hugh Thompson, William Calley, and the My Lai Massacre , 18 3 Emerging Technologies in Transportation Casebook/Open Data in Transportation , 19 3 Emerging Technologies in Transportation Casebook/Transit Payment Technologies , 20 3 Cognition and Instruction/Problem Solving, Critical Thinking and Expertise , 21 3 Cognition and Instruction/Decoding Processes in Learning , 22 3 Cognition and Instruction/Beliefs About Learning and Knowledge , 23 3 WikiSkills Handbook , 24 3 Ethics for IT Professionals/Professional Code of Ethics , 25 3 Lord of the Flies/Symbolism

mai 2016: 1 12 Professionalism , 2 11 Intellectual Property and the Internet/Web search engines , 3 10 Science: An Elementary Teacher’s Guide/Animals , 4 9 Science: An Elementary Teacher’s Guide/Beyond the Earth , 5 7 Science: An Elementary Teacher’s Guide/Simple machines , 6 6 A-level Computing/AQA/Problem Solving, Programming, Data Representation and Practical Exercise/Skeleton code/2016 Exam/Skeleton code 2016 Problems(section D in comp1 and most likely section c in paper1 this year) , 7 5 SQLite , 8 5 Professionalism/Wesley Wineberg and Facebook , 9 5 Science: An Elementary Teacher’s Guide/The Human Body: Muscles , 10 5 Monopoly/Official Rules , 11 4 Professionalism/A Matter of Honor: Lou Bloomfield and Academic Dishonesty , 12 4 Science: An Elementary Teacher’s Guide/Elements, atoms, molecules , 13 4 Science: An Elementary Teacher’s Guide/Objects in motion , 14 4 Professionalism/Stanford Prison Experiment , 15 4 Science: An Elementary Teacher’s Guide/How do students learn? , 16 4 Science: An Elementary Teacher’s Guide/Plants , 17 4 Professionalism/Martin Shkreli, Turing Pharmaceuticals, and Daraprim , 18 4 Professionalism/Lance Armstrong, the Tour de France, and a Culture of Cheating , 19 3 Introduction to Python Programming , 20 3 Science: An Elementary Teacher’s Guide/Energy, work, power, heat , 21 3 Professionalism/Lenny Bernstein, Exxon, and Climate Change , 22 3 Professionalism/Phillip Rogaway, Computer Scientists, and Government Surveillance , 23 3 Science: An Elementary Teacher’s Guide/Observing, questioning, measuring, presenting , 24 3 Science: An Elementary Teacher’s Guide/Electricity and magnetism , 25 3 Professionalism/Ethics and Autonomous AI

jun 2016: 1 12 Advanced Inorganic Chemistry , 2 7 Science: An Elementary Teacher’s Guide/Contributors , 3 6 Science: An Elementary Teacher’s Guide , 4 4 SQLite , 5 4 Artificial Intelligence for Computational Sustainability: A Lab Companion/List of Computational Sustainability Courses , 6 4 Advanced Inorganic Chemistry/Matrix (1.3) , 7 4 Science: An Elementary Teacher’s Guide/Educational Psychology and Science Teaching , 8 4 Science: An Elementary Teacher’s Guide/Animals , 9 4 A-level Computing/AQA/Problem Solving, Programming, Data Representation and Practical Exercise/Skeleton code/2016 Exam/Skeleton code 2016 Problems(section D in comp1 and most likely section c in paper1 this year) , 10 4 Trends and Innovations for K-12 Ed Tech Leaders , 11 4 Chemical Sciences: A Manual for CSIR-UGC National Eligibility Test for Lectureship and JRF/X-ray crystallography , 12 4 Writing Adolescent Fiction/Character names/Girls , 13 3 Science: An Elementary Teacher’s Guide/Earth's Atmosphere , 14 3 Advanced Inorganic Chemistry/Stretching frequencies and structure determination (3.3) , 15 3 Science: An Elementary Teacher’s Guide/Water Cycle , 16 3 Science: An Elementary Teacher’s Guide/Observing, questioning, measuring, presenting , 17 3 A-level Computing/AQA/Paper 2/Fundamentals of data representation/Binary number system , 18 3 High School Earth Science/Mining and Using Minerals , 19 3 Japanese/Vocabulary/Dates , 20 2 Intellectual Property and the Internet/Web search engines , 21 2 Science: An Elementary Teacher’s Guide/Types of Minerals , 22 2 Countries A-Z/South Sudan , 23 2 Taxi Language , 24 2 Interlingual Energizers/King Kong , 25 2 Interlingual Energizers/Popcorn

jul 2016: 1 7 Science: An Elementary Teacher’s Guide , 2 6 ICT in Education/Issues in the Use of ICTs in Education , 3 5 Intellectual Property and the Internet/Web search engines , 4 4 Big Seven Crypto Study , 5 3 Cognition and Instruction/Origins of Cognitive Psychology , 6 3 Cluster-Handbook , 7 3 Science: An Elementary Teacher’s Guide/Educational Psychology and Science Teaching , 8 3 OpenJSCAD User Guide , 9 3 Science: An Elementary Teacher’s Guide/Contributors , 10 3 Cognition and Instruction/Problem Solving, Critical Thinking and Argumentation , 11 3 Science: An Elementary Teacher’s Guide/Weather, seasons, and climate , 12 3 Cognition and Instruction/Encoding and Retrieval , 13 3 Science: An Elementary Teacher’s Guide/Animals , 14 3 Asia/Mongolia , 15 3 A-level Computing/AQA/Paper 1/Theory of computation/Finite state machines , 16 3 Languages/Russian , 17 3 LaTeX/Floats, Figures and Captions , 18 3 World History/Maps , 19 3 Scouting/BSA/Citizenship in the Nation Merit Badge , 20 3 General Astronomy , 21 2 Asia/Iran , 22 2 Using Ubuntu Linux/Glossary , 23 2 PSLE Study Guide/English/Paper 1 , 24 2 Conversational bots/Natural language processing , 25 2 A-level Computing/AQA/Paper 1/Fundamentals of data structures/Data structures

