Estatísticas da Wikilivros galego

Zoom           
 
Monthly counts & Quarterly rankings / Editor activity levels / Distribution of article edits / Most prolific active and inactive registered contributors, anonymous contributors and bots / Records per namespace / Most edited articles / Zeitgeist
 
Jan 31, 2019: This is the final release of Wikistats-1 dump-based reports. Part of these data are available in the first release of Wikistats 2. Read more here

 

Metrics have been collected from a partial dump (aka stub dump), which contains all revisions of every article, meta data, but no page content.
Note that article and editor counts for all months are a few percent higher than when a full archive dump had been processed.
This is because no page content was available to check for internal or category links.
See also metrics definitions


 
Monthly counts & Quarterly rankings: dezembro 2018
 
DataWikiautoresArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100ediçõesbytes
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P__
dez 201818 1 1,3 k 6,9 10      146
nov 201818   1,3 k 6,9 2      146
out 201818   1,3 k 6,9 5      146
set 201818   1,3 k 6,9 1      146
ago 201818   1,3 k 6,9 3      146
jul 201818   1,3 k 6,9 2      146
jun 201818 1 1,3 k 6,9 11      146
mai 2018181  1,3 k 6,8 11      146
abr 201817   1,3 k 6,8 8      146
mar 201817   1,3 k 6,8 9      146
fev 201817   1,3 k 6,8 3      146
jan 201817   1,3 k 6,8 3      146
dez 201717   1,3 k 6,8 2      146
nov 201717   1,3 k 6,8 25      146
out 201717   1,3 k 6,8 2      146
set 201717   1,3 k 6,8        146
ago 201717   1,3 k 6,8 5      146
jul 201717   1,3 k 6,8        146
jun 201717   1,3 k 6,8 24      146
mai 201717   1,3 k 6,8 41      146
abr 201717   1,3 k 6,7 1      146
mar 201717   1,3 k 6,7 3      146
fev 201717 1 1,3 k 6,7 10      146
jan 201717   1,3 k 6,7 6      146
dez 201617   1,3 k 6,7        146
nov 201617   1,3 k 6,7        146
out 201617   1,3 k 6,7 3      146
set 201617   1,3 k 6,7        146
ago 201617   1,3 k 6,7        146
jul 201617   1,3 k 6,7 3      146
jun 201617 1 1,3 k 6,7 14      145
mai 201617   1,3 k 6,7 9      145
abr 201617 1 1,3 k 6,7 19      145
mar 201617 1 1,3 k 6,7 9      145
fev 201617   1,3 k 6,7 4      145
jan 201617 211,3 k 6,7 1,3 k      145
dez 201517   1,3 k 5,7 3      145
nov 201517   1,3 k 5,7 7      145
out 201517   1,3 k 5,7 4      145
set 201517   1,3 k 5,6 5      145
ago 201517 1 1,3 k 5,6 8      145
jul 201517   1,3 k 5,6 5      145
jun 201517   1,3 k 5,6 1      145
mai 201517   1,3 k 5,6 6      145
abr 201517   1,3 k 5,6 11      145
mar 20151711 1,3 k 5,61693403,1 Mb302 k2,3 k230754225145
fev 201516 1 1,3 k 5,61688283,1 Mb300 k2,3 k231754224145
jan 201516   1,3 k 5,6168833,1 Mb299 k2,3 k233754223145
dez 201416 1 1,3 k 5,6168793,1 Mb299 k2,3 k233754223145
nov 201416   1,3 k 5,61688113,1 Mb299 k2,3 k233754223145
out 201416   1,3 k 5,6168723,1 Mb299 k2,3 k233754223145
set 201416   1,3 k 5,6168723,1 Mb299 k2,3 k233754223145
ago 201416 1 1,3 k 5,61687203,1 Mb299 k2,3 k233754222145
jul 201416 1 1,3 k 5,61687453,1 Mb299 k2,3 k261755223145
jun 201416   1,3 k 5,61692113,1 Mb299 k2,3 k261752222143
mai 201416 1 1,3 k 5,51684923,1 Mb298 k2,3 k260752210143
abr 201416 111,2 k15,516491503,0 Mb290 k2,3 k260496175143
mar 201416 1 1,2 k15,51626972,9 Mb282 k2,3 k260301175143
fev 201416   1,2 k 5,5164682,9 Mb281 k2,3 k260217175143
jan 201416   1,2 k 5,51646182,9 Mb281 k2,3 k260217175143
dez 201316   1,2 k 5,41646122,9 Mb281 k2,3 k260217175143
nov 201316   1,2 k 5,4164682,9 Mb281 k2,3 k260217175143
out 201316   1,2 k 5,4164682,9 Mb281 k2,3 k260217175143
set 201316 2 1,2 k 5,41646182,9 Mb281 k2,3 k260217175143
ago 201316 1 1,2 k15,41621682,9 Mb275 k2,1 k260217171143
jul 201316   1,2 k 5,5162942,8 Mb270 k2,0 k260217164142
jun 201316 1 1,2 k 5,51629202,8 Mb270 k2,0 k260217164142
mai 201316   1,2 k 5,51628152,8 Mb270 k2,0 k260217164142
abr 201316   1,2 k 5,4162832,8 Mb270 k2,0 k260217164142
mar 201316   1,2 k 5,41628232,8 Mb270 k2,0 k260217164142
fev 201316   1,2 k 5,4162852,8 Mb270 k2,0 k260217164142
jan 201316   1,2 k 5,4162832,8 Mb270 k2,0 k260217164142
dez 201216   1,2 k 5,41628 2,8 Mb270 k2,0 k260218164142
nov 201216   1,2 k 5,4162852,8 Mb270 k2,0 k260218164142
out 2012161  1,2 k 5,4162832,8 Mb270 k2,0 k260218164142
set 201215   1,2 k 5,4162812,8 Mb270 k2,0 k260218164142
ago 201215   1,2 k 5,4162862,8 Mb270 k2,0 k260218164142
jul 201215 1 1,2 k 5,41628832,8 Mb270 k2,0 k260218164142
jun 201215 1 1,2 k 5,3162892,8 Mb270 k2,0 k260218164142
mai 201215 2 1,2 k 5,31628352,8 Mb270 k2,0 k260218164140
abr 201215 1 1,2 k 5,31630222,8 Mb270 k2,0 k260218163140
mar 201215   1,2 k 5,31631192,8 Mb269 k2,0 k260218163139
fev 2012151  1,2 k 5,3162842,8 Mb269 k2,0 k260218163139
jan 201214 1 1,2 k 5,31628212,8 Mb269 k2,0 k260218163139
dez 201114 1 1,2 k 5,31628262,8 Mb269 k2,0 k260218163130
nov 201114   1,2 k 5,3162992,8 Mb269 k2,0 k260218163130
out 201114 1 1,2 k 5,21629192,8 Mb269 k2,0 k260218163130
set 201114   1,2 k 5,2163162,8 Mb269 k2,0 k258218163129
ago 201114   1,2 k 5,2163132,8 Mb269 k2,0 k258218163129
jul 201114 111,2 k15,216261182,8 Mb269 k2,0 k258218163129
jun 201114 1 1,1 k 5,31657562,8 Mb265 k2,0 k258218163122
mai 201114   1,1 k 5,2167072,8 Mb264 k2,0 k258218162119
abr 201114 1 1,1 k 5,21668292,8 Mb263 k2,0 k258218159119
mar 201114 111,1 k55,316755142,8 Mb262 k1,9 k258218153119
fev 201114 2 967 5,61853792,6 Mb243 k1,6 k254219146117
jan 201114   956 5,6184252,6 Mb238 k1,6 k253219146117
dez 201014 1 956 5,61842362,6 Mb238 k1,6 k253218146117
nov 201014 2195435,518212352,5 Mb235 k1,6 k249218143116
out 20101412 874 5,81992602,5 Mb230 k1,7 k249210138111
set 201013 1 869 5,71947362,4 Mb224 k1,7 k249210138111
ago 201013 3 857 5,81955822,4 Mb220 k1,7 k249210133110
jul 201013 1 843 5,81934412,4 Mb213 k1,6 k248210133109
jun 201013121835 5,818861922,3 Mb205 k1,6 k243210119109
mai 201012 11825 5,619161292,3 Mb200 k1,7 k24321014187
abr 201012 2181415,518365252,2 Mb188 k1,6 k24321014186
mar 201012 1177235,220165492,0 Mb169 k1,5 k23121013454
fev 201012 1166925,119731451,7 Mb141 k1,3 k22921013143
jan 201012 1162415,319261611,7 Mb134 k1,2 k22821012941
dez 200912 1159015,319393741,6 Mb128 k1,1 k22321012535
nov 2009121215512519332961,5 Mb119 k1,0 k22321012129
out 200911 1 505 4,91994531,4 Mb115 k88522321014326
set 200911 1 49014,91986521,4 Mb112 k82422321014226
ago 200911   471 5205821,4 Mb110 k79921521014225
jul 200911   471 5205891,4 Mb110 k79921521014225
jun 200911 2 470 52054421,4 Mb109 k79621521014225
mai 200911 1146514,920422181,4 Mb107 k77620421013925
abr 200911 1 444 4,72065481,3 Mb98 k72917521010322
mar 200911   440 4,6214641,3 Mb97 k6701622109913
fev 200911   440 4,62146101,3 Mb97 k6701622109913
jan 200911   439 4,6214791,3 Mb97 k6711622109913
dez 200811 2 439 4,62147731,3 Mb97 k6711622109913
nov 200811   431 4,5244291,3 Mb96 k6241622109813
out 200811 2 431 4,52474181,3 Mb98 k6261612109813
set 200811   430 4,4247981,3 Mb97 k6251492119813
ago 200811 1 430 4,42479561,3 Mb97 k6251492119813
jul 200811 1 428 4,32365101,2 Mb92 k5981452119712
jun 200811 2 42714,32357951,2 Mb91 k5871442119512
mai 200811 1 407 4,32317281,2 Mb89 k5721402117312
abr 200811   404 4,2230691,2 Mb87 k5411402115412
mar 20081112 404 4,22306341,2 Mb87 k5411402115312
fev 200810 1 401 4,22300311,2 Mb86 k5391302115512
jan 200810   388 4,22302131,2 Mb86 k5391302115512
dez 200710 1 388 4,22301221,2 Mb86 k5391302115612
nov 200710 2 383 4,22347261,2 Mb85 k5371302115611
out 200710   383 4,1234671,2 Mb85 k5371302115611
set 200710 1 383 4,12346441,2 Mb85 k5371302115610
ago 200710   368 4,2249481,2 Mb85 k535130197569
jul 2007101  368 4,1249571,2 Mb85 k535130197569
jun 20079 1 368 4,1249491,2 Mb85 k535130197569
mai 20079 1 368 4,12494171,2 Mb85 k535130197569
abr 20079   368 42505171,2 Mb85 k535131197569
mar 20079   367 42522121,2 Mb85 k523131197569
fev 2007911 367 42522361,2 Mb85 k523130197569
jan 20078   362 3,92520231,2 Mb85 k520130197529
dez 20068   362 3,92529101,2 Mb85 k519130197529
nov 2006821 361 3,82529191,2 Mb85 k519130197529
out 20066   359 3,8252781,2 Mb84 k518130197529
set 20066   359 3,8252781,2 Mb84 k518130197529
ago 20066   359 3,8252751,2 Mb84 k518130197529
jul 20066 1 359 3,82527131,2 Mb84 k518130197529
jun 20066 1 355 3,82536191,2 Mb84 k517130196529
mai 20066 1 351 3,82554201,2 Mb83 k515130190429
abr 20066 1 350 3,72526361,2 Mb82 k513130185429
mar 20066 1 343 3,72458301,1 Mb77 k509130174419
fev 20066 2133933,624832821,1 Mb76 k501130170419
jan 2006613125923,72358312879 kb48 k365130104418
dez 20055 2119443,32555344669 kb58 k41411758467
nov 2005511 7613,9304189380 kb19 k2381158336
out 2005412 38 5,4245236227 kb14 k2141153314
set 20053   23 7,332784204 kb10 k341152162
ago 20053 1 23 7,1323933203 kb10 k341152162
jul 20053 1 16 8,2324030169 kb7,0 k15105 161
jun 20053   14 7,234922162 kb6,9 k10105 16 
mai 2005311 14 7,1342921161 kb6,8 k10105 8 
abr 20052   11 7,137162131 kb6,8 k9105 9 
mar 20052   11 6,937132131 kb6,8 k9105 9 
fev 20052   11 6,73741 131 kb6,8 k9105 11 
jan 20052   11 6,737417131 kb6,8 k9105 11 
dez 20042   11 6,13737 131 kb6,8 k9105 11 
nov 20042 1 11 6,1373738131 kb6,8 k9105 11 
out 2004211 4 7,2820225117 kb5,4 k1106 12 
set 20041   1 470632,1 kb105 106 11 
ago 20041   1 1445 1,8 kb77 106 9 
jul 200411  1 144511,8 kb77 106 9 
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternas

projects
> 5> 100ediçõesbytes
The following table ranks this project in relation to projects in other languages with 1000+ articles
out 201850   32 26 47      71
jul 201850   32 26 47      71
abr 201851   32 26 40      71
jan 201849   32 26 46      71
out 201748   32 26 51      71
jul 201748   32 26        71
abr 201748   31 26 59      71
jan 201748   30 27 43      71
out 201647   29 26 51      71
jul 201647   29 26 48      71
abr 201647 33 29 26 39      71
jan 201647 312028 26 6      71
out 201547   27 29 52      71
jul 201547   27 29 46      71
abr 201547   27 29 43      71
jan 201546244015271529295048393244214571
out 201446173713271228285348392944204571
jul 201446223315271128282447392941204571
abr 201446273917271728282249392941264771
jan 201445224316271527273949402841364671
out 201344284016251226274448402841354571
jul 201343163711261326284248402939354471
abr 201342264216251626285148402839354471
jan 201342284313241426265248402840354271
out 201242184015241425255145402839344271
jul 201242193617241624252745392840334271
abr 201242253319231724253843382840324271
jan 201243313820232023234342352539324270
out 201142213516221723223842342337324270
jul 201142203912221323222142332236314070
abr 201141253314231922213341322135303970
jan 201140243815271925254541322235293970
out 201040192614261625252640302235293870
jul 201041243413261723233039322235283870
abr 201041262915261823231440312135263670
jan 201041243616291722222040392336273870
out 200943263617302221212742383036253570
jul 200943263814301521214042383036253570
abr 200941283316311919193141403240253970
jan 200940294016301915154341383239243870
out 200840242817291715153942363337233870
jul 200836233115272114144341363437223870
abr 200834284518272214144741363437223970
jan 200834294313261514144341353235213970
out 200734284716241714145034333033193870
jul 200734294121232014144434302833193770
abr 200734294019232312123834282631183570
jan 200734304015192112123731262328183470
out 200634293817181910103929262126153270
jul 200632293119152510103727262026153169
abr 2006312631141319772623231623122969
jan 20062921178139661024271721142669
out 2005301520133319552632312223322768
jul 200529192583314552331313440383368
abr 200533202763117444026273541333968
jan 200524202072210332222232738242766
out 200419151962311221917203222162058
jul 20042520133236222527251812111830
 totalnovosediçõescontagemnovos
por dia
médiaediçõestamanhopalavrasinternasinterwikiimagemexternasprojects
> 5> 100ediçõesbytes
 WikiautoresArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