ago 2016: 1 25 Introduction to Information Technology/Networking , 2 21 Introduction to Information Technology/Computing Hardware , 3 16 Recipes for the Design of Experiments/Appendix A: Biographies , 4 8 Science: An Elementary Teacher’s Guide/Contributors , 5 6 Cognition and Instruction/Problem Solving, Critical Thinking and Argumentation , 6 4 Guitar/Different Types of Guitars , 7 3 Intellectual Property and the Internet/Web search engines , 8 3 Introduction to Information Technology/Cybersecurity , 9 3 Introduction to Information Technology , 10 3 Pinyin/Dozens , 11 3 Cognition and Instruction/Encoding and Retrieval , 12 3 Introducing Julia/Working with dates and times , 13 3 Pinyin/China , 14 3 Flora of New York/Lamiales 2 , 15 3 VirtualBox , 16 3 Telugu/Common Phrases , 17 3 Ancient Civilizations/Arabian , 18 3 Mental Math , 19 3 LaTeX/Importing Graphics , 20 3 Study Skills , 21 3 Ham , 22 2 Exercise as it relates to Disease/Usefulness and effects of a healthy lifestyle program in a remote Aboriginal community , 23 2 Interlingue/Appendix/Table of correlatives , 24 2 Exercise as it relates to Disease/Walking away from Bipolar disorder , 25 2 Exercise as it relates to Disease/How walking, cycling or being driven to school influences physical activity levels in children

set 2016: 1 18 Introduction to Information Technology/Virtualization , 2 12 Recipes for the Design of Experiments/Appendix A: Biographies , 3 9 Intellectual Property and the Internet/Web search engines , 4 7 Introduction to Information Technology/Operating Systems , 5 5 Science: An Elementary Teacher’s Guide/Contributors , 6 4 Transportation Systems Casebook/Automated Trucks , 7 4 Introduction to Information Technology/Web Technologies , 8 4 Recipes for the Design of Experiments/Chapter 2: Two or More Factors , 9 4 Cultural Anthropology/Ritual and Religion , 10 3 Guide to The Lord of the Rings/Characters/Morgoth , 11 3 Exercise as it relates to Disease/The 'Pet Effect' - Can Owning a Pet Improve your Adolescent's Health and Wellbeing? , 12 3 Digraphs and blends , 13 3 Human Body/Hands , 14 3 Famous Paintings , 15 3 Exercise as it relates to Disease/Can exercise reduce insulin to reduce breast cancer recurrence? , 16 3 Sensory Systems/Authors , 17 3 Manchu , 18 3 Writing Adolescent Fiction/Character names/Girls , 19 3 Muggles' Guide to Harry Potter , 20 3 Geometry/Chapter 1 , 21 3 Windows Batch Scripting , 22 3 Hindi/Everyday Phrases , 23 3 Computer Programming , 24 2 Chinese cuisine/Cantonese cuisine/Buddha's delight , 25 2 L. Ron Hubbard/Navy

out 2016: 1 21 Recipes for the Design of Experiments/Chapter 2: Two or More Factors , 2 18 Introduction to Information Technology/Web Technologies , 3 16 Intellectual Property and the Internet/Web search engines , 4 15 Recipes for the Design of Experiments/Chapter 3: Completely Randomized Designs , 5 9 Introduction to Information Technology/Spreadsheets , 6 9 Recipes for the Design of Experiments/Chapter 1: One Factor, Two Level Experiments , 7 8 Cognition and Instruction/Cooperative and Inquiry-Based Learning , 8 6 Recipes for the Design of Experiments/Chapter 0: Preliminaries , 9 5 Public-Private Partnership Policy Casebook/Chicago Parking , 10 4 What is Communism/Introduction , 11 4 What is Communism , 12 4 Public-Private Partnership Policy Casebook/UC Merced , 13 4 The Troubles (Northern Ireland) , 14 4 A-level Applied Science/Finding out about substances/Colorimetry , 15 3 Public-Private Partnership Policy Casebook/Goethals Bridge , 16 3 Transportation Systems Casebook/Handicapped Parking , 17 3 Transportation Systems Casebook/Revenue Adequacy , 18 3 Public-Private Partnership Policy Casebook/LAX , 19 3 States of India , 20 3 Transportation Systems Casebook/Automated Trucks , 21 3 Introduction to Information Technology/Operating Systems , 22 3 A-level Computing/AQA , 23 3 GCSE Business Studies/Business Ownership , 24 3 World Religions/Islam , 25 3 Italian/Vocabulary/Basic Words and Phrases

nov 2016: 1 26 Cultural Anthropology/Play, Sport and Arts , 2 18 History of Nevada/Further Reading , 3 17 Introduction to Information Technology/Relational Databases , 4 16 Cultural Anthropology/Ritual and Religion , 5 15 Recipes for the Design of Experiments/Chapter 7: Resampling Methods , 6 14 Cultural Anthropology/Marriage, Reproduction and Kinship , 7 12 History of Nevada/Modern Nevada (1912-1945) , 8 12 History of Nevada/Nevada and the American Dream (1945-present) , 9 11 Intellectual Property and the Internet/Web search engines , 10 11 History of Nevada/Nevada in Popular Culture (1865-present) , 11 11 History of Nevada/Early Statehood (1864-1912) , 12 11 Introduction to Information Technology/SQL , 13 11 Introduction to Information Technology/Spreadsheets , 14 11 Cultural Anthropology/Production, Inequality and Development , 15 10 Lentis , 16 9 Cognition and Instruction/Cooperative and Inquiry-Based Learning , 17 9 Cultural Anthropology/Health and Healing , 18 9 Cultural Anthropology/Social Stratification, Power and Conflict , 19 8 History of Nevada/Introduction , 20 8 Cultural Anthropology/Anthropological Methods , 21 7 History of Nevada/Native American, Spanish and Mexican Alta California-Nevada (to 1848) , 22 7 Cultural Anthropology/Human Rights , 23 6 Science: An Elementary Teacher’s Guide/Oceans , 24 5 Introduction to Information Technology/Cybersecurity , 25 5 Science: An Elementary Teacher’s Guide

dez 2016: 1 28 Cultural Anthropology/Play, Sport and Arts , 2 19 Recipes for the Design of Experiments/Chapter 8: Fractional Factorial Designs , 3 19 Lentis , 4 17 History of Nevada/Further Reading , 5 17 Introduction to Information Technology/Cybersecurity , 6 16 Cultural Anthropology/Ritual and Religion , 7 15 Cultural Anthropology/Marriage, Reproduction and Kinship , 8 14 Recipes for the Design of Experiments/Chapter 10: Taguchi Designs , 9 13 Intellectual Property and the Internet/Web search engines , 10 11 History of Nevada/Nevada in Popular Culture (1865-present) , 11 11 Cultural Anthropology/Health and Healing , 12 10 Cultural Anthropology/Human Rights , 13 9 History of Nevada/Early Statehood (1864-1912) , 14 9 Cultural Anthropology/Production, Inequality and Development , 15 8 Cultural Anthropology/Social Stratification, Power and Conflict , 16 7 History of Nevada/Introduction , 17 7 Science: An Elementary Teacher’s Guide , 18 7 Cultural Anthropology/Globalization and Migration , 19 7 Cultural Anthropology/Anthropological Methods , 20 6 Lentis/Pokémon Go , 21 6 Science: An Elementary Teacher’s Guide/Light , 22 6 Lentis/Cyber-Attacks on Cyber-Physical Systems , 23 6 History of Nevada/Modern Nevada (1912-1945) , 24 6 Cultural Anthropology/Communication and Language , 25 5 Lentis/How Energy Companies Rebrand Themselves