See also Metrics definitions

Wikiautores (usuários registrados)
A = Wikiautores que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikiautores que editaram pelo menos dez vezes desde que chegaram
C = Wikiautores que contribuíram cinco vezes ou mais este mês
D = Wikiautores que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Novos artigos por dia no mês passado
G = Número médio de revisões por artigo
H = Tamanho médio dos artigos em bytes

Base de dados
I = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
J = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
K = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
L = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
M = Total de ligações para outras wikipédias
N = Total de imagens apresentadas
O = Total de ligações para outros sítios
P = Total de páginas de redirecionamento
 


Edit activity levels of registered users and bots per group of namespaces

Articles = namespace 0 - Talk pages = namespaces 1 3 5 7 etc - Other pages = namespaces 2 4 6 8 etc.

  Articles  Talk  Other 
  Users   Bots   Users   Bots   Users   Bots  
Edits ≥ 1  3  5  10  25  100  250  5  10  100  1  3  5  10  5  10  1  3  5  10  25  100  250  5  10  100 
dez 2018211                   1  
nov 20181                       
out 201811            2         
set 20181                       
ago 201811            1         
jul 20181             1         
jun 2018211                      
mai 20182             1         
abr 201831            1         
mar 201811                      
fev 20182             11        
jan 20181                       
dez 2017        1     11        
nov 20171                       
out 20171             1         
set 2017              1         
ago 201721      1               
jul 2017              1         
jun 201732            2111   1  
mai 201721                   1  
abr 2017              1         
mar 2017                        
fev 2017211            51        
jan 20171                       
out 201811            2         
jul 20181             1         
abr 201831            1         
jan 20181                       
out 20171             1         
jul 2017              1         
abr 2017              1         
jan 20171                       
out 2016        1               
jul 20162                       
abr 20161111  1        32111  11 
jan 201622211111111     321111111 
out 2015              4111   1  
jul 20152       1     411       
abr 20151           224211   1  
jan 20151       11    51        
out 20141             211       
jul 201411111          32211     
abr 2014721111    2221  10321      
jan 20142       1     321       
out 20131       1     51        
jul 2013        1     71        
abr 20131             7221      
jan 20131             21        
out 20121       3     8621   1  
jul 201221111          51111  1  
abr 20123211     11    732       
jan 20124111           21     11 
out 2011421      2     1052       
jul 2011311111          531111    
abr 201131111    1     411       
jan 20111             4         
out 201022221    1     731       
jul 201011111    1     322       
abr 20103221111   1     5211      
jan 2010211111    3     4211      
out 200911111          2         
jul 200911            41        
abr 200922111    1     732       
jan 2009              522       
out 2008322      1     5331      
jul 2008111            5331      
abr 20081             4111      
jan 20082       1     3         
out 20073       2     711       
jul 20073       1     311       
abr 200741            321       
jan 200751      21    221       
out 200611            321       
jul 20061111           32        
abr 20063111     21    21        
jan 20069432111   82    63211     
out 20053321     1     411       
jul 200511111                 111
abr 20051                       
jan 20054             2221      
out 200411111          1         
jul 20041                       

 

Distribuição de edições de artigos por wikiautores
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...
 

Edições >=WikiautoresEdições total
1124100.0%7,094100.0%
34233.9%6,97298.3%
101713.7%6,83496.3%
3297.3%6,71294.6%
10064.8%6,51791.9%
31632.4%6,12986.4%
100021.6%5,46977.1%
316210.8%4,05657.2%

 

2 wikiautores recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesCreates
 posiçãoArtigosOutrosPrimeira ediçãoArtigosOutros
User
Contributions
agoraΔtotalúltimos
30 dias
totalúltimos
30 dias
datadias
atrás
totalúltimos
30 dias
totalúltimos
30 dias
GlampusUC34...55--dez 15, 201815----
1997kBUC124...11--dez 15, 201815----

 

20 wikiautores recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
 CountsPrimeira ediçãoúltima edição
User
Contributions
posiçãototaldatadias
atrás
datadias
atrás
GallaecioUC14,056mar 02, 20083955set 01, 20131946
LmbugaUC21,413nov 21, 20054787out 06, 2017450
BanjoUC3660fev 26, 20074325fev 10, 2017688
SobreiraUC4173fev 24, 20074327fev 08, 2018325
AgremonUC5108set 03, 20045231abr 16, 2018258
HombreDHojalataUC6107mar 09, 20112853mai 11, 2018233
FuragaitasUC783jun 24, 20103111jul 12, 2016901
RocasteloUC878mai 14, 20054978jan 17, 20064730
PrevertUC934jan 24, 20055088mai 24, 20093507
Xelo2004~glwikibooksUC1026out 16, 20054823jan 20, 20074362
Xoán Carlos FragaUC1120out 16, 20054823out 15, 20074094
XoioUC1220ago 19, 2017498out 31, 201860
Quentinv57UC1313out 23, 20102990out 23, 20102990
XoséUC1412abr 12, 20055010fev 29, 20083957
ElvireUC1511abr 19, 20093542out 16, 20112632
Moderador~glwikibooksUC1610mai 08, 20064619mai 27, 20074235
MorzaUC1710mai 28, 20103138nov 16, 20102966
Alguén~glwikibooksUC189mai 17, 20054975jun 13, 20064583
BasilioUC199nov 16, 20064427mar 19, 20074304
PmlineditorUC209nov 09, 20093338nov 09, 20093338

 

Anonymous users

No detailed statistics for anonymous users are available for this wiki (performance reasons)

No total 956 edições foram feitas por usuários anônimos, de um total de 8710 edições ( 10e %)
  


8 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesCreates
 posiçãototalPrimeira ediçãoúltima ediçãototalúltimos
30 dias
User
Contributions
datadias
atrás
datadias
atrás
BanjoBot 2.0UC1646jan 12, 20161083abr 19, 2016985--
VolkovBotUC23dez 29, 20074019jan 24, 20122532--
タチコマ robotUC33ago 18, 20112691ago 18, 20112691--
DexbotUC43fev 26, 20151403mar 01, 20151400--
BanjoBotUC52dez 09, 20074039dez 09, 20074039--
PrebotUC61set 28, 20064476set 28, 20064476--
SpBotUC71set 18, 20083755set 18, 20083755--
JackBotUC81ago 03, 20141610ago 03, 20141610--

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110GifJpgPng
dez 20181,4 k366311094972661305       166132
nov 20181,4 k366311094972661305       166132
out 20181,4 k366311094972661305       166132
set 20181,4 k365311094972661305       166132
ago 20181,4 k365311094972661305       166132
jul 20181,4 k364311094972661305       166132
jun 20181,4 k364311094972661305       166132
mai 20181,4 k364311094972661305       166132
abr 20181,4 k364311094972661305       166132
mar 20181,4 k364311094972661305       166132
fev 20181,4 k364311094972661305       166132
jan 20181,4 k362311094972661305       166132
dez 20171,4 k362311094972661305       166132
nov 20171,4 k360311094972661305       166132
out 20171,4 k360311094972661305       166132
set 20171,4 k360311094972661305       166132
ago 20171,4 k359311094972661305       166132
jul 20171,4 k359311094972661305       166132
jun 20171,4 k359311094972661305       166132
mai 20171,4 k358301094972661305       166132
abr 20171,4 k358301094972661305       166132
mar 20171,4 k358301094972661305       166132
fev 20171,4 k358301094972661305       166132
jan 20171,4 k356291094972661305       166132
dez 20161,4 k356291094972661305       166132
nov 20161,4 k356291094972661305       166132
out 20161,4 k356291094972661305       166132
set 20161,4 k356291094972661305       166132
ago 20161,4 k356291094972661305       166132
jul 20161,4 k355291094972661305       166132
jun 20161,4 k355291094972661305       166132
mai 20161,4 k355291094972661305       166132
abr 20161,4 k355281094972661305       166132
mar 20161,4 k355281094972581305       166132
fev 20161,4 k355281094972581305       166132
jan 20161,4 k355281094972581303       166132
dez 20151,4 k354211094772461224       166132
nov 20151,4 k351211094772461224       166132
out 20151,4 k351211094772461224       166132
set 20151,4 k351211094752391224       166132
ago 20151,4 k351211094752391224       166132
jul 20151,4 k351211094742381224       166132
jun 20151,4 k350211094732381224       166132
mai 20151,4 k350211094732381224       166132
abr 20151,4 k350211094712371224       166132
mar 20151,4 k349211094662371224      32166132
fev 20151,4 k347201094652311220      17166132
jan 20151,4 k341201094652311220      1166132
dez 20141,4 k338201094652311220      7166132
nov 20141,4 k338201094652311220      6166132
out 20141,4 k337201094652311220      1166132
set 20141,4 k337201094652301220      2166132
ago 20141,4 k333201094652301220      18166132
jul 20141,4 k331201094652301220      45166132
jun 20141,4 k331201094632041214      10166132
mai 20141,4 k331201094632041214      77166132
abr 20141,4 k331201094632041214      147166132
mar 20141,4 k328201094632031214      90166132
fev 20141,4 k324191094632031213      6166132
jan 20141,4 k321191094632031213      2166132
dez 20131,4 k318191094632031213      4166132
nov 20131,4 k317191094632031213      4166132
out 20131,4 k312191094632031213      1166132
set 20131,4 k309191094632031213      18166132
ago 20131,3 k294191094632031213      67166132
jul 20131,3 k292191094632021201       166132
jun 20131,3 k289191094632021201      18166132
mai 20131,3 k288181094622021201       166132
abr 20131,3 k287181094592021201      2166132
mar 20131,3 k283181094592021201      8166132
fev 20131,3 k278181094562021201       166132
jan 20131,3 k272181094561991201      1166132
dez 20121,3 k271181094561991201       166132
nov 20121,3 k267181094561971201      1166132
out 20121,3 k267181094561951201      2166132
set 20121,3 k263181094521941199       166132
ago 20121,3 k260171094501931199      2166132
jul 20121,3 k257171094501911199      37166132
jun 20121,3 k256171094501901199      5166132
mai 20121,3 k250171094491891199      23166132
abr 20121,3 k246171094491871199      15166132
mar 20121,3 k241171094491841192      6166132
fev 20121,3 k240171094491841192      3166132