jan 2017: 1 6 Intellectual Property and the Internet/Web search engines , 2 6 Honeybees' Impact In Our Lives , 3 6 Cultural Anthropology/Introduction , 4 5 Cultural Anthropology/Globalization and Migration , 5 5 Writing Adolescent Fiction/Character names/Girls , 6 4 A-level Computing/OCR/Unit 1.1.3 Input, Output and Storage , 7 4 A-level Computing/OCR/Unit 1.1.1 Structure and Function of the Processor , 8 4 A-level Computing/OCR , 9 4 A-level Computing/AQA/Paper 1/Skeleton program/2017 , 10 4 How Things Work/Lever , 11 3 SQLite , 12 3 A-level Computing/OCR/Unit 1.4.3 Boolean Algebra , 13 3 A-level Computing/OCR/Unit 1.3.3 Networks , 14 3 A-level Computing/OCR/Unit 1.3.2 Databases , 15 3 A-level Computing/OCR/Unit 1.3.1 Compression, Encryption and Hashing , 16 3 A-level Computing/OCR/Unit 2.1 Elements of Computational Thinking , 17 3 A-level Computing/OCR/Unit 1.2.4 Types of Programming Language , 18 3 A-level Computing/OCR/Unit 1.2.3 Software Development , 19 3 Primes/Introduction , 20 3 A-level Computing/OCR/Unit 1.2.2 Applications Generation , 21 3 A-level Computing/OCR/Unit 1.2.1 Systems Software , 22 3 A-level Computing/OCR/Unit 1.1.2 Types of Processor , 23 3 How Things Work/Porcelain , 24 3 IB/Group 4/Computer Science/Computer Organisation , 25 3 High School Chemistry/Light and the Atomic Spectra

fev 2017: 1 83 Living in a Connected World/Contributors , 2 19 Science: An Elementary Teacher’s Guide/Light , 3 11 Cultural Anthropology/Marriage, Reproduction and Kinship , 4 9 Living in a Connected World/Digital Labour on Social Media Platforms , 5 8 Intellectual Property and the Internet/Web search engines , 6 8 Living in a Connected World/The Online Real-Life Divide , 7 7 Cultural Anthropology/Social Stratification, Power and Conflict , 8 6 Living in a Connected World/Persistent Connectivity and the Fear of Missing Out , 9 6 Cultural Anthropology/Human Rights , 10 6 Italian/Vocabulary/Basic Words and Phrases , 11 5 Living in a Connected World/News, Evidence and Memory in Online Communications , 12 5 Statistical Thermodynamics and Rate Theories/Sample problems , 13 5 The Elements/Magnesium , 14 4 Science: An Elementary Teacher’s Guide/Sound , 15 4 GCSE Business Studies/Methods of Production , 16 4 NCEA Level 1 Science/Life processes , 17 4 Cultural Anthropology/Communication and Language , 18 3 A-level Computing/AQA/Paper 2/Fundamentals of communication and networking/TCP-IP , 19 3 Calculus/Vector calculus , 20 3 Living in a Connected World/Filter Bubbles and the Flow of Information , 21 3 Mishti Doi , 22 3 Statistical Thermodynamics and Rate Theories/Molecular partition functions , 23 3 Statistical Thermodynamics and Rate Theories/Microcanonical ensemble , 24 3 Statistical Thermodynamics and Rate Theories/Degrees of freedom , 25 3 High School Earth Science/Continental Drift

mar 2017: 1 72 Cultural Anthropology/Play, Sport and Arts , 2 53 Cultural Anthropology/Ritual and Religion , 3 31 Cultural Anthropology/Human Rights , 4 31 Cultural Anthropology/Marriage, Reproduction and Kinship , 5 31 Cultural Anthropology/Communication and Language , 6 25 Cultural Anthropology/Social Stratification, Power and Conflict , 7 20 Cultural Anthropology/Production, Inequality and Development , 8 19 Cultural Anthropology/Health and Healing , 9 18 Living in a Connected World/Privacy in a Digital Age , 10 17 A-level Computing/AQA/Paper 1/Skeleton program/AS2017 , 11 17 Cultural Anthropology/Globalization and Migration , 12 14 Cultural Anthropology/Anthropological Methods , 13 13 Living in a Connected World/The Online Real-Life Divide , 14 12 Living in a Connected World/Technology as an Extension of Self , 15 12 Cultural Anthropology/Introduction , 16 11 Intellectual Property and the Internet/Web search engines , 17 11 Living in a Connected World/Persistent Connectivity and the Fear of Missing Out , 18 10 Living in a Connected World/Filter Bubbles and the Flow of Information , 19 10 A-level Computing/AQA/Paper 1/Skeleton program/2017 , 20 9 Living in a Connected World/News, Evidence and Memory in Online Communications , 21 9 Living in a Connected World/Digital Labour on Social Media Platforms , 22 8 Living in a Connected World/The Hive Mind and Collective Intelligence , 23 7 Cultural Anthropology/History of Anthropological Theory , 24 7 Monopoly/Official Rules , 25 5 Living in a Connected World

abr 2017: 1 13 A-level Computing/AQA/Paper 1/Skeleton program/AS2017 , 2 9 Trends and Innovations for K-12 Ed Tech Leaders , 3 9 Professionalism , 4 8 A-level Computing/AQA/Paper 1/Skeleton program/2017 , 5 8 Information Technology and Ethics , 6 8 Cultural Anthropology/Introduction , 7 6 Intellectual Property and the Internet/Web search engines , 8 5 Cultural Anthropology/History of Anthropological Theory , 9 5 Monopoly/Official Rules , 10 4 Information Technology and Ethics/Surveillance , 11 4 Professionalism/Thorlaug Agustsdottir: Free Speech and Abuse on Social Media , 12 4 Professionalism/The Ford Pinto Gas Tank Controversy , 13 4 Cultural Anthropology/Globalization and Migration , 14 4 Cultural Anthropology/Anthropological Methods , 15 4 How Things Work/Pulley , 16 4 The Poetry of Gaius Valerius Catullus/111 , 17 4 Puzzles/Riddles , 18 3 Writing Adolescent Fiction/Character names/Ancient Egyptian , 19 3 Information Technology and Ethics/Social Media Data Collection , 20 3 L. Ron Hubbard/Early life , 21 3 L. Ron Hubbard , 22 3 Professionalism/Apple, the FBI, Personal Data , 23 3 Taxi Language/Dialogue 4 , 24 3 Recovering From Anorexia Nervosa , 25 3 Oberon/A2/Oberon.Sort.Mod