jan 20121,3 k232171094491841192      16166132
dez 20111,3 k230171094481841192      17166132
nov 20111,3 k226171094481841187      3166132
out 20111,3 k213161094451821187      10166132
set 20111,3 k208151094451801182      5166132
ago 20111,3 k205151094441801175       166132
jul 20111,3 k201151094361801175      114166132
jun 20111,3 k19215109436173191      48166132
mai 20111,3 k18815109435169191      4166132
abr 20111,3 k18415109435166191      28166132
mar 20111,2 k17815109435166190      499166132
fev 20111,1 k17815109434162188      60166132
jan 20111,1 k17315109434160186      1166132
dez 20101,1 k17015109434160186      17166132
nov 20101,1 k16915109434160185      216166132
out 201098516715109434158169      57166132
set 201098016415109434156168      33166132
ago 201096715915109434153166      80166132
jul 201095214315109434153166      39166132
jun 201094414315109434150165      185166132
mai 201091213215109434149162      116166132
abr 201090013015109434149160      519166132
mar 201082612515109434149149      538166132
fev 201071212315109434149136      133166132
jan 201066512115109434148136      158166132
dez 200962510915109434148136      364166132
nov 200958010815109434148134      262166132
out 200953110715109434148134      45166132
set 200951610715109434148134      48166132
ago 200949610315109434148122      1166132
jul 200949610315109434148122      4166132
jun 200949510115109434148122      37166132
mai 200949010015109432146121      213166132
abr 20094669815109432145114      47166132
mar 20094539015109432145114      1166132
fev 20094538615109432145114       166132
jan 20094528215109431144114       166132
dez 20084528215109431143114      73166132
nov 20084448115109431115113      1166132
out 20084446914109431114113      15166132
set 20084436014109429114113      4166132
ago 20084436014109428113113      51166132
jul 20084405814109428112113      9166132
jun 20084395714109428112 13      80166132
mai 20084195314109426104 13      14166132
abr 20084164714109425103 13      1166132
mar 20084164714109424103 13      17166132
fev 20084134013109424103 8      26166132
jan 2008400401310942472 7      2166132
dez 2007400391310942472 7      16166132
nov 200739436138342368 7      1216616
out 200739431108342357 3      316616
set 200739328108342357 3      3616616
ago 200737725108342056 3      216616
jul 200737724108341956 3      316616
jun 20073772478341855 3      716616
mai 20073772378341755 3      1016616
abr 20073772378341555 3      816616
mar 20073762378341352 3      616616
fev 20073762278341252 3      3016616
jan 20073711678341236 2      816616
dez 20063711578340933 2      616616
nov 20063701378340533 2      1116616
out 20063681378340533 2      316616
set 20063681378340533 2      216616
ago 20063681378340133 2      416616
jul 20063681378340033 2      1216616
jun 20063641378339632 2      1416616
mai 20063601378339532 2      1416616
abr 20063591378339331 2      2516616
mar 20063521368339130 2      1616616
fev 20063481368339130 2      26116616
jan 20062671166538826 2      30916472
dez 200520186483878 2      331 462
nov 2005826353684 1      86 32
out 2005422 33624          12
set 2005251 23624           2
ago 2005251 23584           2
jul 2005171  3564            
jun 2005141  2974            
mai 2005141  2964            
abr 2005111  2961            
mar 2005111  2961            
fev 2005111  2961            
jan 2005111  2961            
dez 2004111  2961            
nov 2004111  31            
out 200441  3             
set 20041   3             
ago 20041   3             
jul 20041   3             

 

Most edited articles

Table out of order. Data collection needs to be revised.
For some projects up to date and much more extensive database reports are published from the toolserver, e.g. for English Wikipedia and Wikimedia Commons

 


ZeitGeist

For each month articles with most contributors in that month are shown.
x y z    ⇐    x = rank, y = contributors in that month, z = article title

jul 2004: 1 1 Portada

set 2004: 1 1 Portada

out 2004: 1 1 Portada

nov 2004: 1 1 Portada

jan 2005: 1 4 Portada

abr 2005: 1 1 Portada

mai 2005: 1 1 Portada

jun 2005: 1 1 Tradución de programas ó galego

jul 2005: 1 1 Portada

ago 2005: 1 1 Portada

set 2005: 1 1 Blender 3D: de novato a profesional/Sistema de ventás de Blender

out 2005: 1 3 Receitas de filloas/Filloas de anís , 2 2 Receitas de filloas/Filloas de centeo , 3 2 Cociña/Filloas de caldo , 4 1 Portada

nov 2005: 1 1 Portada

dez 2005: 1 4 Portada , 2 2 Wikibooks/axuda/índice , 3 2 Dicionario inglés-galego de termos informáticos