mai 2017: 1 12 Professionalism , 2 10 A-level Computing/AQA/Paper 1/Skeleton program/AS2017 , 3 10 A-level Computing/AQA/Paper 1/Skeleton program/2017 , 4 9 Cultural Anthropology/Marriage, Reproduction and Kinship , 5 8 Cultural Anthropology/Human Rights , 6 7 Cultural Anthropology/Social Stratification, Power and Conflict , 7 6 Information Technology and Ethics/Current Robotic Ethics , 8 5 Intellectual Property and the Internet/Web search engines , 9 5 Professionalism/Honest Shanghai , 10 5 Science: An Elementary Teacher’s Guide/Weather, seasons, and climate , 11 5 Cultural Anthropology/Play, Sport and Arts , 12 5 Big Cats/Snow leopard , 13 4 Stories/The Stonecutter , 14 4 Professionalism/Margaret Goodearl, Ruth Ibarra, and Hughes Microelectronics , 15 4 Professionalism/Geofeedia, Social Media, and Law Enforcement , 16 4 Professionalism/Pekka Himanen and The Hacker Ethic , 17 4 Professionalism/Predictive Policing , 18 4 Professionalism/Volkswagen's Emissions Scandal , 19 4 Professionalism/Hillsborough Disaster , 20 4 Professionalism/Professionalism in ''The Intern'' , 21 4 Professionalism/John Stumpf, Wells Fargo, and Salesmanship , 22 4 Science: An Elementary Teacher’s Guide/Light , 23 4 Scriptapedia , 24 4 Introduction to Computer Information Systems/Computers in Your Life , 25 4 Information Technology and Ethics

jun 2017: 1 16 Cultural Anthropology/Play, Sport and Arts , 2 16 Cultural Anthropology/Communication and Language , 3 15 Cultural Anthropology/Health and Healing , 4 12 Intellectual Property and the Internet/Web search engines , 5 11 Cultural Anthropology/Marriage, Reproduction and Kinship , 6 11 Cultural Anthropology/Social Stratification, Power and Conflict , 7 10 Cultural Anthropology/Human Rights , 8 9 Cultural Anthropology/Ritual and Religion , 9 9 Cultural Anthropology/History of Anthropological Theory , 10 8 Trends and Innovations for K-12 Ed Tech Leaders , 11 8 Cultural Anthropology/Production, Inequality and Development , 12 7 ZCash mining GPU Comparison , 13 7 Cultural Anthropology/Globalization and Migration , 14 7 Cultural Anthropology/Introduction , 15 6 A-level Computing/AQA/Paper 1/Skeleton program/2017 , 16 5 Science: An Elementary Teacher’s Guide/Objects in motion , 17 5 Research Methods/Types of Research , 18 4 A User's Guide to Serre's Arithmetic , 19 4 A-level Computing/AQA/Paper 1/Skeleton program/AS2017 , 20 4 Introduction to Computer Information Systems/Application Software , 21 4 Cultural Anthropology/Anthropological Methods , 22 4 French/Vocabulary/Animals , 23 3 Data Analysis in Astronomy , 24 3 C Programming/Exercise solutions , 25 3 Fruit Alphabet/Complete/G

jul 2017: 1 6 Intellectual Property and the Internet/Web search engines , 2 6 Science: An Elementary Teacher’s Guide/Rocks, earthquakes, and erosion , 3 4 Scriptapedia/Versions (different languages) , 4 4 Science: An Elementary Teacher’s Guide/Earth's Atmosphere , 5 4 Research Methods/Types of Research , 6 4 Sensory Systems/Olfactory System , 7 4 Introductory PLC Programming , 8 3 Arithmetic/Number Operations/Subtraction , 9 3 Introduction to Chinese Civil Law , 10 3 Fun symmetry game with alphabet , 11 3 Reading and writing Alphabet , 12 3 Scriptapedia/ScriptsMap and Design Logic , 13 3 Scriptapedia/90-minute workshop sample , 14 3 Scriptapedia/Readings in System Dynamics , 15 3 Science: An Elementary Teacher’s Guide/Light , 16 3 Science: An Elementary Teacher’s Guide/Weather, seasons, and climate , 17 3 Science: An Elementary Teacher’s Guide/Cells , 18 3 Science: An Elementary Teacher’s Guide/Simple machines , 19 3 Hypnosis/Chapters/Hypno , 20 3 Trigonometry/Angles of a triangle sum to 180 Degrees , 21 3 Identifying Rocks and Minerals/Types of Rocks , 22 3 Lucid Dreaming/Introduction , 23 3 Unicode/Versions , 24 3 C Programming , 25 3 Myers-Briggs Type Indicator/ENTP

ago 2017: 1 31 Exercise as it relates to Disease , 2 5 Fractals , 3 5 Monopoly/Official Rules , 4 4 How Things Work/Wedge , 5 3 Intellectual Property and the Internet/Chilling effect , 6 3 Exercise as it relates to Disease/Increasing physical activity of office workers using treadmill workstations , 7 3 Fruit Alphabet/Complete/Z , 8 3 Fractals/Iterations in the complex plane/misiurewicz , 9 3 Taxi Language/Dialogue 3 , 10 3 Flora of New York/h-sect , 11 3 Flora of New York/Carduoideae , 12 3 Fundamentals of C Programming/Useful functions , 13 3 Research Methods/Types of Research , 14 3 Conlang/Advanced/Sounds/Ingressive , 15 3 ERP Internals/Data Tables/Supporting Tables/Fiscal Period/Year , 16 3 Unicode/Versions , 17 3 FOSS Open Standards/Comparison of File Formats , 18 3 Coding Cookbook/Validate Email Address , 19 2 Intellectual Property and the Internet/Web search engines , 20 2 SQLite , 21 2 Exercise as it relates to Disease/The benefits of a yoga regime on lung function in Indian Cardiovascular Artery Disease (CAD) patients , 22 2 Rebol Programming , 23 2 Algorithm Implementation/Mathematics/Modular Exponentiation , 24 2 Fruit Alphabet/Complete/T , 25 2 Women's Health/Pain/Cervical motion tenderness

set 2017: 1 79 Exercise as it relates to Disease , 2 6 Monopoly/Official Rules , 3 5 Intellectual Property and the Internet/Web search engines , 4 5 Practical DevOps for Big Data , 5 4 A-level Computing/AQA/Paper 1/Skeleton program/2018 , 6 4 Exercise as it relates to Disease/Increasing physical activity of office workers using treadmill workstations , 7 4 GCSE Business Studies/Business Ownership , 8 4 Writing Adolescent Fiction/Character names/Girls , 9 4 The Elements/Nickel , 10 4 Mental Math , 11 4 How To Assemble A Desktop PC/Choosing the parts , 12 3 SQLite , 13 3 Writing Adolescent Fiction/Character names/Ancient Egyptian , 14 3 Unofficial Guide To Expanding Your Numworks/Getting your development environment set up , 15 3 Prussian , 16 3 Exercise as it relates to Disease/Does chronic disease reduce physical activity in older adult? , 17 3 Exercise as it relates to Disease/High intensity eccentric resistance training decreases bradykinesia in Parkinson's disease patients , 18 3 Principles of Microeconomics , 19 3 Social Knowledge Creation , 20 3 Human Geography AP/Gravity model , 21 3 Human Physiology/Homeostasis , 22 3 Chinese Stories/Jade Rabbit , 23 3 Radiation Oncology/Melanoma/Primary , 24 3 Writing Adolescent Fiction/Character names , 25 3 Clarinet/History

out 2017: 1 13 Lentis , 2 10 Practical DevOps for Big Data , 3 9 Intellectual Property and the Internet/Web search engines , 4 4 Practical DevOps for Big Data/Technology-Specific Modelling , 5 4 Practical DevOps for Big Data/Quality Optimisation , 6 4 High School Chemistry/Writing Electron Configurations , 7 4 Exercise as it relates to Disease , 8 4 Research Methods/Types of Research , 9 4 Ancient Civilizations/Mound Builders , 10 4 Monopoly/Official Rules , 11 4 Introduction to Philosophy/The Branches of Philosophy , 12 4 United States Government/The Three Branches , 13 3 Lentis/Mental Health as a Pharmacological Growth Market , 14 3 Lentis/Road Rage , 15 3 Pig Latin , 16 3 Practical DevOps for Big Data/Anomaly Detection , 17 3 Practical DevOps for Big Data/Platform-Independent Modelling , 18 3 Practical DevOps for Big Data/Monitoring , 19 3 Practical DevOps for Big Data/Delivery , 20 3 Practical DevOps for Big Data/Configuration Optimisation , 21 3 US History/Trump , 22 3 Transportation Systems Casebook/Evacuation Best Practices (Lessons Learned) , 23 3 Practical DevOps for Big Data/Deployment-Specific Modelling , 24 3 Practical DevOps for Big Data/Quality Simulation , 25 3 Practical DevOps for Big Data/Fault Injection

nov 2017: 1 42 History of Alaska/Further Reading , 2 15 History of Alaska/Alaska in US Popular Culture (1867-present) , 3 14 History of Alaska/Introduction , 4 12 History of Alaska/Territorial Alaska (1912-1959) , 5 12 Cultural Anthropology/Human Rights , 6 11 History of Alaska/Statehood (1959-present) , 7 10 History of Alaska/Russian Alaska (1780-1867) , 8 8 Intellectual Property and the Internet/Web search engines , 9 8 History of Alaska/From Department to District (1867-1912) , 10 7 History of Alaska/Aboriginal ''Alaxsxaq'' (to 1800) , 11 7 Cultural Anthropology/Marriage, Reproduction and Kinship , 12 7 Cultural Anthropology/Social Stratification, Power and Conflict , 13 6 A-level Computing/AQA/Paper 1/Skeleton program/2018 , 14 4 Asia/Afghanistan , 15 4 Research Methods/Types of Research , 16 4 Ancient History/Egypt/Geography , 17 4 Monopoly/Official Rules , 18 4 Geometry/Points, Lines, Line Segments and Rays , 19 3 CUEBC Resource Book , 20 3 Public-Private Partnership Policy Casebook/I-69 , 21 3 Lentis/Mental Health as a Pharmacological Growth Market , 22 3 Lentis/Road Rage , 23 3 Practical DevOps for Big Data/Introduction to Modelling , 24 3 Chinese Stories/Jade Rabbit , 25 3 High School Earth Science/Continental Drift

dez 2017: 1 21 Cultural Anthropology/Ritual and Religion , 2 20 Cultural Anthropology/Health and Healing , 3 17 Cultural Anthropology/Human Rights , 4 13 Cultural Anthropology/Marriage, Reproduction and Kinship , 5 12 Lentis , 6 12 Cultural Anthropology/Social Stratification, Power and Conflict , 7 12 Cultural Anthropology/Communication and Language , 8 9 Cultural Anthropology/Play, Sport and Arts , 9 8 Cultural Anthropology/Globalization and Migration , 10 7 Intellectual Property and the Internet/Web search engines , 11 7 Cultural Anthropology/Glossary , 12 7 Cultural Anthropology/Anthropological Methods , 13 6 Monopoly/Official Rules , 14 5 Lentis/Religious Opposition to Vaccination , 15 5 Lentis/Technology and Conventional Norms of Personal Beauty , 16 5 Muggles' Guide to Harry Potter/Major Events/Second Task , 17 4 The Elements/Thallium , 18 4 Lentis/Noise pollution , 19 4 Lentis/Mental Health as a Pharmacological Growth Market , 20 4 Lentis/Road Rage , 21 4 Lentis/Fake Users , 22 4 Lentis/Neoluddism and Technophilia , 23 4 How Things Work/Screw , 24 4 How To Assemble A Desktop PC/Choosing the parts , 25 4 United States Government/The Three Branches