jan 2006: 1 3 Portada , 2 2 Destrozando palabras , 3 2 Phishing

fev 2006: 1 1 Portada

mar 2006: 1 1 Exercicios de morfosintaxe en lingua galega/demostrativo/Encrucillado 2

abr 2006: 1 2 Phishing , 2 1 Portada

mai 2006: 1 1 O corpo humano

jun 2006: 1 1 Exercicios de léxico en lingua galega/Sopas/B-V

jul 2006: 1 1 Portada

ago 2006: 1 1 Literatura/Linguaxe científica versus linguaxe literaria

set 2006: 1 1 Phishing

out 2006: 1 1 Exercicios de morfosintaxe en lingua galega/substantivo/Xénero

nov 2006: 1 2 Cociña/Polbo á feira , 2 1 Portada

dez 2006: 1 1 Cociña/Revolto de cogomelos e grelos

jan 2007: 1 2 Cociña/Polbo á feira

fev 2007: 1 2 Cociña/Polbo á feira , 2 1 Destrozando palabras

mar 2007: 1 2 Cociña/Polbo á feira

abr 2007: 1 3 Polbo á mugardesa , 2 1 Cociña/Polbo á feira

mai 2007: 1 2 Polbo á mugardesa , 2 1 Cociña/Polbo á feira

jun 2007: 1 2 Exercicios de léxico en lingua galega/Fraseoloxía , 2 1 Exercicios de morfosintaxe en lingua galega/substantivo/Concretos e abstractos

jul 2007: 1 1 Phishing

ago 2007: 1 1 Termodinámica/1ª lei/Termoquímica

set 2007: 1 1 Portada

out 2007: 1 1 Phishing

nov 2007: 1 1 Euskara

dez 2007: 1 1 Destrozando palabras

jan 2008: 1 1 Phishing

fev 2008: 1 1 Euskara/Capítulo 16

mar 2008: 1 1 C/Características

abr 2008: 1 1 Administración do tempo/Desaproveitando o tempo

mai 2008: 1 1 C/Compilar un programa

jun 2008: 1 2 C , 2 1 C/Requisitos

jul 2008: 1 1 C/Estrutura e estilo

ago 2008: 1 1 C/Variables

set 2008: 1 1 C

out 2008: 1 1 Comentarios literarios de poesía/Figuras estilísticas de Chove, chove... de Celso Emilio Ferreiro

nov 2008: 1 1 Portada

dez 2008: 1 1 VirtualBox/Compartir cartafoles

mar 2009: 1 1 Alemán

abr 2009: 1 2 HTML/Introdución , 2 1 Programación en C/Variables

mai 2009: 1 1 PHP/PHP vs ASP

jun 2009: 1 2 CSS , 2 1 Lectoescritura/A lectura/Procedemento fonolóxico versus procedemento léxico

jul 2009: 1 1 Gettext/Ficheiros

ago 2009: 1 1 Curso de lingua galega/Catro normas para falar e escribir

set 2009: 1 1 Programación en linguaxes estruturadas/Algoritmo e programa

out 2009: 1 1 PhpMyAdmin/Instalación

nov 2009: 1 1 Formación e orientación laboral/O contrato de traballo

dez 2009: 1 1 Phishing

jan 2010: 1 1 Bash/sort

fev 2010: 1 1 C/Historia

mar 2010: 1 2 GNU Linux/dev , 2 1 Gettext/msgfmt

abr 2010: 1 2 C/strcmp , 2 1 Rsync

mai 2010: 1 1 GNU patch

jun 2010: 1 1 HTML/Aprendizaxe

jul 2010: 1 1 C/stdint.h

ago 2010: 1 3 C/Nomear tipos , 2 2 HTML/Editores de texto , 3 2 Bash/poweroff , 4 2 GNU Linux/boot , 5 1 C/setjmp.h

set 2010: 1 1 Proxecto integrado/Ciclo superior de Desenvolvemento de aplicacións informáticas

out 2010: 1 1 Portada

nov 2010: 1 2 Curso de lingua galega/A acentuación/Acentuar ditongos e hiatos , 2 1 Microsoft Visual Basic 6/Crear controis de usuario

dez 2010: 1 1 Lua

jan 2011: 1 1 Phishing

fev 2011: 1 2 Exercicios de morfosintaxe en lingua galega/persoal/te-che , 2 1 JavaScript/Operadores

mar 2011: 1 1 PHP/preg match()

abr 2011: 1 3 Curso de lingua galega/O verbo/Paradigma dos verbos regulares , 2 1 CMake/include directories

mai 2011: 1 1 C++

jun 2011: 1 1 C++/Clases

jul 2011: 1 1 Cociña/Arroz cocido

set 2011: 1 1 Cociña/Paella sen marisco

out 2011: 1 1 Portada

nov 2011: 1 1 Lixo

dez 2011: 1 2 SQL , 2 1 Cociña/Medidas

jan 2012: 1 1 Phishing

fev 2012: 1 1 Cociña/Fajitas

mar 2012: 1 1 Phishing

abr 2012: 1 2 Exercicios de morfosintaxe en lingua galega/persoal/Colocación , 2 2 Exercicios de morfosintaxe en lingua galega/persoal/te-che , 3 1 Cociña/Albóndegas en salsa