jan 2018: 1 11 Intellectual Property and the Internet/Web search engines , 2 4 Dinosaurs/Spinosaurus , 3 4 A-level Computing/AQA/Paper 1/Skeleton program/2018 , 4 4 Practical DevOps for Big Data , 5 4 ZCash mining GPU Comparison , 6 4 Writing Adolescent Fiction/Character names/Girls , 7 3 Botany/Plant cells/Photosynthesis , 8 3 Social Knowledge Creation/History , 9 3 Practical DevOps for Big Data/Trace Checking , 10 3 High School Earth Science/The Sun and the Earth-Moon System , 11 3 Basic Geology/Outer Core , 12 3 Football (Soccer)/The Basics , 13 3 High School Earth Science/Wave Erosion and Deposition , 14 3 LaTeX/Special Characters , 15 3 Vehicle Identification Numbers (VIN codes)/Ford/VIN Codes , 16 3 Vehicle Identification Numbers (VIN codes)/World Manufacturer Identifier (WMI) , 17 3 A-level Applied Science/Finding out about substances/Colorimetry , 18 3 Computer Programming/Hello world , 19 3 The Elements/Uranium , 20 3 LaTeX/Colors , 21 3 The Elements/Hydrogen , 22 3 Dinosaurs/Allosaurus , 23 3 X86 Assembly/X86 Architecture , 24 3 LaTeX/Mathematics , 25 3 Tamil/Tamil Script

fev 2018: 1 19 Intellectual Property and the Internet/Web search engines , 2 10 Digital Media & Culture: Collaborative Essay Collection 2018/Contributors , 3 6 A-level Computing/AQA/Paper 1/Skeleton program/2018 , 4 5 How Things Work/Inclined Plane , 5 4 Open and Distance Education/E-learning Readiness/E-learning Frameworks , 6 4 Trends and Innovations for K-12 Ed Tech Leaders/Part II , 7 4 Social Knowledge Creation/Knowledge Construction and Constriction , 8 4 A-level Computing/AQA/Computer Components, The Stored Program Concept and the Internet/Structure of the Internet/Packet switching , 9 4 Social Knowledge Creation , 10 4 New Zealand History/Polynesian Settlement , 11 4 The Elements/Hydrogen , 12 4 Monopoly/Official Rules , 13 4 Hamburger , 14 4 Of Mice and Men , 15 3 Open and Distance Education/Distance learners and learner support/MOOC Learners , 16 3 Open and Distance Education/Distance learners and learner support , 17 3 Open and Distance Education/E-learning Readiness/Facts and Figures , 18 3 Open and Distance Education/E-learning Readiness/Students E-readiness in Higher Education , 19 3 Open and Distance Education/E-learning Readiness/E-readiness in Higher Education , 20 3 Open and Distance Education/E-learning Readiness , 21 3 Open and Distance Education/Selected Research on Emerging Technologies in Education , 22 3 Open and Distance Education/Evaluating Technologies for Open and Distance Education , 23 3 Open and Distance Education/Common Technologies in Open and Distance Education , 24 3 Open and Distance Education/Classifying Technologies in Open and Distance Education , 25 3 Open and Distance Education/Technologies in Open and Distance Education: A Timeline

mar 2018: 1 55 Digital Media & Culture: Collaborative Essay Collection 2018/Contributors , 2 15 Trends and Innovations for K-12 Ed Tech Leaders/Part II , 3 10 Intellectual Property and the Internet/Web search engines , 4 9 A-level Computing/AQA/Paper 1/Skeleton program/AS2018 , 5 8 A-level Computing/AQA/Paper 1/Skeleton program/2018 , 6 6 Ancient History/Egypt/Geography , 7 5 Social Knowledge Creation/Shifting Future , 8 5 Social Knowledge Creation , 9 5 High School Earth Science/The Sun and the Earth-Moon System , 10 4 Digital Media & Culture: Collaborative Essay Collection 2018/Always-on Culture/Research Question 1:/To what extent do we agree with Sherry Turkle's argument that digital connections offer only an illusion of companionship? , 11 4 Digital Media & Culture: Collaborative Essay Collection 2018/Collective Intelligence/Research Question 2:Fairman Fairplay , 12 4 Digital Media & Culture: Collaborative Essay Collection 2018/Always-on Culture/Research Question 2:/To what extent can we agree with dana boyd’s argument that we are always connected to the network? , 13 4 Social Knowledge Creation/Gamification , 14 4 Solar System/Moon , 15 3 Constitution of India/Emergency provisions , 16 3 Transportation Planning Casebook/New Public Transport Timetables for Sydney , 17 3 Digital Media & Culture: Collaborative Essay Collection 2018/The Internet of Things/Research Question 1: Media Maidens , 18 3 Digital Media & Culture: Collaborative Essay Collection 2018/Convergence/Research Question 2:/The Snow Ploughs , 19 3 Digital Media & Culture: Collaborative Essay Collection 2018/Convergence/Research Question 1:/JJ.AMBS , 20 3 Digital Media & Culture: Collaborative Essay Collection 2018/Convergence , 21 3 Statistical Thermodynamics and Rate Theories/Chemical Equilibrium , 22 3 Statistical Thermodynamics and Rate Theories/Eyring Transition State Theory , 23 3 Trends and Innovations for K-12 Ed Tech Leaders , 24 3 Sport Innovation/Background of Under Armour , 25 3 Identifying Rocks and Minerals/Differences Between Rocks and Minerals

abr 2018: 1 11 A-level Computing/AQA/Paper 1/Skeleton program/2018 , 2 11 Professionalism , 3 10 Trends and Innovations for K-12 Ed Tech Leaders/Part II , 4 8 Trends and Innovations for K-12 Ed Tech Leaders/Part IIHA2 , 5 6 Transportation Planning Casebook/Sydney LRT (CBD and Southeast) , 6 6 Monopoly/Official Rules , 7 5 Transportation Planning Casebook/Northern Beaches Freeway , 8 5 Transportation Planning Casebook/Sydney Metro (Northwest) , 9 5 Transportation Planning Casebook/Stationless Bikesharing in Sydney , 10 5 Digital Media & Culture: Collaborative Essay Collection 2018/The Internet of Things/Research Question 1: Media Maidens , 11 5 Digital Media & Culture: Collaborative Essay Collection 2018/Convergence/Research Question 4:/Digital Dancers , 12 5 Digital Media & Culture: Collaborative Essay Collection 2018/Convergence/Research Question 3:/RandomLabGroup , 13 5 Digital Media & Culture: Collaborative Essay Collection 2018/Convergence/Research Question 2:/The Snow Ploughs , 14 5 Information Technology and Ethics/Consumer AI , 15 4 Professionalism/Tom Williams and the Wings of the A380 , 16 4 Digital Media & Culture: Collaborative Essay Collection 2018/Online Identity/Research Question 2:Bring Me the Bananas , 17 4 Digital Media & Culture: Collaborative Essay Collection 2018/Transmediality/Research Question 3:Jenwards , 18 4 Digital Media & Culture: Collaborative Essay Collection 2018/Always-on Culture/Research Question 3:/SNAC , 19 4 Digital Media & Culture: Collaborative Essay Collection 2018/Online Identity/Research Question 1: To what extent does online identity, created through social media interactions, represent real life identity? , 20 4 Social Knowledge Creation/Final Engagements , 21 4 Social Knowledge Creation , 22 4 Information Technology and Ethics/IT and Healthcare , 23 4 Information Technology and Ethics , 24 4 Writing Adolescent Fiction/Character names/Girls , 25 4 Ancient History/Egypt/Geography

mai 2018: 1 34 Transportation Deployment Casebook/2018 , 2 17 Intellectual Property and the Internet/Web search engines , 3 16 Professionalism , 4 11 A-level Computing/AQA/Paper 1/Skeleton program/2018 , 5 5 Professionalism/Environmental Racism , 6 5 Canadian History/Red River Rebellion , 7 5 Writing Adolescent Fiction/Character names/Girls , 8 4 Transportation Deployment Casebook/2018/Nanjing Metro , 9 4 Professionalism/Scott Reuben and Research Fraud , 10 4 Professionalism/Fishbein and the NIH , 11 4 Professionalism/LaMia Flight 2933 , 12 4 Professionalism/Walter Tamosaitis and the Hanford Site , 13 4 Professionalism/Tom Williams and the Wings of the A380 , 14 4 GNU Health/Operating System-Specific Notes , 15 4 Transportation Deployment Casebook , 16 4 New Zealand History/Polynesian Settlement , 17 4 Writing Adolescent Fiction/Character names/Boys , 18 4 Bugs/Walking Stick , 19 3 Mojolicious , 20 3 Transportation Deployment Casebook/2018/Beijing subway , 21 3 Transportation Planning Casebook/Sydney Ferries , 22 3 Transportation Planning Casebook/Sydney West Metro , 23 3 Transportation Deployment Casebook/2018/Air Transport Mode , 24 3 Transportation Deployment Casebook/2018/The two-wheel-miracle: an analysis of the life-cycle of Electric Bicycle in China , 25 3 Professionalism/Restaurant Ethics according to Bob's Burgers

jun 2018: 1 8 A-level Computing/AQA/Paper 1/Skeleton program/2018 , 2 6 History of wireless telegraphy and broadcasting in Australia/Topical/Biographies/John Graeme Balsillie , 3 4 Applications of ICT in Libraries/Print version , 4 4 Scriptapedia , 5 4 Introduction to Computer Information Systems/System Software , 6 4 BASIC Programming , 7 3 Scriptapedia/Trends Over Time , 8 3 Scriptapedia/Chickens and Eggs , 9 3 Scriptapedia/Elephant , 10 3 Jumarkese , 11 3 Jamaican Curried Chicken , 12 3 A-level Computing/AQA/Paper 1/Skeleton program/AS2017 , 13 3 Advanced Inorganic Chemistry , 14 3 Introducing Julia/DataFrames , 15 3 Space Transport and Engineering Methods/Mars Development , 16 3 The Ten Commandments/Honor your father and your mother , 17 3 Basic Geology , 18 3 Welsh Cakes , 19 3 Albanian , 20 3 An Awk Primer , 21 3 QEMU/Installing QEMU , 22 3 Writing Adolescent Fiction/Character names/Boys , 23 3 Human Body/CirculatorySystem , 24 3 Haskell/GADT , 25 3 Ancient History/Human Evolution/Neolithic Age

jul 2018: 1 6 Professionalism/Corporate Psychopaths , 2 5 Bash Shell Scripting , 3 3 Quantum theory of observation/About this book , 4 3 History of wireless telegraphy and broadcasting in Australia/Topical/Biographies/John Graeme Balsillie , 5 3 Science: An Elementary Teacher’s Guide/Chemical Reactions , 6 3 Science: An Elementary Teacher’s Guide/Building Blocks of Matter , 7 3 NVQ Carpentry Level 2 , 8 3 Quantum theory of observation , 9 3 Big Seven Crypto Study , 10 3 Scriptapedia , 11 3 Football (Soccer)/The Basics , 12 3 Sex and Music , 13 3 Brazilian Portuguese , 14 3 US History/Obama , 15 3 Starting and Running a Wiki Website/Hosted Wikis , 16 3 Staffing and Supervision in the Hotel & Tourism Industry , 17 3 French/Vocabulary/Animals , 18 3 Circuit Theory/Phasors , 19 3 Football (Soccer)/The Trophies And Cups , 20 3 Chinese (Mandarin) , 21 3 Cell Biology , 22 2 Yubeshi , 23 2 History of wireless telegraphy and broadcasting in Australia/Topical/Stations/2UE Sydney , 24 2 Scriptapedia/180-minute workshop sample , 25 2 Blender 3D: Noob to Pro/Simple Vehicle: Another Shooting Machine – UV Map

ago 2018: 1 8 Sensory Systems/Authors , 2 4 Introducing Julia/Arrays and tuples , 3 3 Exercise as it relates to Disease/Benefits of exercise on rheumatoid arthritis patients , 4 3 Kids-Economy , 5 3 Exercise as it relates to Disease/Interventions for obese patients with knee osteoarthritis - Underwater vs. home exercise? , 6 3 Sensory Systems/Visual System/In Vivo Imaging , 7 3 Human Body/Pain , 8 3 The Python Class , 9 3 Digital Media & Culture: Collaborative Essay Collection 2018 , 10 3 Prussian , 11 3 Order Theory , 12 3 Oberon , 13 3 Professionalism/Corporate Psychopaths , 14 3 Kannada/Numbers , 15 3 Mentor teacher , 16 3 Sardinian , 17 3 Pixlr Editor , 18 3 Exercise as it relates to Disease , 19 3 Ethnography of Fiddle/Noise Khanyile , 20 3 God and Religious Toleration , 21 3 Project Management/PMBOK , 22 3 OpenSCAD User Manual/Other Language Features , 23 3 Autodesk Inventor , 24 3 Learn to Play Drums , 25 3 Relationships/Where Couples Met