mai 2012: 1 2 Cociña/Proia manteigada , 2 1 Phishing

jun 2012: 1 1 Albóndegas

jul 2012: 1 1 Phishing

ago 2012: 1 1 Phishing

out 2012: 1 1 Filloa

nov 2012: 1 1 Phishing

jan 2013: 1 1 Curso de lingua galega/O persoal/Átono/Uso de \"te\" e \"che\"

mar 2013: 1 1 Phishing

abr 2013: 1 1 Exercicios de ortografía en lingua galega/b-v

jun 2013: 1 1 Exercicios de morfosintaxe en lingua galega/verbo/Infinitivo conxugado

ago 2013: 1 1 Portada

set 2013: 1 2 Expoñentes , 2 1 Portada

out 2013: 1 1 Exercicios de morfosintaxe en lingua galega/substantivo/Número

nov 2013: 1 1 Phishing

dez 2013: 1 3 Exercicios de morfosintaxe en lingua galega/artigo , 2 1 Exercicios de morfosintaxe en lingua galega/substantivo/Xénero

jan 2014: 1 1 Euskara

fev 2014: 1 1 Exercicios de morfosintaxe en lingua galega/substantivo/Número

mar 2014: 1 2 Portada

abr 2014: 1 4 Dourado á auga , 2 2 Portada

mai 2014: 1 2 Portada , 2 2 Exercicios de morfosintaxe en lingua galega/persoal/te-che

jun 2014: 1 2 Phishing

jul 2014: 1 1 Portada

ago 2014: 1 1 Portada

set 2014: 1 1 Vigo señorial

out 2014: 1 1 Phishing

nov 2014: 1 1 Vigo marítimo

dez 2014: 1 2 Peras ao viño

jan 2015: 1 1 Dourado á auga

fev 2015: 1 1 Inmersión na lingua galega/Árabe/Vocabulario 2

mar 2015: 1 1 JavaScript/String

abr 2015: 1 1 Exercicios de morfosintaxe en lingua galega/persoal/Colocación

mai 2015: 1 1 Vigo señorial

jun 2015: 1 1 Curso de lingua galega/A interxección

jul 2015: 1 1 Vigo señorial

ago 2015: 1 1 Exercicios de Fonética e Fonoloxía/Consonantismo

set 2015: 1 1 Euskara/Vocabulario de euskara

nov 2015: 1 1 A ciencia ten nome de muller

dez 2015: 1 1 Sintaxe da lingua galega/Cuestionario sobre o atributo e o complemento predicativo

jan 2016: 1 2 Sintaxe da lingua galega/O atributo , 2 1 Portada

fev 2016: 1 1 Portada

mar 2016: 1 1 Vigo marítimo

abr 2016: 1 1 Portada

mai 2016: 1 2 Destrozando palabras

jun 2016: 1 1 Programación

jul 2016: 1 1 Euskera

jan 2017: 1 1 Exercicios de morfosintaxe en lingua galega/persoal/Colocación

fev 2017: 1 1 Sintaxe da lingua galega/Cuestionario sobre o suplemento

mai 2017: 1 1 Exercicios de morfosintaxe en lingua galega/persoal/Colocación

jun 2017: 1 1 A ciencia ten nome de muller

ago 2017: 1 1 Os cetáceos nalgúns dicionarios galegos

out 2017: 1 1 Novela

nov 2017: 1 1 Historia da lingua

jan 2018: 1 1 Curso de lingua galega/Nexos/Construcións comparativas

fev 2018: 1 1 A ciencia ten nome de muller

mar 2018: 1 1 A ciencia ten nome de muller

abr 2018: 1 1 A ciencia ten nome de muller

mai 2018: 1 1 A ciencia ten nome de muller

jun 2018: 1 2 Exercicios de morfosintaxe en lingua galega/persoal/Colocación

jul 2018: 1 1 A ciencia ten nome de muller

ago 2018: 1 1 A ciencia ten nome de muller

set 2018: 1 1 A ciencia ten nome de muller

out 2018: 1 1 Os cetáceos nalgúns dicionarios galegos

nov 2018: 1 1 Fundamentos físicos da informática

dez 2018: 1 2 Exercicios de morfosintaxe en lingua galega/persoal/te-che

Wikipedias are ordered by hourly page views in recent days
Estatísticas geradas em Quinta-feira, 31 de janeiro 2019 21:14 (final run)

Dump file glwikibooks-20190101-stub-meta-history.xml.gz (edits only), size 886 kb as gz -> 6.4 Mb
Dump processed till Dec 31, 2018, on server stat1007, ready at Sat-05/01/2019-16:15 after 5 sec.

Autor:Erik Zachte (2002-Jan 2019) (Sítio web)
Endereço:erikzachte@### (no spam: ### = infodisiac.com)
Documentation / Scripts / CSV files: About WikiStats

You can download the English version of these reports here (also download common_files.zip)
You can download aggregated data here

All data and images on this page are in the public domain.