set 2018: 1 7 Elements of Art/Line , 2 5 Lentis , 3 4 How Things are Made/Toys , 4 4 How Things are Made , 5 4 A-level Computing/AQA/Paper 1/Skeleton program/2019 , 6 3 The implementation of E-Government/E-Government by country/Ukraine/State center for cyber defense and countering cyber threats , 7 3 The implementation of E-Government/E-Government by country/Russia/Internet representation of the President of Russia , 8 3 History of Vietnam , 9 3 History of Central Asia , 10 3 Exercise as it relates to Disease/Exercise and major depression in older patients , 11 3 Exercise as it relates to Disease/A behavioural intervention to increase physical activity amongst chronic obstructive pulmonary disease patients , 12 3 Exercise as it relates to Disease/Strategies for increasing recess-time physical activity for children , 13 3 Oberon , 14 3 Introducing Julia/Controlling the flow , 15 3 Medical Simulation , 16 3 Future/10 years into the future , 17 3 High School Earth Science/Earth's Motions , 18 3 NCEA Level 1 Science/Life processes , 19 3 Canadian History/The Geography of the Lands , 20 3 General Chemistry/Chemistries of Various Elements/Group 18 , 21 3 Structural Biochemistry/Cell Organelles , 22 3 Writing Adolescent Fiction/Character names/Girls , 23 3 IB Theory of Knowledge , 24 3 Monopoly/Official Rules , 25 3 Scouting/BSA/Citizenship in the Nation Merit Badge

out 2018: 1 11 Lentis , 2 8 A-level Computing/AQA/Paper 1/Skeleton program/2019 , 3 6 United States Government/The Three Branches , 4 4 Programming Fundamentals , 5 4 Lord of the Flies/Symbolism , 6 4 Video Game Design/Components , 7 4 Muggles' Guide to Harry Potter/Magic/Legilimency , 8 3 How Things Work/Data Center , 9 3 Soil Erosion by Water , 10 3 Wikibooks Stacks , 11 3 Science Alphabet , 12 3 Numerical calculations and rigorous mathematics , 13 3 How to program a computer if you are a child , 14 3 Oberon , 15 3 Citizenship and Nationality , 16 3 Guarani , 17 3 A Bit History of Internet/Chapter 1 : Introduction , 18 3 Basic Geology/Outer Core , 19 3 Algebra/Standard Form and Solving Slope , 20 3 Fundamentals of Transportation/Traffic Signals , 21 3 Muggles' Guide to Harry Potter/Major Events/Order of the Phoenix , 22 3 World War II/Tanks , 23 3 A-level Applied Science/Energy Transfer Systems/Circulatory and Respiratory Systems , 24 3 Human Physiology/The Immune System , 25 3 Human Physiology/The respiratory system

nov 2018: 1 17 Issues in Interdisciplinarity 2018-19 , 2 8 Living in a Connected World 2018/Contributors , 3 7 A-level Computing/AQA/Paper 1/Skeleton program/2019 , 4 5 Issues in Interdisciplinarity 2018-19/Imperial Influences on African Education Systems , 5 5 Issues in Interdisciplinarity 2018-19/Evidence in driverless cars , 6 5 Issues in Interdisciplinarity 2018-19/Imperialism in Museums , 7 5 Truth and the Arts , 8 5 How Things Work/Light Bulb , 9 4 Issues in Interdisciplinarity 2018-19/Imperialism in the 'War on Drugs' , 10 4 Issues in Interdisciplinarity 2018-19/Imperialism in Fashion , 11 4 Issues in Interdisciplinarity 2018-19/Truth in Uchronia , 12 4 Big Book Of Cities And Towns , 13 4 Lentis , 14 4 Lord of the Flies/Symbolism , 15 4 Identifying Rocks and Minerals/Differences Between Rocks and Minerals , 16 4 Writing Adolescent Fiction/Character names/Girls , 17 4 Cell Biology/Organelles , 18 3 Issues in Interdisciplinarity 2018-19/Truth and Power: Education under Hitler , 19 3 Lentis/Online Consumer Reviews , 20 3 Issues in Interdisciplinarity 2018-19/Evidence in the Gender Pay Gap , 21 3 Issues in Interdisciplinarity 2018-19/Truth in Reproductive Biology , 22 3 Issues in Interdisciplinarity 2018-19/Truth in the Diagnosis of Depression , 23 3 Issues in Interdisciplinarity 2018-19/Truth in Franco's Regime , 24 3 Public-Private Partnership Policy Casebook/Midtown Tunnel , 25 3 Big Book Of Cities And Towns/Introduction

dez 2018: 1 53 Issues in Interdisciplinarity 2018-19 , 2 8 Lentis , 3 7 Issues in Interdisciplinarity 2018-19/Disciplinary Categories and Their Effect On Gender Perception , 4 6 Issues in Interdisciplinarity 2018-19/Truth in Politics , 5 6 Issues in Interdisciplinarity 2018-19/Evidence in Nutrition , 6 6 Issues in Interdisciplinarity 2018-19/Evidence in driverless cars , 7 6 Issues in Interdisciplinarity 2018-19/Truth in Media in the case of Turkish Politics , 8 5 Issues in Interdisciplinarity 2018-19/Imperialism: a black and white issue? , 9 5 Truth in Medicine , 10 5 Imperialism: a black and white issue? , 11 5 Issues in Interdisciplinarity 2018-19/Evidence in Climate Change , 12 5 Issues in Interdisciplinarity 2018-19/Evidence for the Implications of the Cow in Contemporary India , 13 5 Issues in Interdisciplinarity 2018-19/Imperialism in the study of children’s toy preferences , 14 5 Issues in Interdisciplinarity 2018-19/Truth and the Environment , 15 5 Issues in Interdisciplinarity 2018-19/Imperial Influences on African Education Systems , 16 5 Digital Technology and Cultures , 17 5 High School Earth Science/Continental Drift , 18 5 How Things Work/Inclined Plane , 19 4 Four-Player Chess/Common openings , 20 4 Issues in Interdisciplinarity 2018-19/Truth and Power: Education under Hitler , 21 4 Issues in Interdisciplinarity 2018-19/Imperialism and Humanitarian Architecture , 22 4 Issues in Interdisciplinarity 2018-19/Truth, History and Society: How good is Twitter at telling the Truth? , 23 4 Truth in history: the teaching of WW2 in Japan , 24 4 TRUTH AND POWER: EDUCATION UNDER HITLER , 25 4 Issues in Interdisciplinarity 2018-19/Truth and Art

Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Quinta-feira, 31 de janeiro 2019 21:14 (final run)

Dump file enwikibooks-20190101-stub-meta-history.xml.gz (edits only), size 180 Mb as gz -> 1.3 Gb
Dump processed till Dec 31, 2018, on server stat1007, ready at Sat-05/01/2019-16:47 after 11 min, 41 sec.

Autor:Erik Zachte (2002-Jan 2019) (Sítio web)
Endereço:erikzachte@### (no spam: ### = infodisiac.com)
Documentation / Scripts / CSV files: About WikiStats

You can download the English version of these reports here (also download common_files.zip)
You can download aggregated data here

All data and images on this page are in the public domain.